F374320

General Info

Members Datasets Scaffolds Average Seq Length
266 158 266 151

Family's Representative Sequence

Representative Sequence 3300048908|Ga0496105_0323737|Ga0496105_0323737_98_646
Length 182
Sequence VGGSSTGTIHAAAAFRVPVDTVTGVATGTPATALLAKLQIPHTLHPYEHDPRAQAYGEEAAAALGVDPAQLFKTLIATVDGKLACAVVPVAARLDLKRFAAALGGKRAELAEPAAAARATGYVVGGISPIGQKARLRVVVDESAEAFPTVYVSAGKRGLQVELAPADLVRAAGASVAAVAAV

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
5 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
8 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
9 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
10 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
11 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
12 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
13 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
14 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
15 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
16 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
17 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
18 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
19 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
20 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
21 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
22 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
23 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
24 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
25 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
26 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
27 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
28 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
29 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
30 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
31 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
32 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
33 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
34 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
36 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
37 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
38 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
60 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
61 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
62 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
63 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
64 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
65 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
66 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
67 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
68 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
69 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
70 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
71 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
72 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
73 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
74 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
75 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
76 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
77 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
78 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
79 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
80 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
81 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
82 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
83 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
84 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
85 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
86 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
87 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
88 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
89 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
90 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
91 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
92 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
93 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
94 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
95 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
96 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
97 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
98 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
99 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
100 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
101 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
102 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
103 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
104 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
105 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
106 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
107 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
108 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
109 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
110 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
111 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
112 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
113 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
114 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
115 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
116 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
117 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
118 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
119 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
120 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
121 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
122 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
123 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
124 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
125 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
126 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
127 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
128 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
129 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
130 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
131 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
132 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
133 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
134 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
135 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
136 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
137 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
138 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
139 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
140 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
141 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
142 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
143 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
144 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
145 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
146 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
147 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
148 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
149 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
150 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
151 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
153 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
154 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
155 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
156 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
157 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
158 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.62
Metatranscriptomes 3.38
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.02
Rhizosphere 93.23
Stem 0
Stem Tuber 0
Unclassified 0.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10222122 3300005327 Bacteria 1598
2 Ga0070658_10487626 3300005327 Bacteria 1064
3 Ga0070658_10819880 3300005327 Bacteria 808
4 Ga0070683_100020837 3300005329 Bacteria 5841
5 Ga0070683_100025194 3300005329 Bacteria 5339
6 Ga0070683_100419542 3300005329 Bacteria 1276
7 Ga0070680_100367492 3300005336 Bacteria 1224
8 Ga0070680_100486389 3300005336 Bacteria 1055
9 Ga0070661_100083377 3300005344 Bacteria 2361
10 Ga0070661_100135702 3300005344 Bacteria 1851
11 Ga0070661_100926560 3300005344 Unclassified 720
12 Ga0070671_100556311 3300005355 Bacteria 989
13 Ga0070714_100072946 3300005435 Bacteria 2973
14 Ga0070714_101459336 3300005435 Bacteria 668
15 Ga0070708_100843400 3300005445 Bacteria 861
16 Ga0070681_10151691 3300005458 Bacteria 2244
17 Ga0070679_100036913 3300005530 Bacteria 4851
18 Ga0070679_100048468 3300005530 Bacteria 4232
19 Ga0070684_100002166 3300005535 Bacteria 14495
20 Ga0070684_100121717 3300005535 Bacteria 2348
21 Ga0070684_100128370 3300005535 Bacteria 2286
22 Ga0070684_100736928 3300005535 Bacteria 920
23 Ga0070693_100231036 3300005547 Bacteria 1217
24 Ga0068855_100030931 3300005563 Bacteria 6397
25 Ga0068855_100058213 3300005563 Bacteria 4526
26 Ga0068855_100311295 3300005563 Bacteria 1742
27 Ga0068855_100485839 3300005563 Bacteria 1344
28 Ga0068857_100332744 3300005577 Bacteria 1404
29 Ga0068856_100073700 3300005614 Bacteria 3380
30 Ga0068856_100184859 3300005614 Bacteria 2098
31 Ga0068856_100297977 3300005614 Bacteria 1630
32 Ga0068856_100475213 3300005614 Bacteria 1271
33 Ga0068852_100020578 3300005616 Bacteria 5249
34 Ga0068852_100890420 3300005616 Bacteria 907
35 Ga0068851_10817035 3300005834 Bacteria 580
36 Ga0070717_10076183 3300006028 Bacteria 2807
37 Ga0070715_10874698 3300006163 Bacteria 551
38 Ga0070712_100655768 3300006175 Bacteria 892
39 Ga0070712_100893152 3300006175 Bacteria 766
40 Ga0075434_100242196 3300006871 Bacteria 1823
41 Ga0075435_100005481 3300007076 Bacteria 8869
42 Ga0105240_10047226 3300009093 Bacteria 5449
43 Ga0105240_10122010 3300009093 Bacteria 3137
44 Ga0105240_10183978 3300009093 Bacteria 2463
45 Ga0105245_12805418 3300009098 Bacteria 540
46 Ga0105243_10798007 3300009148 Bacteria 930
47 Ga0105241_10667744 3300009174 Bacteria 946
48 Ga0105241_11845853 3300009174 Bacteria 591
49 Ga0105237_10062162 3300009545 Bacteria 3733
50 Ga0105238_10164361 3300009551 Bacteria 2195
51 Ga0157373_10011418 3300013100 Bacteria 6533
52 Ga0157370_10058261 3300013104 Bacteria 3672
53 Ga0157370_10341332 3300013104 Bacteria 1381
54 Ga0157370_10499152 3300013104 Bacteria 1117
55 Ga0157369_10006123 3300013105 Bacteria 13961
56 Ga0157369_11544219 3300013105 Bacteria 675
57 Ga0157372_10071007 3300013307 Bacteria 3920
58 Ga0182006_1200034 3300015261 Bacteria 662
59 Ga0182007_10025727 3300015262 Bacteria 2047
60 Ga0197907_11221306 3300020069 Bacteria 870
61 Ga0197907_11432064 3300020069 Bacteria 547
62 Ga0206356_10597032 3300020070 Bacteria 1350
63 Ga0206354_11720673 3300020081 Bacteria 1558
64 Ga0206353_10029576 3300020082 Bacteria 4035
65 Ga0206353_10042058 3300020082 Bacteria 3303
66 Ga0206353_10127022 3300020082 Bacteria 3218
67 Ga0206353_11059685 3300020082 Bacteria 1092
68 Ga0206353_11905109 3300020082 Bacteria 2978
69 Ga0207692_10267110 3300025898 Unclassified 1030
70 Ga0207707_10189819 3300025912 Bacteria 1793
71 Ga0207707_10694928 3300025912 Bacteria 854
72 Ga0207707_11235255 3300025912 Bacteria 603
73 Ga0207695_10246095 3300025913 Bacteria 1688
74 Ga0207695_10383664 3300025913 Bacteria 1291
75 Ga0207695_10743848 3300025913 Bacteria 861
76 Ga0207671_10176495 3300025914 Bacteria 1661
77 Ga0207693_10074493 3300025915 Bacteria 2659
78 Ga0207660_10188764 3300025917 Bacteria 1604
79 Ga0207657_10002431 3300025919 Bacteria 20110
80 Ga0207657_10297620 3300025919 Bacteria 1278
81 Ga0207649_10144732 3300025920 Bacteria 1630
82 Ga0207649_10276291 3300025920 Bacteria 1220
83 Ga0207649_10747246 3300025920 Unclassified 761
84 Ga0207652_10528300 3300025921 Bacteria 1061
85 Ga0207694_10135887 3300025924 Bacteria 1974
86 Ga0207700_10589368 3300025928 Bacteria 989
87 Ga0207664_10803335 3300025929 Bacteria 846
88 Ga0207664_10976659 3300025929 Bacteria 759
89 Ga0207644_10222021 3300025931 Bacteria 1498
90 Ga0207661_10082448 3300025944 Bacteria 2659
91 Ga0207679_11244875 3300025945 Bacteria 683
92 Ga0207667_11403877 3300025949 Bacteria 672
93 Ga0207640_11059987 3300025981 Bacteria 716
94 Ga0207639_10865927 3300026041 Bacteria 844
95 Ga0207702_10152626 3300026078 Bacteria 2102
96 Ga0207702_11095383 3300026078 Bacteria 790
97 Ga0207683_10020907 3300026121 Bacteria 5600
98 Ga0207698_10123184 3300026142 Bacteria 2199
99 Ga0207698_10833964 3300026142 Bacteria 926
100 Ga0207698_11436908 3300026142 Bacteria 705
101 Ga0265326_10064906 3300028558 Bacteria 1032
102 Ga0265334_10057543 3300028573 Bacteria 1473
103 Ga0265318_10277958 3300028577 Bacteria 611
104 Ga0265322_10021957 3300028654 Bacteria 1828
105 Ga0265336_10077398 3300028666 Bacteria 994
106 Ga0265338_10007452 3300028800 Bacteria 13579
107 Ga0265338_10029168 3300028800 Bacteria 5479
108 Ga0265338_10067787 3300028800 Bacteria 3079
109 Ga0265324_10039589 3300029957 Bacteria 1634
110 Ga0265325_10013463 3300031241 Bacteria 4657
111 Ga0265340_10276608 3300031247 Bacteria 746
112 Ga0265339_10026715 3300031249 Bacteria 3304
113 Ga0265331_10050210 3300031250 Bacteria 2001
114 Ga0265327_10007278 3300031251 Bacteria 8586
115 Ga0265316_10049928 3300031344 Bacteria 3293
116 Ga0265313_10018970 3300031595 Bacteria 3844
117 Ga0265313_10038323 3300031595 Bacteria 2388
118 Ga0265313_10329275 3300031595 Bacteria 609
119 Ga0265342_10032996 3300031712 Bacteria 3188
120 Ga0265342_10156943 3300031712 Bacteria 1260
121 Ga0373944_0025703 3300035089 Bacteria 1735
122 Ga0373936_0044277 3300035113 Bacteria 1790
123 Ga0373945_0069466 3300035116 Bacteria 1330
124 Ga0373954_0054359 3300035118 Bacteria 1883
125 Ga0373943_0006557 3300035170 Bacteria 5223
126 Ga0373943_0425647 3300035170 Bacteria 769
127 Ga0373955_0177815 3300035172 Bacteria 1262
128 Ga0373924_0169555 3300035410 Bacteria 959
129 Ga0373935_0043565 3300035692 Bacteria 2825
130 Ga0373947_0003721 3300035725 Bacteria 9009
131 Ga0373947_0515948 3300035725 Bacteria 813
132 Ga0373937_0340204 3300036401 Bacteria 1421
133 Ga0373925_0099129 3300037068 Bacteria 2237
134 Ga0395900_0115320 3300037418 Bacteria 2756
135 Ga0395900_0183082 3300037418 Bacteria 2128
136 Ga0395900_0261641 3300037418 Bacteria 1727
137 Ga0395900_1067564 3300037418 Bacteria 726
138 Ga0395898_0001313 3300037466 Bacteria 36176
139 Ga0395898_0139924 3300037466 Bacteria 2317
140 Ga0395898_0164851 3300037466 Bacteria 2119
141 Ga0395898_0261712 3300037466 Bacteria 1650
142 Ga0395905_0112750 3300037471 Bacteria 2554
143 Ga0395905_0323631 3300037471 Bacteria 1432
144 Ga0436364_0477538 3300037853 Bacteria 679
145 Ga0395901_0002853 3300038443 Bacteria 17452
146 Ga0395901_0003265 3300038443 Bacteria 16325
147 Ga0436363_1330396 3300039450 Bacteria 711
148 Ga0451804_1125088 3300041463 Bacteria 529
149 Ga0439448_0272591 3300042005 Bacteria 599
150 Ga0466972_0033723 3300044658 Bacteria 2511
151 Ga0466965_0290975 3300044683 Bacteria 884
152 Ga0466966_0066575 3300044684 Bacteria 2264
153 Ga0466966_0154459 3300044684 Bacteria 1398
154 Ga0466966_0179469 3300044684 Bacteria 1285
155 Ga0466966_0353639 3300044684 Bacteria 883
156 Ga0466966_0535204 3300044684 Bacteria 705
157 Ga0466961_0068663 3300044693 Bacteria 2250
158 Ga0466961_0176794 3300044693 Bacteria 1326
159 Ga0466963_0003463 3300044694 Bacteria 9043
160 Ga0466963_0014657 3300044694 Bacteria 4839
161 Ga0466963_0033727 3300044694 Bacteria 3326
162 Ga0466963_0081835 3300044694 Bacteria 2188
163 Ga0466963_0366878 3300044694 Bacteria 1014
164 Ga0466964_0062823 3300044706 Bacteria 1549
165 Ga0466971_0000387 3300044719 Bacteria 16986
166 Ga0466971_0096045 3300044719 Bacteria 1359
167 Ga0466970_0081724 3300044765 Bacteria 1747
168 Ga0466957_0005219 3300044842 Bacteria 7270
169 Ga0466957_0049990 3300044842 Bacteria 2543
170 Ga0466960_0105935 3300044901 Bacteria 1454
171 Ga0466960_0388959 3300044901 Bacteria 801
172 Ga0466959_0068283 3300045049 Bacteria 2576
173 Ga0466959_0072115 3300045049 Bacteria 2500
174 Ga0466959_0125138 3300045049 Bacteria 1825
175 Ga0466958_0000662 3300045836 Bacteria 14905
176 Ga0466958_0546934 3300045836 Bacteria 752
177 Ga0466967_0000496 3300045976 Bacteria 19228
178 Ga0466967_0005093 3300045976 Bacteria 9023
179 Ga0466967_0012272 3300045976 Bacteria 6544
180 Ga0466967_0040876 3300045976 Bacteria 3994
181 Ga0466967_0077400 3300045976 Bacteria 2994
182 Ga0466967_0106020 3300045976 Bacteria 2575
183 Ga0466967_0110388 3300045976 Bacteria 2526
184 Ga0466967_0308764 3300045976 Bacteria 1523
185 Ga0466967_0916609 3300045976 Bacteria 872
186 Ga0466967_1073835 3300045976 Bacteria 802
187 Ga0466967_1323415 3300045976 Bacteria 717
188 Ga0495592_0130178 3300046454 Bacteria 1761
189 Ga0495629_0088731 3300046459 Bacteria 2157
190 Ga0495641_0043325 3300046461 Bacteria 2082
191 Ga0495641_0268759 3300046461 Bacteria 767
192 Ga0495651_0039549 3300046462 Bacteria 3671
193 Ga0495651_0066945 3300046462 Bacteria 2740
194 Ga0495653_0037559 3300046463 Bacteria 3804
195 Ga0495582_0033654 3300046473 Bacteria 2818
196 Ga0495662_0055336 3300046476 Bacteria 1917
197 Ga0495608_0006490 3300046511 Bacteria 8303
198 Ga0495608_0332217 3300046511 Bacteria 937
199 Ga0495618_0064255 3300046514 Bacteria 2332
200 Ga0495628_0014804 3300046516 Bacteria 6524
201 Ga0495628_0030454 3300046516 Bacteria 4369
202 Ga0495630_0016696 3300046517 Bacteria 5369
203 Ga0495630_0052435 3300046517 Bacteria 3054
204 Ga0495630_0158447 3300046517 Bacteria 1723
205 Ga0495652_0071636 3300046529 Bacteria 2891
206 Ga0495640_0027639 3300046533 Bacteria 4090
207 Ga0495640_0055805 3300046533 Bacteria 2701
208 Ga0495587_0013168 3300046536 Bacteria 5200
209 Ga0495587_0310355 3300046536 Bacteria 881
210 Ga0495645_0251280 3300046543 Bacteria 1175
211 Ga0495667_0018250 3300046559 Bacteria 4739
212 Ga0495634_0089774 3300046642 Bacteria 1997
213 Ga0495635_0110710 3300046663 Bacteria 1876
214 Ga0495657_0003812 3300046675 Bacteria 12203
215 Ga0495657_0051910 3300046675 Bacteria 2752
216 Ga0495599_0241117 3300046678 Unclassified 1102
217 Ga0495623_0100429 3300046679 Bacteria 1763
218 Ga0495646_0051375 3300046680 Bacteria 2495
219 Ga0495658_0295374 3300046683 Bacteria 1024
220 Ga0495613_0004233 3300046689 Bacteria 10750
221 Ga0495600_0004479 3300046809 Bacteria 8369
222 Ga0495604_0027950 3300047317 Bacteria 4485
223 Ga0495674_0004654 3300047319 Bacteria 13188
224 Ga0495680_0000965 3300047322 Bacteria 31875
225 Ga0495680_0002509 3300047322 Bacteria 18776
226 Ga0495684_0017271 3300047471 Bacteria 5555
227 Ga0495684_0039666 3300047471 Bacteria 3610
228 Ga0495593_0098374 3300047673 Bacteria 1502
229 Ga0495602_0045068 3300048088 Bacteria 3994
230 Ga0495602_0062936 3300048088 Bacteria 3217
231 Ga0495602_0158054 3300048088 Bacteria 1773
232 Ga0495602_0698553 3300048088 Bacteria 689
233 Ga0496100_0046494 3300048903 Bacteria 2791
234 Ga0496101_0073519 3300048904 Bacteria 2511
235 Ga0496102_0092592 3300048905 Bacteria 2799
236 Ga0496103_0152591 3300048906 Bacteria 1480
237 Ga0496105_0323737 3300048908 Bacteria 1235
238 Ga0496105_1363033 3300048908 Bacteria 515
239 Ga0496106_0027569 3300048909 Bacteria 4231
240 Ga0496106_0053060 3300048909 Bacteria 3061
241 Ga0496107_0063123 3300048910 Bacteria 2684
242 Ga0496107_0132220 3300048910 Bacteria 1842
243 Ga0496109_0076194 3300048912 Bacteria 3085
244 Ga0496114_0117918 3300048917 Bacteria 2280
245 Ga0496114_0145041 3300048917 Bacteria 2057
246 Ga0496115_0045924 3300048918 Bacteria 3488
247 Ga0496115_0314521 3300048918 Bacteria 1282
248 Ga0501069_0043501 3300049585 Bacteria 2486
249 Ga0501069_0062685 3300049585 Bacteria 2076
250 Ga0501070_0000677 3300049586 Bacteria 31275
251 Ga0501070_0120393 3300049586 Bacteria 2169
252 Ga0501070_0632126 3300049586 Bacteria 851
253 Ga0501074_0386353 3300049590 Bacteria 993
254 Ga0501080_0116678 3300049742 Bacteria 2474
255 Ga0501080_1857139 3300049742 Bacteria 505
256 Ga0501035_0228576 3300049822 Bacteria 1586
257 Ga0501044_0551438 3300049823 Bacteria 1050
258 nmdc:mga0n895_82843_c1 3300050512 Bacteria 3198
259 nmdc:mga0rr50_21340_c1 3300050513 Bacteria 4419
260 Ga0495601_0243134 3300053077 Unclassified 1175
261 Ga0495595_0006495 3300053084 Bacteria 4771
262 Ga0495595_0513887 3300053084 Bacteria 611
263 Ga0495619_0009728 3300053085 Bacteria 6062
264 Ga0466962_0003658 3300061719 Bacteria 7332
265 Ga0466962_0005515 3300061719 Bacteria 6075
266 Ga0466962_0325237 3300061719 Bacteria 763

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044684 Ga0466966_0179469 Ga0466966_0179469_518_958 146
2 3300044694 Ga0466963_0366878 Ga0466963_0366878_47_496 146
3 3300044719 Ga0466971_0096045 Ga0466971_0096045_712_1161 146
4 3300044842 Ga0466957_0049990 Ga0466957_0049990_1950_2399 146
5 3300045976 Ga0466967_0012272 Ga0466967_0012272_1027_1467 146
6 3300045976 Ga0466967_0308764 Ga0466967_0308764_289_738 146
7 3300048918 Ga0496115_0045924 Ga0496115_0045924_11_451 146
8 3300053084 Ga0495595_0513887 Ga0495595_0513887_68_508 146
9 3300061719 Ga0466962_0003658 Ga0466962_0003658_1533_1982 146
10 3300044684 Ga0466966_0535204 Ga0466966_0535204_132_650 149
11 3300048908 Ga0496105_0323737 Ga0496105_0323737_98_646 149
12 3300048912 Ga0496109_0076194 Ga0496109_0076194_1628_2176 149
13 3300005327 Ga0070658_10222122 Ga0070658_102221222 150
14 3300005327 Ga0070658_10487626 Ga0070658_104876261 150
15 3300005327 Ga0070658_10819880 Ga0070658_108198802 150
16 3300005329 Ga0070683_100020837 Ga0070683_1000208372 150
17 3300005329 Ga0070683_100025194 Ga0070683_1000251942 150
18 3300005329 Ga0070683_100419542 Ga0070683_1004195423 150
19 3300005336 Ga0070680_100367492 Ga0070680_1003674922 150
20 3300005336 Ga0070680_100486389 Ga0070680_1004863892 150
21 3300005344 Ga0070661_100083377 Ga0070661_1000833773 150
22 3300005344 Ga0070661_100135702 Ga0070661_1001357022 150
23 3300005344 Ga0070661_100926560 Ga0070661_1009265602 150
24 3300005355 Ga0070671_100556311 Ga0070671_1005563112 150
25 3300005435 Ga0070714_100072946 Ga0070714_1000729462 150
26 3300005435 Ga0070714_101459336 Ga0070714_1014593361 150
27 3300005445 Ga0070708_100843400 Ga0070708_1008434001 150
28 3300005458 Ga0070681_10151691 Ga0070681_101516913 150
29 3300005530 Ga0070679_100036913 Ga0070679_1000369133 150
30 3300005530 Ga0070679_100048468 Ga0070679_1000484681 150
31 3300005535 Ga0070684_100002166 Ga0070684_10000216610 150
32 3300005535 Ga0070684_100121717 Ga0070684_1001217172 150
33 3300005535 Ga0070684_100128370 Ga0070684_1001283702 150
34 3300005535 Ga0070684_100736928 Ga0070684_1007369281 150
35 3300005547 Ga0070693_100231036 Ga0070693_1002310363 150
36 3300005563 Ga0068855_100030931 Ga0068855_1000309313 150
37 3300005563 Ga0068855_100058213 Ga0068855_1000582132 150
38 3300005563 Ga0068855_100311295 Ga0068855_1003112952 150
39 3300005563 Ga0068855_100485839 Ga0068855_1004858391 150
40 3300005577 Ga0068857_100332744 Ga0068857_1003327442 150
41 3300005614 Ga0068856_100073700 Ga0068856_1000737002 150
42 3300005614 Ga0068856_100184859 Ga0068856_1001848592 150
43 3300005614 Ga0068856_100297977 Ga0068856_1002979772 150
44 3300005614 Ga0068856_100475213 Ga0068856_1004752132 150
45 3300005616 Ga0068852_100020578 Ga0068852_1000205785 150
46 3300005616 Ga0068852_100890420 Ga0068852_1008904202 150
47 3300005834 Ga0068851_10817035 Ga0068851_108170352 150
48 3300006028 Ga0070717_10076183 Ga0070717_100761834 150
49 3300006163 Ga0070715_10874698 Ga0070715_108746982 150
50 3300006175 Ga0070712_100655768 Ga0070712_1006557681 150
51 3300006175 Ga0070712_100893152 Ga0070712_1008931521 150
52 3300006871 Ga0075434_100242196 Ga0075434_1002421962 150
53 3300007076 Ga0075435_100005481 Ga0075435_1000054814 150
54 3300009093 Ga0105240_10047226 Ga0105240_100472266 150
55 3300009093 Ga0105240_10122010 Ga0105240_101220103 150
56 3300009093 Ga0105240_10183978 Ga0105240_101839782 150
57 3300009098 Ga0105245_12805418 Ga0105245_128054181 150
58 3300009148 Ga0105243_10798007 Ga0105243_107980071 150
59 3300009174 Ga0105241_10667744 Ga0105241_106677442 150
60 3300009174 Ga0105241_11845853 Ga0105241_118458531 150
61 3300009545 Ga0105237_10062162 Ga0105237_100621625 150
62 3300009551 Ga0105238_10164361 Ga0105238_101643612 150
63 3300013100 Ga0157373_10011418 Ga0157373_100114183 150
64 3300013104 Ga0157370_10058261 Ga0157370_100582616 150
65 3300013104 Ga0157370_10341332 Ga0157370_103413322 150
66 3300013104 Ga0157370_10499152 Ga0157370_104991522 150
67 3300013105 Ga0157369_10006123 Ga0157369_1000612315 150
68 3300013105 Ga0157369_11544219 Ga0157369_115442192 150
69 3300013307 Ga0157372_10071007 Ga0157372_100710074 150
70 3300015261 Ga0182006_1200034 Ga0182006_12000341 150
71 3300015262 Ga0182007_10025727 Ga0182007_100257273 150
72 3300020069 Ga0197907_11221306 Ga0197907_112213062 150
73 3300020069 Ga0197907_11432064 Ga0197907_114320641 150
74 3300020070 Ga0206356_10597032 Ga0206356_105970322 150
75 3300020081 Ga0206354_11720673 Ga0206354_117206732 150
76 3300020082 Ga0206353_10029576 Ga0206353_100295764 150
77 3300020082 Ga0206353_10042058 Ga0206353_100420584 150
78 3300020082 Ga0206353_10127022 Ga0206353_101270223 150
79 3300020082 Ga0206353_11059685 Ga0206353_110596852 150
80 3300020082 Ga0206353_11905109 Ga0206353_119051092 150
81 3300025898 Ga0207692_10267110 Ga0207692_102671102 150
82 3300025912 Ga0207707_10189819 Ga0207707_101898192 150
83 3300025912 Ga0207707_10694928 Ga0207707_106949282 150
84 3300025912 Ga0207707_11235255 Ga0207707_112352551 150
85 3300025913 Ga0207695_10246095 Ga0207695_102460952 150
86 3300025913 Ga0207695_10383664 Ga0207695_103836643 150
87 3300025913 Ga0207695_10743848 Ga0207695_107438481 150
88 3300025914 Ga0207671_10176495 Ga0207671_101764953 150
89 3300025915 Ga0207693_10074493 Ga0207693_100744934 150
90 3300025917 Ga0207660_10188764 Ga0207660_101887643 150
91 3300025919 Ga0207657_10002431 Ga0207657_1000243121 150
92 3300025919 Ga0207657_10297620 Ga0207657_102976202 150
93 3300025920 Ga0207649_10144732 Ga0207649_101447322 150
94 3300025920 Ga0207649_10276291 Ga0207649_102762911 150
95 3300025920 Ga0207649_10747246 Ga0207649_107472462 150
96 3300025921 Ga0207652_10528300 Ga0207652_105283002 150
97 3300025924 Ga0207694_10135887 Ga0207694_101358873 150
98 3300025928 Ga0207700_10589368 Ga0207700_105893682 150
99 3300025929 Ga0207664_10803335 Ga0207664_108033352 150
100 3300025929 Ga0207664_10976659 Ga0207664_109766592 150
101 3300025931 Ga0207644_10222021 Ga0207644_102220213 150
102 3300025944 Ga0207661_10082448 Ga0207661_100824483 150
103 3300025945 Ga0207679_11244875 Ga0207679_112448751 150
104 3300025949 Ga0207667_11403877 Ga0207667_114038772 150
105 3300025981 Ga0207640_11059987 Ga0207640_110599872 150
106 3300026041 Ga0207639_10865927 Ga0207639_108659272 150
107 3300026078 Ga0207702_10152626 Ga0207702_101526263 150
108 3300026078 Ga0207702_11095383 Ga0207702_110953832 150
109 3300026121 Ga0207683_10020907 Ga0207683_100209073 150
110 3300026142 Ga0207698_10123184 Ga0207698_101231842 150
111 3300026142 Ga0207698_10833964 Ga0207698_108339642 150
112 3300026142 Ga0207698_11436908 Ga0207698_114369082 150
113 3300028558 Ga0265326_10064906 Ga0265326_100649061 150
114 3300028573 Ga0265334_10057543 Ga0265334_100575432 150
115 3300028577 Ga0265318_10277958 Ga0265318_102779582 150
116 3300028654 Ga0265322_10021957 Ga0265322_100219573 150
117 3300028666 Ga0265336_10077398 Ga0265336_100773981 150
118 3300028800 Ga0265338_10007452 Ga0265338_1000745219 150
119 3300028800 Ga0265338_10029168 Ga0265338_100291687 150
120 3300028800 Ga0265338_10067787 Ga0265338_100677872 150
121 3300029957 Ga0265324_10039589 Ga0265324_100395892 150
122 3300031241 Ga0265325_10013463 Ga0265325_100134632 150
123 3300031247 Ga0265340_10276608 Ga0265340_102766082 150
124 3300031249 Ga0265339_10026715 Ga0265339_100267154 150
125 3300031250 Ga0265331_10050210 Ga0265331_100502102 150
126 3300031251 Ga0265327_10007278 Ga0265327_1000727810 150
127 3300031344 Ga0265316_10049928 Ga0265316_100499283 150
128 3300031595 Ga0265313_10018970 Ga0265313_100189703 150
129 3300031595 Ga0265313_10038323 Ga0265313_100383234 150
130 3300031595 Ga0265313_10329275 Ga0265313_103292751 150
131 3300031712 Ga0265342_10032996 Ga0265342_100329965 150
132 3300031712 Ga0265342_10156943 Ga0265342_101569432 150
133 3300035089 Ga0373944_0025703 Ga0373944_0025703_1098_1550 150
134 3300035113 Ga0373936_0044277 Ga0373936_0044277_798_1250 150
135 3300035116 Ga0373945_0069466 Ga0373945_0069466_123_575 150
136 3300035118 Ga0373954_0054359 Ga0373954_0054359_33_485 150
137 3300035170 Ga0373943_0006557 Ga0373943_0006557_2884_3336 150
138 3300035170 Ga0373943_0425647 Ga0373943_0425647_167_619 150
139 3300035172 Ga0373955_0177815 Ga0373955_0177815_222_674 150
140 3300035410 Ga0373924_0169555 Ga0373924_0169555_420_872 150
141 3300035692 Ga0373935_0043565 Ga0373935_0043565_1968_2420 150
142 3300035725 Ga0373947_0003721 Ga0373947_0003721_993_1445 150
143 3300035725 Ga0373947_0515948 Ga0373947_0515948_207_659 150
144 3300036401 Ga0373937_0340204 Ga0373937_0340204_937_1389 150
145 3300037068 Ga0373925_0099129 Ga0373925_0099129_889_1341 150
146 3300037418 Ga0395900_0115320 Ga0395900_0115320_1096_1548 150
147 3300037418 Ga0395900_0183082 Ga0395900_0183082_975_1427 150
148 3300037418 Ga0395900_0261641 Ga0395900_0261641_890_1345 150
149 3300037418 Ga0395900_1067564 Ga0395900_1067564_109_561 150
150 3300037466 Ga0395898_0001313 Ga0395898_0001313_5624_6076 150
151 3300037466 Ga0395898_0139924 Ga0395898_0139924_71_544 150
152 3300037466 Ga0395898_0164851 Ga0395898_0164851_1561_2016 150
153 3300037466 Ga0395898_0261712 Ga0395898_0261712_1143_1595 150
154 3300037471 Ga0395905_0112750 Ga0395905_0112750_668_1123 150
155 3300037471 Ga0395905_0323631 Ga0395905_0323631_226_684 150
156 3300037853 Ga0436364_0477538 Ga0436364_0477538_38_493 150
157 3300038443 Ga0395901_0002853 Ga0395901_0002853_15329_15781 150
158 3300038443 Ga0395901_0003265 Ga0395901_0003265_574_1029 150
159 3300039450 Ga0436363_1330396 Ga0436363_1330396_87_542 150
160 3300041463 Ga0451804_1125088 Ga0451804_1125088_12_467 150
161 3300042005 Ga0439448_0272591 Ga0439448_0272591_123_575 150
162 3300044658 Ga0466972_0033723 Ga0466972_0033723_1902_2363 150
163 3300044683 Ga0466965_0290975 Ga0466965_0290975_319_771 150
164 3300044684 Ga0466966_0066575 Ga0466966_0066575_1708_2160 150
165 3300044684 Ga0466966_0154459 Ga0466966_0154459_98_550 150
166 3300044684 Ga0466966_0353639 Ga0466966_0353639_230_682 150
167 3300044693 Ga0466961_0068663 Ga0466961_0068663_1193_1645 150
168 3300044693 Ga0466961_0176794 Ga0466961_0176794_113_574 150
169 3300044694 Ga0466963_0003463 Ga0466963_0003463_1329_1781 150
170 3300044694 Ga0466963_0014657 Ga0466963_0014657_2075_2527 150
171 3300044694 Ga0466963_0033727 Ga0466963_0033727_1949_2404 150
172 3300044694 Ga0466963_0081835 Ga0466963_0081835_1233_1697 150
173 3300044706 Ga0466964_0062823 Ga0466964_0062823_339_791 150
174 3300044719 Ga0466971_0000387 Ga0466971_0000387_12011_12463 150
175 3300044765 Ga0466970_0081724 Ga0466970_0081724_329_781 150
176 3300044842 Ga0466957_0005219 Ga0466957_0005219_2099_2551 150
177 3300044901 Ga0466960_0105935 Ga0466960_0105935_336_791 150
178 3300044901 Ga0466960_0388959 Ga0466960_0388959_292_747 150
179 3300045049 Ga0466959_0068283 Ga0466959_0068283_138_590 150
180 3300045049 Ga0466959_0072115 Ga0466959_0072115_1432_1884 150
181 3300045049 Ga0466959_0125138 Ga0466959_0125138_344_805 150
182 3300045836 Ga0466958_0000662 Ga0466958_0000662_5350_5802 150
183 3300045836 Ga0466958_0546934 Ga0466958_0546934_76_528 150
184 3300045976 Ga0466967_0000496 Ga0466967_0000496_12744_13196 150
185 3300045976 Ga0466967_0005093 Ga0466967_0005093_3001_3453 150
186 3300045976 Ga0466967_0040876 Ga0466967_0040876_3371_3835 150
187 3300045976 Ga0466967_0077400 Ga0466967_0077400_930_1382 150
188 3300045976 Ga0466967_0106020 Ga0466967_0106020_2070_2525 150
189 3300045976 Ga0466967_0110388 Ga0466967_0110388_1439_1891 150
190 3300045976 Ga0466967_0916609 Ga0466967_0916609_261_713 150
191 3300045976 Ga0466967_1073835 Ga0466967_1073835_205_657 150
192 3300045976 Ga0466967_1323415 Ga0466967_1323415_211_663 150
193 3300046454 Ga0495592_0130178 Ga0495592_0130178_557_1009 150
194 3300046459 Ga0495629_0088731 Ga0495629_0088731_263_715 150
195 3300046461 Ga0495641_0043325 Ga0495641_0043325_742_1194 150
196 3300046461 Ga0495641_0268759 Ga0495641_0268759_223_675 150
197 3300046462 Ga0495651_0039549 Ga0495651_0039549_1609_2061 150
198 3300046462 Ga0495651_0066945 Ga0495651_0066945_2257_2709 150
199 3300046463 Ga0495653_0037559 Ga0495653_0037559_190_642 150
200 3300046473 Ga0495582_0033654 Ga0495582_0033654_1006_1458 150
201 3300046476 Ga0495662_0055336 Ga0495662_0055336_1235_1687 150
202 3300046511 Ga0495608_0006490 Ga0495608_0006490_611_1063 150
203 3300046511 Ga0495608_0332217 Ga0495608_0332217_154_606 150
204 3300046514 Ga0495618_0064255 Ga0495618_0064255_1656_2108 150
205 3300046516 Ga0495628_0014804 Ga0495628_0014804_5567_6019 150
206 3300046516 Ga0495628_0030454 Ga0495628_0030454_545_997 150
207 3300046517 Ga0495630_0016696 Ga0495630_0016696_2055_2507 150
208 3300046517 Ga0495630_0052435 Ga0495630_0052435_1128_1580 150
209 3300046517 Ga0495630_0158447 Ga0495630_0158447_325_777 150
210 3300046529 Ga0495652_0071636 Ga0495652_0071636_259_711 150
211 3300046533 Ga0495640_0027639 Ga0495640_0027639_2895_3347 150
212 3300046533 Ga0495640_0055805 Ga0495640_0055805_125_577 150
213 3300046536 Ga0495587_0013168 Ga0495587_0013168_838_1290 150
214 3300046536 Ga0495587_0310355 Ga0495587_0310355_345_797 150
215 3300046543 Ga0495645_0251280 Ga0495645_0251280_569_1021 150
216 3300046559 Ga0495667_0018250 Ga0495667_0018250_1020_1472 150
217 3300046642 Ga0495634_0089774 Ga0495634_0089774_154_606 150
218 3300046663 Ga0495635_0110710 Ga0495635_0110710_1020_1472 150
219 3300046675 Ga0495657_0003812 Ga0495657_0003812_5330_5782 150
220 3300046675 Ga0495657_0051910 Ga0495657_0051910_317_769 150
221 3300046678 Ga0495599_0241117 Ga0495599_0241117_388_840 150
222 3300046679 Ga0495623_0100429 Ga0495623_0100429_933_1385 150
223 3300046680 Ga0495646_0051375 Ga0495646_0051375_2000_2452 150
224 3300046683 Ga0495658_0295374 Ga0495658_0295374_168_620 150
225 3300046689 Ga0495613_0004233 Ga0495613_0004233_371_823 150
226 3300046809 Ga0495600_0004479 Ga0495600_0004479_3990_4442 150
227 3300047317 Ga0495604_0027950 Ga0495604_0027950_2950_3402 150
228 3300047319 Ga0495674_0004654 Ga0495674_0004654_3177_3629 150
229 3300047322 Ga0495680_0000965 Ga0495680_0000965_28105_28557 150
230 3300047322 Ga0495680_0002509 Ga0495680_0002509_10843_11295 150
231 3300047471 Ga0495684_0017271 Ga0495684_0017271_1917_2369 150
232 3300047471 Ga0495684_0039666 Ga0495684_0039666_72_524 150
233 3300047673 Ga0495593_0098374 Ga0495593_0098374_552_1004 150
234 3300048088 Ga0495602_0045068 Ga0495602_0045068_1946_2398 150
235 3300048088 Ga0495602_0062936 Ga0495602_0062936_1971_2423 150
236 3300048088 Ga0495602_0158054 Ga0495602_0158054_440_892 150
237 3300048088 Ga0495602_0698553 Ga0495602_0698553_220_672 150
238 3300048903 Ga0496100_0046494 Ga0496100_0046494_2131_2583 150
239 3300048904 Ga0496101_0073519 Ga0496101_0073519_680_1132 150
240 3300048905 Ga0496102_0092592 Ga0496102_0092592_1484_1936 150
241 3300048906 Ga0496103_0152591 Ga0496103_0152591_228_680 150
242 3300048908 Ga0496105_1363033 Ga0496105_1363033_51_503 150
243 3300048909 Ga0496106_0027569 Ga0496106_0027569_3579_4031 150
244 3300048909 Ga0496106_0053060 Ga0496106_0053060_858_1310 150
245 3300048910 Ga0496107_0063123 Ga0496107_0063123_1525_1977 150
246 3300048910 Ga0496107_0132220 Ga0496107_0132220_12_464 150
247 3300048917 Ga0496114_0117918 Ga0496114_0117918_891_1343 150
248 3300048917 Ga0496114_0145041 Ga0496114_0145041_233_685 150
249 3300048918 Ga0496115_0314521 Ga0496115_0314521_297_749 150
250 3300049585 Ga0501069_0043501 Ga0501069_0043501_282_746 150
251 3300049585 Ga0501069_0062685 Ga0501069_0062685_1227_1679 150
252 3300049586 Ga0501070_0000677 Ga0501070_0000677_26126_26590 150
253 3300049586 Ga0501070_0120393 Ga0501070_0120393_308_760 150
254 3300049586 Ga0501070_0632126 Ga0501070_0632126_159_611 150
255 3300049590 Ga0501074_0386353 Ga0501074_0386353_484_948 150
256 3300049742 Ga0501080_0116678 Ga0501080_0116678_677_1129 150
257 3300049742 Ga0501080_1857139 Ga0501080_1857139_34_486 150
258 3300049822 Ga0501035_0228576 Ga0501035_0228576_745_1209 150
259 3300049823 Ga0501044_0551438 Ga0501044_0551438_335_787 150
260 3300050512 nmdc:mga0n895_82843_c1 nmdc:mga0n895_82843_c1_253_705 150
261 3300050513 nmdc:mga0rr50_21340_c1 nmdc:mga0rr50_21340_c1_1667_2119 150
262 3300053077 Ga0495601_0243134 Ga0495601_0243134_231_683 150
263 3300053084 Ga0495595_0006495 Ga0495595_0006495_2904_3356 150
264 3300053085 Ga0495619_0009728 Ga0495619_0009728_3156_3608 150
265 3300061719 Ga0466962_0005515 Ga0466962_0005515_4712_5164 150
266 3300061719 Ga0466962_0325237 Ga0466962_0325237_297_749 150

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04073

tRNA_edit

Aminoacyl-tRNA editing domain

50

171

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dxa-assembly1.cif.gz_A crystal structure of trans editing enzyme prox from e.coli 0.9244 1 150
2dxa-assembly1.cif.gz_A crystal structure of trans editing enzyme prox from e.coli 0.9184 1 150
1dbx-assembly2.cif.gz_B crystal structure of cysteinyl-trna(pro) deacylase from h. influenzae (hi1434) 0.9003 2 150
1dbx-assembly2.cif.gz_B crystal structure of cysteinyl-trna(pro) deacylase from h. influenzae (hi1434) 0.8886 2 150
1dbu-assembly1.cif.gz_A crystal structure of cysteinyl-trna(pro) deacylase protein from h. influenzae (hi1434) 0.8881 2 150
ID Description Score Start End Superfamily
af_Q2G0A0_1_158_3.90.960.10 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.9227 2 148 3.90.960.10
af_Q2G0A0_1_158_3.90.960.10 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.8991 2 148 3.90.960.10
1wdvB00 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.88 3 150 3.90.960.10
1dbxB00 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.877 2 150 3.90.960.10
af_Q4DLP0_103_258_3.90.960.10 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.8706 31 148 3.90.960.10
ID Description Score Start End GO Terms
AF-A0A840IFR0-F1-model_v4 Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase (EC 4.2.-.-) 0.9735 1 150 GO:0002161
GO:0006412
GO:0016829
AF-A0PRC1-F1-model_v4 Conserved hypothetical membrane protein 0.9703 46 150 GO:0002161
GO:0006412
AF-A0A159ZAH5-F1-model_v4 Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase (EC 4.2.-.-) 0.9684 1 150 GO:0002161
GO:0006412
GO:0016829
AF-A0A6L7GBN3-F1-model_v4 Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase (EC 4.2.-.-) 0.9683 1 150 GO:0002161
GO:0006412
GO:0016829
AF-A0A6G2UW32-F1-model_v4 Cys-tRNA(Pro) deacylase 0.9672 43 150 GO:0002161
GO:0006412
GO:0016829

Feature Viewer

pLDDT pTM Quality
96.04 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map