F374325

General Info

Members Datasets Scaffolds Average Seq Length
266 149 532 78

Family's Representative Sequence

Representative Sequence 3300048911|Ga0496108_0395412|Ga0496108_0395412_236_511
Length 91
Sequence VPPVAEHSKRRTDMPMPPPKASTEGRRDRQVFHEMGQIIRAVEANGALSVDALRTLVGADYWEAGRFDRALAFAVADGLLFRDPEGRFAAV

Samples

Sample ID Description Type Environment
1 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
16 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
19 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
20 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
21 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
22 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
25 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
26 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
27 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
30 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
50 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
71 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
73 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
74 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
75 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
76 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
77 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
78 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
79 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
80 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
81 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
82 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
83 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
84 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
85 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
86 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
87 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
88 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
89 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
90 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
91 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
92 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
93 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
94 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
95 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
96 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
97 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
98 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
99 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
100 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
101 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
102 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
103 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
104 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
119 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
120 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
121 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
122 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
123 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
124 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
125 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
126 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
127 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
128 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
129 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
130 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
131 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
132 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
133 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
134 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
135 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
137 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
138 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
139 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
140 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
141 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
142 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
143 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
144 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
145 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
146 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
147 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
148 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
149 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.25
Metatranscriptomes 0.75
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.41
Nodule 0
Rhizoplane 2.26
Rhizosphere 81.95
Stem 0
Stem Tuber 0
Unclassified 2.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496108_0395412 3300048911 Bacteria 1207
2 Ga0070683_100149819 3300005329 Bacteria 2212
3 Ga0070683_100360921 3300005329 Bacteria 1384
4 Ga0070670_100721719 3300005331 Bacteria 897
5 Ga0070680_101836111 3300005336 Bacteria 525
6 Ga0070682_100162802 3300005337 Bacteria 1543
7 Ga0068868_100814177 3300005338 Bacteria 843
8 Ga0070687_100247431 3300005343 Bacteria 1106
9 Ga0070687_100355146 3300005343 Bacteria 947
10 Ga0070692_10759932 3300005345 Bacteria 658
11 Ga0070675_101490950 3300005354 Bacteria 624
12 Ga0070659_101546239 3300005366 Bacteria 592
13 Ga0070700_100537303 3300005441 Bacteria 906
14 Ga0070700_101777986 3300005441 Bacteria 530
15 Ga0070663_101522994 3300005455 Bacteria 595
16 Ga0070685_10707139 3300005466 Bacteria 735
17 Ga0070684_101216075 3300005535 Bacteria 709
18 Ga0070664_101320656 3300005564 Bacteria 681
19 Ga0070664_101798981 3300005564 Bacteria 581
20 Ga0068854_101227323 3300005578 Bacteria 673
21 Ga0068856_102478085 3300005614 Bacteria 526
22 Ga0068859_102368135 3300005617 Bacteria 585
23 Ga0068866_10278666 3300005718 Bacteria 1035
24 Ga0068861_102554176 3300005719 Unclassified 514
25 Ga0068851_10107089 3300005834 Bacteria 1489
26 Ga0068870_10656923 3300005840 Bacteria 719
27 Ga0068870_11325935 3300005840 Bacteria 525
28 Ga0068863_101249903 3300005841 Bacteria 749
29 Ga0068862_102269471 3300005844 Unclassified 554
30 Ga0075365_10069609 3300006038 Bacteria 2365
31 Ga0075365_10078002 3300006038 Bacteria 2239
32 Ga0075365_10127707 3300006038 Bacteria 1758
33 Ga0075365_10143916 3300006038 Bacteria 1656
34 Ga0075365_10323399 3300006038 Bacteria 1086
35 Ga0075365_10413076 3300006038 Bacteria 953
36 Ga0075365_10763444 3300006038 Bacteria 683
37 Ga0075365_11023913 3300006038 Bacteria 582
38 Ga0075368_10240352 3300006042 Bacteria 772
39 Ga0075368_10299210 3300006042 Bacteria 694
40 Ga0075363_100087170 3300006048 Bacteria 1715
41 Ga0075363_100190786 3300006048 Bacteria 1169
42 Ga0075364_10071957 3300006051 Bacteria 2278
43 Ga0075364_10183130 3300006051 Bacteria 1418
44 Ga0075364_10209046 3300006051 Bacteria 1323
45 Ga0075364_10306489 3300006051 Bacteria 1081
46 Ga0075362_10076174 3300006177 Bacteria 1539
47 Ga0075367_10265082 3300006178 Bacteria 1079
48 Ga0075367_10599688 3300006178 Bacteria 700
49 Ga0097621_101271972 3300006237 Unclassified 694
50 Ga0075370_10048223 3300006353 Bacteria 2413
51 Ga0075370_10062524 3300006353 Bacteria 2121
52 Ga0075433_10998919 3300006852 Bacteria 729
53 Ga0075434_101058982 3300006871 Bacteria 825
54 Ga0097620_102368478 3300006931 Bacteria 585
55 Ga0111539_11538447 3300009094 Bacteria 771
56 Ga0111539_12910280 3300009094 Bacteria 554
57 Ga0105245_10777092 3300009098 Bacteria 995
58 Ga0105243_10524230 3300009148 Bacteria 1127
59 Ga0105243_11412253 3300009148 Bacteria 717
60 Ga0105243_11489835 3300009148 Bacteria 700
61 Ga0105242_10840167 3300009176 Bacteria 913
62 Ga0105248_12415438 3300009177 Bacteria 599
63 Ga0105238_12241264 3300009551 Bacteria 581
64 Ga0105239_12064079 3300010375 Bacteria 662
65 Ga0105246_10826285 3300011119 Bacteria 824
66 Ga0105246_12204272 3300011119 Bacteria 536
67 Ga0157336_1033657 3300012477 Bacteria 524
68 Ga0157369_11106053 3300013105 Bacteria 810
69 Ga0163162_11192894 3300013306 Bacteria 864
70 Ga0157375_11357228 3300013308 Bacteria 837
71 Ga0163163_10063180 3300014325 Bacteria 3670
72 Ga0163163_11142123 3300014325 Bacteria 842
73 Ga0163163_11392236 3300014325 Bacteria 763
74 Ga0157380_10044024 3300014326 Bacteria 3496
75 Ga0157380_12368095 3300014326 Bacteria 596
76 Ga0157380_12390305 3300014326 Unclassified 594
77 Ga0197907_10184352 3300020069 Bacteria 549
78 Ga0224712_10313735 3300022467 Bacteria 736
79 Ga0207642_10302608 3300025899 Bacteria 927
80 Ga0207662_10167736 3300025918 Bacteria 1406
81 Ga0207650_10815163 3300025925 Bacteria 791
82 Ga0207650_11261726 3300025925 Bacteria 629
83 Ga0207659_10178751 3300025926 Bacteria 1679
84 Ga0207659_10385083 3300025926 Bacteria 1170
85 Ga0207687_10684057 3300025927 Bacteria 870
86 Ga0207687_11163072 3300025927 Bacteria 663
87 Ga0207644_11495461 3300025931 Bacteria 567
88 Ga0207644_11530748 3300025931 Bacteria 560
89 Ga0207709_10693598 3300025935 Bacteria 814
90 Ga0207661_10272047 3300025944 Bacteria 1512
91 Ga0207661_10340330 3300025944 Bacteria 1352
92 Ga0207679_10399631 3300025945 Bacteria 1209
93 Ga0207651_10241011 3300025960 Bacteria 1474
94 Ga0207712_11796630 3300025961 Bacteria 549
95 Ga0207640_10643225 3300025981 Bacteria 903
96 Ga0207677_10115791 3300026023 Bacteria 2006
97 Ga0207678_10223937 3300026067 Bacteria 1610
98 Ga0207708_10009470 3300026075 Bacteria 7215
99 Ga0207708_11316113 3300026075 Bacteria 633
100 Ga0207708_11445363 3300026075 Bacteria 604
101 Ga0207641_10654689 3300026088 Bacteria 1032
102 Ga0207676_11281020 3300026095 Bacteria 727
103 Ga0207675_100013512 3300026118 Bacteria 7620
104 Ga0207675_101605685 3300026118 Bacteria 671
105 Ga0209813_10198821 3300027866 Bacteria 741
106 Ga0268265_11822140 3300028380 Bacteria 615
107 Ga0307408_100360908 3300031548 Bacteria 1236
108 Ga0307408_100500902 3300031548 Bacteria 1063
109 Ga0307405_10650933 3300031731 Bacteria 866
110 Ga0307413_11423594 3300031824 Bacteria 610
111 Ga0307410_11031457 3300031852 Bacteria 710
112 Ga0307410_11239795 3300031852 Unclassified 651
113 Ga0307406_10333811 3300031901 Bacteria 1178
114 Ga0307407_10026746 3300031903 Bacteria 3060
115 Ga0307407_10039632 3300031903 Bacteria 2621
116 Ga0307407_10325712 3300031903 Bacteria 1080
117 Ga0307407_11307547 3300031903 Bacteria 569
118 Ga0307412_10190536 3300031911 Bacteria 1550
119 Ga0307412_10343314 3300031911 Bacteria 1196
120 Ga0307412_11756407 3300031911 Bacteria 570
121 Ga0307409_100010836 3300031995 Bacteria 5703
122 Ga0307409_100019654 3300031995 Bacteria 4580
123 Ga0307409_100173599 3300031995 Bacteria 1900
124 Ga0307409_100286298 3300031995 Bacteria 1526
125 Ga0307416_100034283 3300032002 Bacteria 3861
126 Ga0307416_102680130 3300032002 Bacteria 595
127 Ga0307414_10639608 3300032004 Bacteria 958
128 Ga0307414_11668424 3300032004 Bacteria 594
129 Ga0307411_10046930 3300032005 Bacteria 2789
130 Ga0307415_100026007 3300032126 Bacteria 3684
131 Ga0307415_100081291 3300032126 Bacteria 2314
132 Ga0307415_101570349 3300032126 Bacteria 631
133 Ga0395898_0570590 3300037466 Bacteria 1074
134 Ga0395901_0060596 3300038443 Bacteria 3938
135 Ga0451853_3968600 3300041512 Bacteria 528
136 Ga0466965_0012918 3300044683 Bacteria 3933
137 Ga0466965_0015837 3300044683 Bacteria 3582
138 Ga0466964_0089059 3300044706 Bacteria 1340
139 Ga0466970_0084199 3300044765 Bacteria 1721
140 Ga0466957_0012629 3300044842 Bacteria 4891
141 Ga0466960_0003029 3300044901 Bacteria 6413
142 Ga0466960_0421782 3300044901 Bacteria 771
143 Ga0466958_0009795 3300045836 Bacteria 5347
144 Ga0466967_0033814 3300045976 Bacteria 4332
145 Ga0466967_0194941 3300045976 Bacteria 1916
146 Ga0466967_0468092 3300045976 Bacteria 1233
147 Ga0495629_0582104 3300046459 Bacteria 750
148 Ga0495641_0037241 3300046461 Bacteria 2282
149 Ga0495641_0415594 3300046461 Bacteria 611
150 Ga0495608_0496503 3300046511 Bacteria 739
151 Ga0495656_0657063 3300046615 Unclassified 563
152 Ga0495657_0132952 3300046675 Bacteria 1557
153 Ga0495624_0671611 3300046690 Bacteria 616
154 Ga0496102_0955852 3300048905 Bacteria 778
155 Ga0496107_0387089 3300048910 Bacteria 1040
156 Ga0496109_0393300 3300048912 Bacteria 1310
157 Ga0496114_0076674 3300048917 Bacteria 2817
158 Ga0496114_0738623 3300048917 Bacteria 861
159 Ga0501031_0001223 3300049568 Bacteria 15717
160 Ga0501032_0072103 3300049569 Bacteria 2302
161 Ga0501033_0158480 3300049570 Bacteria 1630
162 Ga0501034_0120926 3300049571 Bacteria 2605
163 Ga0501034_0633770 3300049571 Bacteria 972
164 Ga0501036_0062186 3300049572 Bacteria 3162
165 Ga0501036_0397462 3300049572 Bacteria 1150
166 Ga0501036_0398188 3300049572 Bacteria 1149
167 Ga0501036_0672208 3300049572 Bacteria 857
168 Ga0501037_0034640 3300049573 Bacteria 3725
169 Ga0501038_0005023 3300049574 Bacteria 12285
170 Ga0501038_1127014 3300049574 Bacteria 572
171 Ga0501039_0047317 3300049575 Bacteria 3324
172 Ga0501039_0150327 3300049575 Bacteria 1830
173 Ga0501039_0332093 3300049575 Bacteria 1195
174 Ga0501040_0274367 3300049576 Bacteria 1204
175 Ga0501040_0289060 3300049576 Bacteria 1171
176 Ga0501040_1138315 3300049576 Bacteria 566
177 Ga0501041_0046621 3300049577 Bacteria 2637
178 Ga0501041_0179423 3300049577 Bacteria 1326
179 Ga0501041_0424004 3300049577 Bacteria 844
180 Ga0501042_0028192 3300049578 Bacteria 3953
181 Ga0501042_1075010 3300049578 Bacteria 586
182 Ga0501042_1302139 3300049578 Bacteria 530
183 Ga0501043_1156251 3300049579 Bacteria 545
184 Ga0501046_0108557 3300049580 Bacteria 2122
185 Ga0501046_0595720 3300049580 Bacteria 785
186 Ga0501048_0004152 3300049582 Bacteria 11043
187 Ga0501048_0987611 3300049582 Bacteria 606
188 Ga0501048_1319314 3300049582 Bacteria 519
189 Ga0501067_0017124 3300049583 Bacteria 4004
190 Ga0501068_0275141 3300049584 Bacteria 1075
191 Ga0501068_0489915 3300049584 Bacteria 797
192 Ga0501069_0063428 3300049585 Bacteria 2064
193 Ga0501069_0520719 3300049585 Bacteria 710
194 Ga0501070_0067861 3300049586 Bacteria 2953
195 Ga0501070_0387689 3300049586 Bacteria 1131
196 Ga0501071_0057924 3300049587 Bacteria 2800
197 Ga0501071_0152950 3300049587 Bacteria 1722
198 Ga0501071_0520035 3300049587 Bacteria 913
199 Ga0501072_0041963 3300049588 Bacteria 3594
200 Ga0501072_0154744 3300049588 Bacteria 1828
201 Ga0501072_0271151 3300049588 Bacteria 1350
202 Ga0501073_0152924 3300049589 Bacteria 1599
203 Ga0501073_0620548 3300049589 Bacteria 746
204 Ga0501073_0915479 3300049589 Bacteria 604
205 Ga0501073_1222248 3300049589 Bacteria 516
206 Ga0501074_0015091 3300049590 Bacteria 5619
207 Ga0501074_0302593 3300049590 Bacteria 1136
208 Ga0501074_0500702 3300049590 Bacteria 861
209 Ga0501074_0757481 3300049590 Bacteria 685
210 Ga0501075_0120868 3300049591 Bacteria 1993
211 Ga0501075_0373034 3300049591 Bacteria 1088
212 Ga0501076_0011003 3300049592 Bacteria 6727
213 Ga0501076_0131446 3300049592 Bacteria 2030
214 Ga0501077_0053720 3300049593 Bacteria 2558
215 Ga0501077_0797959 3300049593 Bacteria 607
216 Ga0501206_009819 3300049653 Bacteria 1276
217 Ga0501243_008303 3300049675 Bacteria 1599
218 Ga0501255_072701 3300049684 Bacteria 566
219 Ga0501079_0057142 3300049741 Bacteria 3011
220 Ga0501079_0114595 3300049741 Bacteria 2095
221 Ga0501079_0305261 3300049741 Bacteria 1245
222 Ga0501079_0337249 3300049741 Bacteria 1181
223 Ga0501080_0017305 3300049742 Bacteria 6663
224 Ga0501080_0450558 3300049742 Bacteria 1154
225 Ga0501080_0878312 3300049742 Unclassified 783
226 Ga0501081_0045664 3300049743 Bacteria 3008
227 Ga0501081_1009039 3300049743 Bacteria 629
228 Ga0501035_0296829 3300049822 Bacteria 1362
229 Ga0501035_0388654 3300049822 Bacteria 1163
230 Ga0501035_1199079 3300049822 Bacteria 589
231 Ga0501045_0008335 3300049824 Bacteria 7218
232 Ga0501045_0155485 3300049824 Bacteria 1702
233 Ga0501045_0234558 3300049824 Bacteria 1366
234 nmdc:mga03683_155145_c1 3300050489 Bacteria 1035
235 nmdc:mga03n38_310637_c1 3300050490 Bacteria 849
236 nmdc:mga03n38_450946_c1 3300050490 Bacteria 715
237 nmdc:mga00v17_1092057_c1 3300050491 Bacteria 500
238 nmdc:mga00v17_219203_c1 3300050491 Bacteria 1232
239 nmdc:mga00v17_299839_c1 3300050491 Bacteria 1044
240 nmdc:mga00v17_426383_c1 3300050491 Bacteria 861
241 nmdc:mga0yw44_101645_c1 3300050492 Bacteria 1832
242 nmdc:mga0yw44_1237953_c1 3300050492 Bacteria 503
243 nmdc:mga0yw44_131194_c1 3300050492 Bacteria 1622
244 nmdc:mga0yw44_20905_c1 3300050492 Bacteria 3643
245 nmdc:mga0yw44_249445_c1 3300050492 Bacteria 1181
246 nmdc:mga0yw44_41678_c1 3300050492 Bacteria 2734
247 nmdc:mga0yw44_443183_c1 3300050492 Bacteria 880
248 nmdc:mga0yw44_706024_c1 3300050492 Bacteria 685
249 nmdc:mga06z11_250129_c1 3300050494 Bacteria 1043
250 nmdc:mga06z11_313134_c1 3300050494 Bacteria 935
251 nmdc:mga06z11_50919_c1 3300050494 Bacteria 2118
252 nmdc:mga07m45_27264_c1 3300050496 Bacteria 3146
253 nmdc:mga08y16_484938_c1 3300050511 Bacteria 1257
254 Ga0495595_0203155 3300053084 Bacteria 987
255 Ga0495619_0059587 3300053085 Bacteria 2536
256 Ga0501084_0036454 3300054114 Bacteria 4108
257 Ga0501084_0222661 3300054114 Bacteria 1592
258 Ga0501084_1208442 3300054114 Bacteria 634
259 Ga0501082_0008186 3300060353 Bacteria 9022
260 Ga0501082_0552811 3300060353 Bacteria 1007
261 Ga0501082_0929148 3300060353 Bacteria 761
262 Ga0501082_1164211 3300060353 Bacteria 674
263 Ga0501082_2034825 3300060353 Bacteria 501
264 Ga0466962_0108697 3300061719 Bacteria 1334
265 Ga0530510_0056682 3300061734 Bacteria 2831
266 Ga0530510_1090976 3300061734 Bacteria 611
267 Ga0496108_0395412
268 Ga0070683_100149819
269 Ga0070683_100360921
270 Ga0070670_100721719
271 Ga0070680_101836111
272 Ga0070682_100162802
273 Ga0068868_100814177
274 Ga0070687_100247431
275 Ga0070687_100355146
276 Ga0070692_10759932
277 Ga0070675_101490950
278 Ga0070659_101546239
279 Ga0070700_100537303
280 Ga0070700_101777986
281 Ga0070663_101522994
282 Ga0070685_10707139
283 Ga0070684_101216075
284 Ga0070664_101320656
285 Ga0070664_101798981
286 Ga0068854_101227323
287 Ga0068856_102478085
288 Ga0068859_102368135
289 Ga0068866_10278666
290 Ga0068861_102554176
291 Ga0068851_10107089
292 Ga0068870_10656923
293 Ga0068870_11325935
294 Ga0068863_101249903
295 Ga0068862_102269471
296 Ga0075365_10069609
297 Ga0075365_10078002
298 Ga0075365_10127707
299 Ga0075365_10143916
300 Ga0075365_10323399
301 Ga0075365_10413076
302 Ga0075365_10763444
303 Ga0075365_11023913
304 Ga0075368_10240352
305 Ga0075368_10299210
306 Ga0075363_100087170
307 Ga0075363_100190786
308 Ga0075364_10071957
309 Ga0075364_10183130
310 Ga0075364_10209046
311 Ga0075364_10306489
312 Ga0075362_10076174
313 Ga0075367_10265082
314 Ga0075367_10599688
315 Ga0097621_101271972
316 Ga0075370_10048223
317 Ga0075370_10062524
318 Ga0075433_10998919
319 Ga0075434_101058982
320 Ga0097620_102368478
321 Ga0111539_11538447
322 Ga0111539_12910280
323 Ga0105245_10777092
324 Ga0105243_10524230
325 Ga0105243_11412253
326 Ga0105243_11489835
327 Ga0105242_10840167
328 Ga0105248_12415438
329 Ga0105238_12241264
330 Ga0105239_12064079
331 Ga0105246_10826285
332 Ga0105246_12204272
333 Ga0157336_1033657
334 Ga0157369_11106053
335 Ga0163162_11192894
336 Ga0157375_11357228
337 Ga0163163_10063180
338 Ga0163163_11142123
339 Ga0163163_11392236
340 Ga0157380_10044024
341 Ga0157380_12368095
342 Ga0157380_12390305
343 Ga0197907_10184352
344 Ga0224712_10313735
345 Ga0207642_10302608
346 Ga0207662_10167736
347 Ga0207650_10815163
348 Ga0207650_11261726
349 Ga0207659_10178751
350 Ga0207659_10385083
351 Ga0207687_10684057
352 Ga0207687_11163072
353 Ga0207644_11495461
354 Ga0207644_11530748
355 Ga0207709_10693598
356 Ga0207661_10272047
357 Ga0207661_10340330
358 Ga0207679_10399631
359 Ga0207651_10241011
360 Ga0207712_11796630
361 Ga0207640_10643225
362 Ga0207677_10115791
363 Ga0207678_10223937
364 Ga0207708_10009470
365 Ga0207708_11316113
366 Ga0207708_11445363
367 Ga0207641_10654689
368 Ga0207676_11281020
369 Ga0207675_100013512
370 Ga0207675_101605685
371 Ga0209813_10198821
372 Ga0268265_11822140
373 Ga0307408_100360908
374 Ga0307408_100500902
375 Ga0307405_10650933
376 Ga0307413_11423594
377 Ga0307410_11031457
378 Ga0307410_11239795
379 Ga0307406_10333811
380 Ga0307407_10026746
381 Ga0307407_10039632
382 Ga0307407_10325712
383 Ga0307407_11307547
384 Ga0307412_10190536
385 Ga0307412_10343314
386 Ga0307412_11756407
387 Ga0307409_100010836
388 Ga0307409_100019654
389 Ga0307409_100173599
390 Ga0307409_100286298
391 Ga0307416_100034283
392 Ga0307416_102680130
393 Ga0307414_10639608
394 Ga0307414_11668424
395 Ga0307411_10046930
396 Ga0307415_100026007
397 Ga0307415_100081291
398 Ga0307415_101570349
399 Ga0395898_0570590
400 Ga0395901_0060596
401 Ga0451853_3968600
402 Ga0466965_0012918
403 Ga0466965_0015837
404 Ga0466964_0089059
405 Ga0466970_0084199
406 Ga0466957_0012629
407 Ga0466960_0003029
408 Ga0466960_0421782
409 Ga0466958_0009795
410 Ga0466967_0033814
411 Ga0466967_0194941
412 Ga0466967_0468092
413 Ga0495629_0582104
414 Ga0495641_0037241
415 Ga0495641_0415594
416 Ga0495608_0496503
417 Ga0495656_0657063
418 Ga0495657_0132952
419 Ga0495624_0671611
420 Ga0496102_0955852
421 Ga0496107_0387089
422 Ga0496109_0393300
423 Ga0496114_0076674
424 Ga0496114_0738623
425 Ga0501031_0001223
426 Ga0501032_0072103
427 Ga0501033_0158480
428 Ga0501034_0120926
429 Ga0501034_0633770
430 Ga0501036_0062186
431 Ga0501036_0397462
432 Ga0501036_0398188
433 Ga0501036_0672208
434 Ga0501037_0034640
435 Ga0501038_0005023
436 Ga0501038_1127014
437 Ga0501039_0047317
438 Ga0501039_0150327
439 Ga0501039_0332093
440 Ga0501040_0274367
441 Ga0501040_0289060
442 Ga0501040_1138315
443 Ga0501041_0046621
444 Ga0501041_0179423
445 Ga0501041_0424004
446 Ga0501042_0028192
447 Ga0501042_1075010
448 Ga0501042_1302139
449 Ga0501043_1156251
450 Ga0501046_0108557
451 Ga0501046_0595720
452 Ga0501048_0004152
453 Ga0501048_0987611
454 Ga0501048_1319314
455 Ga0501067_0017124
456 Ga0501068_0275141
457 Ga0501068_0489915
458 Ga0501069_0063428
459 Ga0501069_0520719
460 Ga0501070_0067861
461 Ga0501070_0387689
462 Ga0501071_0057924
463 Ga0501071_0152950
464 Ga0501071_0520035
465 Ga0501072_0041963
466 Ga0501072_0154744
467 Ga0501072_0271151
468 Ga0501073_0152924
469 Ga0501073_0620548
470 Ga0501073_0915479
471 Ga0501073_1222248
472 Ga0501074_0015091
473 Ga0501074_0302593
474 Ga0501074_0500702
475 Ga0501074_0757481
476 Ga0501075_0120868
477 Ga0501075_0373034
478 Ga0501076_0011003
479 Ga0501076_0131446
480 Ga0501077_0053720
481 Ga0501077_0797959
482 Ga0501206_009819
483 Ga0501243_008303
484 Ga0501255_072701
485 Ga0501079_0057142
486 Ga0501079_0114595
487 Ga0501079_0305261
488 Ga0501079_0337249
489 Ga0501080_0017305
490 Ga0501080_0450558
491 Ga0501080_0878312
492 Ga0501081_0045664
493 Ga0501081_1009039
494 Ga0501035_0296829
495 Ga0501035_0388654
496 Ga0501035_1199079
497 Ga0501045_0008335
498 Ga0501045_0155485
499 Ga0501045_0234558
500 nmdc:mga03683_155145_c1
501 nmdc:mga03n38_310637_c1
502 nmdc:mga03n38_450946_c1
503 nmdc:mga00v17_1092057_c1
504 nmdc:mga00v17_219203_c1
505 nmdc:mga00v17_299839_c1
506 nmdc:mga00v17_426383_c1
507 nmdc:mga0yw44_101645_c1
508 nmdc:mga0yw44_1237953_c1
509 nmdc:mga0yw44_131194_c1
510 nmdc:mga0yw44_20905_c1
511 nmdc:mga0yw44_249445_c1
512 nmdc:mga0yw44_41678_c1
513 nmdc:mga0yw44_443183_c1
514 nmdc:mga0yw44_706024_c1
515 nmdc:mga06z11_250129_c1
516 nmdc:mga06z11_313134_c1
517 nmdc:mga06z11_50919_c1
518 nmdc:mga07m45_27264_c1
519 nmdc:mga08y16_484938_c1
520 Ga0495595_0203155
521 Ga0495619_0059587
522 Ga0501084_0036454
523 Ga0501084_0222661
524 Ga0501084_1208442
525 Ga0501082_0008186
526 Ga0501082_0552811
527 Ga0501082_0929148
528 Ga0501082_1164211
529 Ga0501082_2034825
530 Ga0466962_0108697
531 Ga0530510_0056682
532 Ga0530510_1090976

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1okr-assembly1.cif.gz_A three-dimensional structure of s.aureus methicillin-resistance regulating transcriptional repressor meci. 0.8551 22 78
7fsf-assembly1.cif.gz_A crystal structure of t. maritima reverse gyrase active site variant y851f 0.8544 54 78
3o6b-assembly3.cif.gz_F a dual e3 mechanism for rub1 ligation to cdc53: dcn1(p)-cdc53(whb) low resolution 0.8491 16 78
8ofb-assembly1.cif.gz_A crystal structure of t. maritima reverse gyrase with a minimal latch, hexagonal form 0.8453 54 78
7dh8-assembly1.cif.gz_A-2 crystal structure of holo xczur 0.8433 21 78
ID Description Score Start End Superfamily
af_Q59048_168_225_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8831 19 78 1.10.10.10
af_Q4CZG6_202_263_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8693 21 76 1.10.10.10
af_P39360_5_75_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8575 18 77 1.10.10.10
af_Q59048_168_225_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.856 19 78 1.10.10.10
af_A4I3U0_697_766_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8525 16 78 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7W1M0X2-F1-model_v4 Uncharacterized protein 0.96 16 77
AF-A0A2U3K3G8-F1-model_v4 Uncharacterized protein 0.9555 18 78
AF-A0A2N9L3W9-F1-model_v4 DNA primase/polymerase bifunctional N-terminal domain-containing protein 0.9527 18 78
AF-A0LL79-F1-model_v4 DUF3987 domain-containing protein 0.9521 18 78
AF-A0A6M3LDK6-F1-model_v4 DUF3987 domain-containing protein 0.9447 18 77

Map