F374320
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 266 | 158 | 266 | 151 |
Family's Representative Sequence
| Representative Sequence | 3300048908|Ga0496105_0323737|Ga0496105_0323737_98_646 |
| Length | 182 |
| Sequence | VGGSSTGTIHAAAAFRVPVDTVTGVATGTPATALLAKLQIPHTLHPYEHDPRAQAYGEEAAAALGVDPAQLFKTLIATVDGKLACAVVPVAARLDLKRFAAALGGKRAELAEPAAAARATGYVVGGISPIGQKARLRVVVDESAEAFPTVYVSAGKRGLQVELAPADLVRAAGASVAAVAAV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 4 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 13 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 14 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 15 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 16 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 17 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 21 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 22 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 23 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 24 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 25 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 26 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 27 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 28 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 29 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 30 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 31 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 32 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 33 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 34 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 35 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 36 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 37 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 38 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 60 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 61 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 62 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 63 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 64 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 65 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 66 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 67 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 68 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 69 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 70 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 71 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 72 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 73 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 74 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 75 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 76 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 77 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 78 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 79 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 80 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 81 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 82 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 83 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 84 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 85 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 86 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 87 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 88 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 89 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 90 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 91 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 92 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 93 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 94 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 95 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 96 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 97 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 98 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 99 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 100 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 101 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 102 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 103 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 104 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 105 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 106 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 138 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 139 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 140 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 141 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 142 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 143 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 144 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 145 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 146 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 147 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 148 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 149 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 150 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 151 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 152 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 153 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 154 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 155 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.62 |
| Metatranscriptomes | 3.38 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 6.02 |
| Rhizosphere | 93.23 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.75 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10222122 | 3300005327 | Bacteria | 1598 |
| 2 | Ga0070658_10487626 | 3300005327 | Bacteria | 1064 |
| 3 | Ga0070658_10819880 | 3300005327 | Bacteria | 808 |
| 4 | Ga0070683_100020837 | 3300005329 | Bacteria | 5841 |
| 5 | Ga0070683_100025194 | 3300005329 | Bacteria | 5339 |
| 6 | Ga0070683_100419542 | 3300005329 | Bacteria | 1276 |
| 7 | Ga0070680_100367492 | 3300005336 | Bacteria | 1224 |
| 8 | Ga0070680_100486389 | 3300005336 | Bacteria | 1055 |
| 9 | Ga0070661_100083377 | 3300005344 | Bacteria | 2361 |
| 10 | Ga0070661_100135702 | 3300005344 | Bacteria | 1851 |
| 11 | Ga0070661_100926560 | 3300005344 | Unclassified | 720 |
| 12 | Ga0070671_100556311 | 3300005355 | Bacteria | 989 |
| 13 | Ga0070714_100072946 | 3300005435 | Bacteria | 2973 |
| 14 | Ga0070714_101459336 | 3300005435 | Bacteria | 668 |
| 15 | Ga0070708_100843400 | 3300005445 | Bacteria | 861 |
| 16 | Ga0070681_10151691 | 3300005458 | Bacteria | 2244 |
| 17 | Ga0070679_100036913 | 3300005530 | Bacteria | 4851 |
| 18 | Ga0070679_100048468 | 3300005530 | Bacteria | 4232 |
| 19 | Ga0070684_100002166 | 3300005535 | Bacteria | 14495 |
| 20 | Ga0070684_100121717 | 3300005535 | Bacteria | 2348 |
| 21 | Ga0070684_100128370 | 3300005535 | Bacteria | 2286 |
| 22 | Ga0070684_100736928 | 3300005535 | Bacteria | 920 |
| 23 | Ga0070693_100231036 | 3300005547 | Bacteria | 1217 |
| 24 | Ga0068855_100030931 | 3300005563 | Bacteria | 6397 |
| 25 | Ga0068855_100058213 | 3300005563 | Bacteria | 4526 |
| 26 | Ga0068855_100311295 | 3300005563 | Bacteria | 1742 |
| 27 | Ga0068855_100485839 | 3300005563 | Bacteria | 1344 |
| 28 | Ga0068857_100332744 | 3300005577 | Bacteria | 1404 |
| 29 | Ga0068856_100073700 | 3300005614 | Bacteria | 3380 |
| 30 | Ga0068856_100184859 | 3300005614 | Bacteria | 2098 |
| 31 | Ga0068856_100297977 | 3300005614 | Bacteria | 1630 |
| 32 | Ga0068856_100475213 | 3300005614 | Bacteria | 1271 |
| 33 | Ga0068852_100020578 | 3300005616 | Bacteria | 5249 |
| 34 | Ga0068852_100890420 | 3300005616 | Bacteria | 907 |
| 35 | Ga0068851_10817035 | 3300005834 | Bacteria | 580 |
| 36 | Ga0070717_10076183 | 3300006028 | Bacteria | 2807 |
| 37 | Ga0070715_10874698 | 3300006163 | Bacteria | 551 |
| 38 | Ga0070712_100655768 | 3300006175 | Bacteria | 892 |
| 39 | Ga0070712_100893152 | 3300006175 | Bacteria | 766 |
| 40 | Ga0075434_100242196 | 3300006871 | Bacteria | 1823 |
| 41 | Ga0075435_100005481 | 3300007076 | Bacteria | 8869 |
| 42 | Ga0105240_10047226 | 3300009093 | Bacteria | 5449 |
| 43 | Ga0105240_10122010 | 3300009093 | Bacteria | 3137 |
| 44 | Ga0105240_10183978 | 3300009093 | Bacteria | 2463 |
| 45 | Ga0105245_12805418 | 3300009098 | Bacteria | 540 |
| 46 | Ga0105243_10798007 | 3300009148 | Bacteria | 930 |
| 47 | Ga0105241_10667744 | 3300009174 | Bacteria | 946 |
| 48 | Ga0105241_11845853 | 3300009174 | Bacteria | 591 |
| 49 | Ga0105237_10062162 | 3300009545 | Bacteria | 3733 |
| 50 | Ga0105238_10164361 | 3300009551 | Bacteria | 2195 |
| 51 | Ga0157373_10011418 | 3300013100 | Bacteria | 6533 |
| 52 | Ga0157370_10058261 | 3300013104 | Bacteria | 3672 |
| 53 | Ga0157370_10341332 | 3300013104 | Bacteria | 1381 |
| 54 | Ga0157370_10499152 | 3300013104 | Bacteria | 1117 |
| 55 | Ga0157369_10006123 | 3300013105 | Bacteria | 13961 |
| 56 | Ga0157369_11544219 | 3300013105 | Bacteria | 675 |
| 57 | Ga0157372_10071007 | 3300013307 | Bacteria | 3920 |
| 58 | Ga0182006_1200034 | 3300015261 | Bacteria | 662 |
| 59 | Ga0182007_10025727 | 3300015262 | Bacteria | 2047 |
| 60 | Ga0197907_11221306 | 3300020069 | Bacteria | 870 |
| 61 | Ga0197907_11432064 | 3300020069 | Bacteria | 547 |
| 62 | Ga0206356_10597032 | 3300020070 | Bacteria | 1350 |
| 63 | Ga0206354_11720673 | 3300020081 | Bacteria | 1558 |
| 64 | Ga0206353_10029576 | 3300020082 | Bacteria | 4035 |
| 65 | Ga0206353_10042058 | 3300020082 | Bacteria | 3303 |
| 66 | Ga0206353_10127022 | 3300020082 | Bacteria | 3218 |
| 67 | Ga0206353_11059685 | 3300020082 | Bacteria | 1092 |
| 68 | Ga0206353_11905109 | 3300020082 | Bacteria | 2978 |
| 69 | Ga0207692_10267110 | 3300025898 | Unclassified | 1030 |
| 70 | Ga0207707_10189819 | 3300025912 | Bacteria | 1793 |
| 71 | Ga0207707_10694928 | 3300025912 | Bacteria | 854 |
| 72 | Ga0207707_11235255 | 3300025912 | Bacteria | 603 |
| 73 | Ga0207695_10246095 | 3300025913 | Bacteria | 1688 |
| 74 | Ga0207695_10383664 | 3300025913 | Bacteria | 1291 |
| 75 | Ga0207695_10743848 | 3300025913 | Bacteria | 861 |
| 76 | Ga0207671_10176495 | 3300025914 | Bacteria | 1661 |
| 77 | Ga0207693_10074493 | 3300025915 | Bacteria | 2659 |
| 78 | Ga0207660_10188764 | 3300025917 | Bacteria | 1604 |
| 79 | Ga0207657_10002431 | 3300025919 | Bacteria | 20110 |
| 80 | Ga0207657_10297620 | 3300025919 | Bacteria | 1278 |
| 81 | Ga0207649_10144732 | 3300025920 | Bacteria | 1630 |
| 82 | Ga0207649_10276291 | 3300025920 | Bacteria | 1220 |
| 83 | Ga0207649_10747246 | 3300025920 | Unclassified | 761 |
| 84 | Ga0207652_10528300 | 3300025921 | Bacteria | 1061 |
| 85 | Ga0207694_10135887 | 3300025924 | Bacteria | 1974 |
| 86 | Ga0207700_10589368 | 3300025928 | Bacteria | 989 |
| 87 | Ga0207664_10803335 | 3300025929 | Bacteria | 846 |
| 88 | Ga0207664_10976659 | 3300025929 | Bacteria | 759 |
| 89 | Ga0207644_10222021 | 3300025931 | Bacteria | 1498 |
| 90 | Ga0207661_10082448 | 3300025944 | Bacteria | 2659 |
| 91 | Ga0207679_11244875 | 3300025945 | Bacteria | 683 |
| 92 | Ga0207667_11403877 | 3300025949 | Bacteria | 672 |
| 93 | Ga0207640_11059987 | 3300025981 | Bacteria | 716 |
| 94 | Ga0207639_10865927 | 3300026041 | Bacteria | 844 |
| 95 | Ga0207702_10152626 | 3300026078 | Bacteria | 2102 |
| 96 | Ga0207702_11095383 | 3300026078 | Bacteria | 790 |
| 97 | Ga0207683_10020907 | 3300026121 | Bacteria | 5600 |
| 98 | Ga0207698_10123184 | 3300026142 | Bacteria | 2199 |
| 99 | Ga0207698_10833964 | 3300026142 | Bacteria | 926 |
| 100 | Ga0207698_11436908 | 3300026142 | Bacteria | 705 |
| 101 | Ga0265326_10064906 | 3300028558 | Bacteria | 1032 |
| 102 | Ga0265334_10057543 | 3300028573 | Bacteria | 1473 |
| 103 | Ga0265318_10277958 | 3300028577 | Bacteria | 611 |
| 104 | Ga0265322_10021957 | 3300028654 | Bacteria | 1828 |
| 105 | Ga0265336_10077398 | 3300028666 | Bacteria | 994 |
| 106 | Ga0265338_10007452 | 3300028800 | Bacteria | 13579 |
| 107 | Ga0265338_10029168 | 3300028800 | Bacteria | 5479 |
| 108 | Ga0265338_10067787 | 3300028800 | Bacteria | 3079 |
| 109 | Ga0265324_10039589 | 3300029957 | Bacteria | 1634 |
| 110 | Ga0265325_10013463 | 3300031241 | Bacteria | 4657 |
| 111 | Ga0265340_10276608 | 3300031247 | Bacteria | 746 |
| 112 | Ga0265339_10026715 | 3300031249 | Bacteria | 3304 |
| 113 | Ga0265331_10050210 | 3300031250 | Bacteria | 2001 |
| 114 | Ga0265327_10007278 | 3300031251 | Bacteria | 8586 |
| 115 | Ga0265316_10049928 | 3300031344 | Bacteria | 3293 |
| 116 | Ga0265313_10018970 | 3300031595 | Bacteria | 3844 |
| 117 | Ga0265313_10038323 | 3300031595 | Bacteria | 2388 |
| 118 | Ga0265313_10329275 | 3300031595 | Bacteria | 609 |
| 119 | Ga0265342_10032996 | 3300031712 | Bacteria | 3188 |
| 120 | Ga0265342_10156943 | 3300031712 | Bacteria | 1260 |
| 121 | Ga0373944_0025703 | 3300035089 | Bacteria | 1735 |
| 122 | Ga0373936_0044277 | 3300035113 | Bacteria | 1790 |
| 123 | Ga0373945_0069466 | 3300035116 | Bacteria | 1330 |
| 124 | Ga0373954_0054359 | 3300035118 | Bacteria | 1883 |
| 125 | Ga0373943_0006557 | 3300035170 | Bacteria | 5223 |
| 126 | Ga0373943_0425647 | 3300035170 | Bacteria | 769 |
| 127 | Ga0373955_0177815 | 3300035172 | Bacteria | 1262 |
| 128 | Ga0373924_0169555 | 3300035410 | Bacteria | 959 |
| 129 | Ga0373935_0043565 | 3300035692 | Bacteria | 2825 |
| 130 | Ga0373947_0003721 | 3300035725 | Bacteria | 9009 |
| 131 | Ga0373947_0515948 | 3300035725 | Bacteria | 813 |
| 132 | Ga0373937_0340204 | 3300036401 | Bacteria | 1421 |
| 133 | Ga0373925_0099129 | 3300037068 | Bacteria | 2237 |
| 134 | Ga0395900_0115320 | 3300037418 | Bacteria | 2756 |
| 135 | Ga0395900_0183082 | 3300037418 | Bacteria | 2128 |
| 136 | Ga0395900_0261641 | 3300037418 | Bacteria | 1727 |
| 137 | Ga0395900_1067564 | 3300037418 | Bacteria | 726 |
| 138 | Ga0395898_0001313 | 3300037466 | Bacteria | 36176 |
| 139 | Ga0395898_0139924 | 3300037466 | Bacteria | 2317 |
| 140 | Ga0395898_0164851 | 3300037466 | Bacteria | 2119 |
| 141 | Ga0395898_0261712 | 3300037466 | Bacteria | 1650 |
| 142 | Ga0395905_0112750 | 3300037471 | Bacteria | 2554 |
| 143 | Ga0395905_0323631 | 3300037471 | Bacteria | 1432 |
| 144 | Ga0436364_0477538 | 3300037853 | Bacteria | 679 |
| 145 | Ga0395901_0002853 | 3300038443 | Bacteria | 17452 |
| 146 | Ga0395901_0003265 | 3300038443 | Bacteria | 16325 |
| 147 | Ga0436363_1330396 | 3300039450 | Bacteria | 711 |
| 148 | Ga0451804_1125088 | 3300041463 | Bacteria | 529 |
| 149 | Ga0439448_0272591 | 3300042005 | Bacteria | 599 |
| 150 | Ga0466972_0033723 | 3300044658 | Bacteria | 2511 |
| 151 | Ga0466965_0290975 | 3300044683 | Bacteria | 884 |
| 152 | Ga0466966_0066575 | 3300044684 | Bacteria | 2264 |
| 153 | Ga0466966_0154459 | 3300044684 | Bacteria | 1398 |
| 154 | Ga0466966_0179469 | 3300044684 | Bacteria | 1285 |
| 155 | Ga0466966_0353639 | 3300044684 | Bacteria | 883 |
| 156 | Ga0466966_0535204 | 3300044684 | Bacteria | 705 |
| 157 | Ga0466961_0068663 | 3300044693 | Bacteria | 2250 |
| 158 | Ga0466961_0176794 | 3300044693 | Bacteria | 1326 |
| 159 | Ga0466963_0003463 | 3300044694 | Bacteria | 9043 |
| 160 | Ga0466963_0014657 | 3300044694 | Bacteria | 4839 |
| 161 | Ga0466963_0033727 | 3300044694 | Bacteria | 3326 |
| 162 | Ga0466963_0081835 | 3300044694 | Bacteria | 2188 |
| 163 | Ga0466963_0366878 | 3300044694 | Bacteria | 1014 |
| 164 | Ga0466964_0062823 | 3300044706 | Bacteria | 1549 |
| 165 | Ga0466971_0000387 | 3300044719 | Bacteria | 16986 |
| 166 | Ga0466971_0096045 | 3300044719 | Bacteria | 1359 |
| 167 | Ga0466970_0081724 | 3300044765 | Bacteria | 1747 |
| 168 | Ga0466957_0005219 | 3300044842 | Bacteria | 7270 |
| 169 | Ga0466957_0049990 | 3300044842 | Bacteria | 2543 |
| 170 | Ga0466960_0105935 | 3300044901 | Bacteria | 1454 |
| 171 | Ga0466960_0388959 | 3300044901 | Bacteria | 801 |
| 172 | Ga0466959_0068283 | 3300045049 | Bacteria | 2576 |
| 173 | Ga0466959_0072115 | 3300045049 | Bacteria | 2500 |
| 174 | Ga0466959_0125138 | 3300045049 | Bacteria | 1825 |
| 175 | Ga0466958_0000662 | 3300045836 | Bacteria | 14905 |
| 176 | Ga0466958_0546934 | 3300045836 | Bacteria | 752 |
| 177 | Ga0466967_0000496 | 3300045976 | Bacteria | 19228 |
| 178 | Ga0466967_0005093 | 3300045976 | Bacteria | 9023 |
| 179 | Ga0466967_0012272 | 3300045976 | Bacteria | 6544 |
| 180 | Ga0466967_0040876 | 3300045976 | Bacteria | 3994 |
| 181 | Ga0466967_0077400 | 3300045976 | Bacteria | 2994 |
| 182 | Ga0466967_0106020 | 3300045976 | Bacteria | 2575 |
| 183 | Ga0466967_0110388 | 3300045976 | Bacteria | 2526 |
| 184 | Ga0466967_0308764 | 3300045976 | Bacteria | 1523 |
| 185 | Ga0466967_0916609 | 3300045976 | Bacteria | 872 |
| 186 | Ga0466967_1073835 | 3300045976 | Bacteria | 802 |
| 187 | Ga0466967_1323415 | 3300045976 | Bacteria | 717 |
| 188 | Ga0495592_0130178 | 3300046454 | Bacteria | 1761 |
| 189 | Ga0495629_0088731 | 3300046459 | Bacteria | 2157 |
| 190 | Ga0495641_0043325 | 3300046461 | Bacteria | 2082 |
| 191 | Ga0495641_0268759 | 3300046461 | Bacteria | 767 |
| 192 | Ga0495651_0039549 | 3300046462 | Bacteria | 3671 |
| 193 | Ga0495651_0066945 | 3300046462 | Bacteria | 2740 |
| 194 | Ga0495653_0037559 | 3300046463 | Bacteria | 3804 |
| 195 | Ga0495582_0033654 | 3300046473 | Bacteria | 2818 |
| 196 | Ga0495662_0055336 | 3300046476 | Bacteria | 1917 |
| 197 | Ga0495608_0006490 | 3300046511 | Bacteria | 8303 |
| 198 | Ga0495608_0332217 | 3300046511 | Bacteria | 937 |
| 199 | Ga0495618_0064255 | 3300046514 | Bacteria | 2332 |
| 200 | Ga0495628_0014804 | 3300046516 | Bacteria | 6524 |
| 201 | Ga0495628_0030454 | 3300046516 | Bacteria | 4369 |
| 202 | Ga0495630_0016696 | 3300046517 | Bacteria | 5369 |
| 203 | Ga0495630_0052435 | 3300046517 | Bacteria | 3054 |
| 204 | Ga0495630_0158447 | 3300046517 | Bacteria | 1723 |
| 205 | Ga0495652_0071636 | 3300046529 | Bacteria | 2891 |
| 206 | Ga0495640_0027639 | 3300046533 | Bacteria | 4090 |
| 207 | Ga0495640_0055805 | 3300046533 | Bacteria | 2701 |
| 208 | Ga0495587_0013168 | 3300046536 | Bacteria | 5200 |
| 209 | Ga0495587_0310355 | 3300046536 | Bacteria | 881 |
| 210 | Ga0495645_0251280 | 3300046543 | Bacteria | 1175 |
| 211 | Ga0495667_0018250 | 3300046559 | Bacteria | 4739 |
| 212 | Ga0495634_0089774 | 3300046642 | Bacteria | 1997 |
| 213 | Ga0495635_0110710 | 3300046663 | Bacteria | 1876 |
| 214 | Ga0495657_0003812 | 3300046675 | Bacteria | 12203 |
| 215 | Ga0495657_0051910 | 3300046675 | Bacteria | 2752 |
| 216 | Ga0495599_0241117 | 3300046678 | Unclassified | 1102 |
| 217 | Ga0495623_0100429 | 3300046679 | Bacteria | 1763 |
| 218 | Ga0495646_0051375 | 3300046680 | Bacteria | 2495 |
| 219 | Ga0495658_0295374 | 3300046683 | Bacteria | 1024 |
| 220 | Ga0495613_0004233 | 3300046689 | Bacteria | 10750 |
| 221 | Ga0495600_0004479 | 3300046809 | Bacteria | 8369 |
| 222 | Ga0495604_0027950 | 3300047317 | Bacteria | 4485 |
| 223 | Ga0495674_0004654 | 3300047319 | Bacteria | 13188 |
| 224 | Ga0495680_0000965 | 3300047322 | Bacteria | 31875 |
| 225 | Ga0495680_0002509 | 3300047322 | Bacteria | 18776 |
| 226 | Ga0495684_0017271 | 3300047471 | Bacteria | 5555 |
| 227 | Ga0495684_0039666 | 3300047471 | Bacteria | 3610 |
| 228 | Ga0495593_0098374 | 3300047673 | Bacteria | 1502 |
| 229 | Ga0495602_0045068 | 3300048088 | Bacteria | 3994 |
| 230 | Ga0495602_0062936 | 3300048088 | Bacteria | 3217 |
| 231 | Ga0495602_0158054 | 3300048088 | Bacteria | 1773 |
| 232 | Ga0495602_0698553 | 3300048088 | Bacteria | 689 |
| 233 | Ga0496100_0046494 | 3300048903 | Bacteria | 2791 |
| 234 | Ga0496101_0073519 | 3300048904 | Bacteria | 2511 |
| 235 | Ga0496102_0092592 | 3300048905 | Bacteria | 2799 |
| 236 | Ga0496103_0152591 | 3300048906 | Bacteria | 1480 |
| 237 | Ga0496105_0323737 | 3300048908 | Bacteria | 1235 |
| 238 | Ga0496105_1363033 | 3300048908 | Bacteria | 515 |
| 239 | Ga0496106_0027569 | 3300048909 | Bacteria | 4231 |
| 240 | Ga0496106_0053060 | 3300048909 | Bacteria | 3061 |
| 241 | Ga0496107_0063123 | 3300048910 | Bacteria | 2684 |
| 242 | Ga0496107_0132220 | 3300048910 | Bacteria | 1842 |
| 243 | Ga0496109_0076194 | 3300048912 | Bacteria | 3085 |
| 244 | Ga0496114_0117918 | 3300048917 | Bacteria | 2280 |
| 245 | Ga0496114_0145041 | 3300048917 | Bacteria | 2057 |
| 246 | Ga0496115_0045924 | 3300048918 | Bacteria | 3488 |
| 247 | Ga0496115_0314521 | 3300048918 | Bacteria | 1282 |
| 248 | Ga0501069_0043501 | 3300049585 | Bacteria | 2486 |
| 249 | Ga0501069_0062685 | 3300049585 | Bacteria | 2076 |
| 250 | Ga0501070_0000677 | 3300049586 | Bacteria | 31275 |
| 251 | Ga0501070_0120393 | 3300049586 | Bacteria | 2169 |
| 252 | Ga0501070_0632126 | 3300049586 | Bacteria | 851 |
| 253 | Ga0501074_0386353 | 3300049590 | Bacteria | 993 |
| 254 | Ga0501080_0116678 | 3300049742 | Bacteria | 2474 |
| 255 | Ga0501080_1857139 | 3300049742 | Bacteria | 505 |
| 256 | Ga0501035_0228576 | 3300049822 | Bacteria | 1586 |
| 257 | Ga0501044_0551438 | 3300049823 | Bacteria | 1050 |
| 258 | nmdc:mga0n895_82843_c1 | 3300050512 | Bacteria | 3198 |
| 259 | nmdc:mga0rr50_21340_c1 | 3300050513 | Bacteria | 4419 |
| 260 | Ga0495601_0243134 | 3300053077 | Unclassified | 1175 |
| 261 | Ga0495595_0006495 | 3300053084 | Bacteria | 4771 |
| 262 | Ga0495595_0513887 | 3300053084 | Bacteria | 611 |
| 263 | Ga0495619_0009728 | 3300053085 | Bacteria | 6062 |
| 264 | Ga0466962_0003658 | 3300061719 | Bacteria | 7332 |
| 265 | Ga0466962_0005515 | 3300061719 | Bacteria | 6075 |
| 266 | Ga0466962_0325237 | 3300061719 | Bacteria | 763 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044684 | Ga0466966_0179469 | Ga0466966_0179469_518_958 | 146 |
| 2 | 3300044694 | Ga0466963_0366878 | Ga0466963_0366878_47_496 | 146 |
| 3 | 3300044719 | Ga0466971_0096045 | Ga0466971_0096045_712_1161 | 146 |
| 4 | 3300044842 | Ga0466957_0049990 | Ga0466957_0049990_1950_2399 | 146 |
| 5 | 3300045976 | Ga0466967_0012272 | Ga0466967_0012272_1027_1467 | 146 |
| 6 | 3300045976 | Ga0466967_0308764 | Ga0466967_0308764_289_738 | 146 |
| 7 | 3300048918 | Ga0496115_0045924 | Ga0496115_0045924_11_451 | 146 |
| 8 | 3300053084 | Ga0495595_0513887 | Ga0495595_0513887_68_508 | 146 |
| 9 | 3300061719 | Ga0466962_0003658 | Ga0466962_0003658_1533_1982 | 146 |
| 10 | 3300044684 | Ga0466966_0535204 | Ga0466966_0535204_132_650 | 149 |
| 11 | 3300048908 | Ga0496105_0323737 | Ga0496105_0323737_98_646 | 149 |
| 12 | 3300048912 | Ga0496109_0076194 | Ga0496109_0076194_1628_2176 | 149 |
| 13 | 3300005327 | Ga0070658_10222122 | Ga0070658_102221222 | 150 |
| 14 | 3300005327 | Ga0070658_10487626 | Ga0070658_104876261 | 150 |
| 15 | 3300005327 | Ga0070658_10819880 | Ga0070658_108198802 | 150 |
| 16 | 3300005329 | Ga0070683_100020837 | Ga0070683_1000208372 | 150 |
| 17 | 3300005329 | Ga0070683_100025194 | Ga0070683_1000251942 | 150 |
| 18 | 3300005329 | Ga0070683_100419542 | Ga0070683_1004195423 | 150 |
| 19 | 3300005336 | Ga0070680_100367492 | Ga0070680_1003674922 | 150 |
| 20 | 3300005336 | Ga0070680_100486389 | Ga0070680_1004863892 | 150 |
| 21 | 3300005344 | Ga0070661_100083377 | Ga0070661_1000833773 | 150 |
| 22 | 3300005344 | Ga0070661_100135702 | Ga0070661_1001357022 | 150 |
| 23 | 3300005344 | Ga0070661_100926560 | Ga0070661_1009265602 | 150 |
| 24 | 3300005355 | Ga0070671_100556311 | Ga0070671_1005563112 | 150 |
| 25 | 3300005435 | Ga0070714_100072946 | Ga0070714_1000729462 | 150 |
| 26 | 3300005435 | Ga0070714_101459336 | Ga0070714_1014593361 | 150 |
| 27 | 3300005445 | Ga0070708_100843400 | Ga0070708_1008434001 | 150 |
| 28 | 3300005458 | Ga0070681_10151691 | Ga0070681_101516913 | 150 |
| 29 | 3300005530 | Ga0070679_100036913 | Ga0070679_1000369133 | 150 |
| 30 | 3300005530 | Ga0070679_100048468 | Ga0070679_1000484681 | 150 |
| 31 | 3300005535 | Ga0070684_100002166 | Ga0070684_10000216610 | 150 |
| 32 | 3300005535 | Ga0070684_100121717 | Ga0070684_1001217172 | 150 |
| 33 | 3300005535 | Ga0070684_100128370 | Ga0070684_1001283702 | 150 |
| 34 | 3300005535 | Ga0070684_100736928 | Ga0070684_1007369281 | 150 |
| 35 | 3300005547 | Ga0070693_100231036 | Ga0070693_1002310363 | 150 |
| 36 | 3300005563 | Ga0068855_100030931 | Ga0068855_1000309313 | 150 |
| 37 | 3300005563 | Ga0068855_100058213 | Ga0068855_1000582132 | 150 |
| 38 | 3300005563 | Ga0068855_100311295 | Ga0068855_1003112952 | 150 |
| 39 | 3300005563 | Ga0068855_100485839 | Ga0068855_1004858391 | 150 |
| 40 | 3300005577 | Ga0068857_100332744 | Ga0068857_1003327442 | 150 |
| 41 | 3300005614 | Ga0068856_100073700 | Ga0068856_1000737002 | 150 |
| 42 | 3300005614 | Ga0068856_100184859 | Ga0068856_1001848592 | 150 |
| 43 | 3300005614 | Ga0068856_100297977 | Ga0068856_1002979772 | 150 |
| 44 | 3300005614 | Ga0068856_100475213 | Ga0068856_1004752132 | 150 |
| 45 | 3300005616 | Ga0068852_100020578 | Ga0068852_1000205785 | 150 |
| 46 | 3300005616 | Ga0068852_100890420 | Ga0068852_1008904202 | 150 |
| 47 | 3300005834 | Ga0068851_10817035 | Ga0068851_108170352 | 150 |
| 48 | 3300006028 | Ga0070717_10076183 | Ga0070717_100761834 | 150 |
| 49 | 3300006163 | Ga0070715_10874698 | Ga0070715_108746982 | 150 |
| 50 | 3300006175 | Ga0070712_100655768 | Ga0070712_1006557681 | 150 |
| 51 | 3300006175 | Ga0070712_100893152 | Ga0070712_1008931521 | 150 |
| 52 | 3300006871 | Ga0075434_100242196 | Ga0075434_1002421962 | 150 |
| 53 | 3300007076 | Ga0075435_100005481 | Ga0075435_1000054814 | 150 |
| 54 | 3300009093 | Ga0105240_10047226 | Ga0105240_100472266 | 150 |
| 55 | 3300009093 | Ga0105240_10122010 | Ga0105240_101220103 | 150 |
| 56 | 3300009093 | Ga0105240_10183978 | Ga0105240_101839782 | 150 |
| 57 | 3300009098 | Ga0105245_12805418 | Ga0105245_128054181 | 150 |
| 58 | 3300009148 | Ga0105243_10798007 | Ga0105243_107980071 | 150 |
| 59 | 3300009174 | Ga0105241_10667744 | Ga0105241_106677442 | 150 |
| 60 | 3300009174 | Ga0105241_11845853 | Ga0105241_118458531 | 150 |
| 61 | 3300009545 | Ga0105237_10062162 | Ga0105237_100621625 | 150 |
| 62 | 3300009551 | Ga0105238_10164361 | Ga0105238_101643612 | 150 |
| 63 | 3300013100 | Ga0157373_10011418 | Ga0157373_100114183 | 150 |
| 64 | 3300013104 | Ga0157370_10058261 | Ga0157370_100582616 | 150 |
| 65 | 3300013104 | Ga0157370_10341332 | Ga0157370_103413322 | 150 |
| 66 | 3300013104 | Ga0157370_10499152 | Ga0157370_104991522 | 150 |
| 67 | 3300013105 | Ga0157369_10006123 | Ga0157369_1000612315 | 150 |
| 68 | 3300013105 | Ga0157369_11544219 | Ga0157369_115442192 | 150 |
| 69 | 3300013307 | Ga0157372_10071007 | Ga0157372_100710074 | 150 |
| 70 | 3300015261 | Ga0182006_1200034 | Ga0182006_12000341 | 150 |
| 71 | 3300015262 | Ga0182007_10025727 | Ga0182007_100257273 | 150 |
| 72 | 3300020069 | Ga0197907_11221306 | Ga0197907_112213062 | 150 |
| 73 | 3300020069 | Ga0197907_11432064 | Ga0197907_114320641 | 150 |
| 74 | 3300020070 | Ga0206356_10597032 | Ga0206356_105970322 | 150 |
| 75 | 3300020081 | Ga0206354_11720673 | Ga0206354_117206732 | 150 |
| 76 | 3300020082 | Ga0206353_10029576 | Ga0206353_100295764 | 150 |
| 77 | 3300020082 | Ga0206353_10042058 | Ga0206353_100420584 | 150 |
| 78 | 3300020082 | Ga0206353_10127022 | Ga0206353_101270223 | 150 |
| 79 | 3300020082 | Ga0206353_11059685 | Ga0206353_110596852 | 150 |
| 80 | 3300020082 | Ga0206353_11905109 | Ga0206353_119051092 | 150 |
| 81 | 3300025898 | Ga0207692_10267110 | Ga0207692_102671102 | 150 |
| 82 | 3300025912 | Ga0207707_10189819 | Ga0207707_101898192 | 150 |
| 83 | 3300025912 | Ga0207707_10694928 | Ga0207707_106949282 | 150 |
| 84 | 3300025912 | Ga0207707_11235255 | Ga0207707_112352551 | 150 |
| 85 | 3300025913 | Ga0207695_10246095 | Ga0207695_102460952 | 150 |
| 86 | 3300025913 | Ga0207695_10383664 | Ga0207695_103836643 | 150 |
| 87 | 3300025913 | Ga0207695_10743848 | Ga0207695_107438481 | 150 |
| 88 | 3300025914 | Ga0207671_10176495 | Ga0207671_101764953 | 150 |
| 89 | 3300025915 | Ga0207693_10074493 | Ga0207693_100744934 | 150 |
| 90 | 3300025917 | Ga0207660_10188764 | Ga0207660_101887643 | 150 |
| 91 | 3300025919 | Ga0207657_10002431 | Ga0207657_1000243121 | 150 |
| 92 | 3300025919 | Ga0207657_10297620 | Ga0207657_102976202 | 150 |
| 93 | 3300025920 | Ga0207649_10144732 | Ga0207649_101447322 | 150 |
| 94 | 3300025920 | Ga0207649_10276291 | Ga0207649_102762911 | 150 |
| 95 | 3300025920 | Ga0207649_10747246 | Ga0207649_107472462 | 150 |
| 96 | 3300025921 | Ga0207652_10528300 | Ga0207652_105283002 | 150 |
| 97 | 3300025924 | Ga0207694_10135887 | Ga0207694_101358873 | 150 |
| 98 | 3300025928 | Ga0207700_10589368 | Ga0207700_105893682 | 150 |
| 99 | 3300025929 | Ga0207664_10803335 | Ga0207664_108033352 | 150 |
| 100 | 3300025929 | Ga0207664_10976659 | Ga0207664_109766592 | 150 |
| 101 | 3300025931 | Ga0207644_10222021 | Ga0207644_102220213 | 150 |
| 102 | 3300025944 | Ga0207661_10082448 | Ga0207661_100824483 | 150 |
| 103 | 3300025945 | Ga0207679_11244875 | Ga0207679_112448751 | 150 |
| 104 | 3300025949 | Ga0207667_11403877 | Ga0207667_114038772 | 150 |
| 105 | 3300025981 | Ga0207640_11059987 | Ga0207640_110599872 | 150 |
| 106 | 3300026041 | Ga0207639_10865927 | Ga0207639_108659272 | 150 |
| 107 | 3300026078 | Ga0207702_10152626 | Ga0207702_101526263 | 150 |
| 108 | 3300026078 | Ga0207702_11095383 | Ga0207702_110953832 | 150 |
| 109 | 3300026121 | Ga0207683_10020907 | Ga0207683_100209073 | 150 |
| 110 | 3300026142 | Ga0207698_10123184 | Ga0207698_101231842 | 150 |
| 111 | 3300026142 | Ga0207698_10833964 | Ga0207698_108339642 | 150 |
| 112 | 3300026142 | Ga0207698_11436908 | Ga0207698_114369082 | 150 |
| 113 | 3300028558 | Ga0265326_10064906 | Ga0265326_100649061 | 150 |
| 114 | 3300028573 | Ga0265334_10057543 | Ga0265334_100575432 | 150 |
| 115 | 3300028577 | Ga0265318_10277958 | Ga0265318_102779582 | 150 |
| 116 | 3300028654 | Ga0265322_10021957 | Ga0265322_100219573 | 150 |
| 117 | 3300028666 | Ga0265336_10077398 | Ga0265336_100773981 | 150 |
| 118 | 3300028800 | Ga0265338_10007452 | Ga0265338_1000745219 | 150 |
| 119 | 3300028800 | Ga0265338_10029168 | Ga0265338_100291687 | 150 |
| 120 | 3300028800 | Ga0265338_10067787 | Ga0265338_100677872 | 150 |
| 121 | 3300029957 | Ga0265324_10039589 | Ga0265324_100395892 | 150 |
| 122 | 3300031241 | Ga0265325_10013463 | Ga0265325_100134632 | 150 |
| 123 | 3300031247 | Ga0265340_10276608 | Ga0265340_102766082 | 150 |
| 124 | 3300031249 | Ga0265339_10026715 | Ga0265339_100267154 | 150 |
| 125 | 3300031250 | Ga0265331_10050210 | Ga0265331_100502102 | 150 |
| 126 | 3300031251 | Ga0265327_10007278 | Ga0265327_1000727810 | 150 |
| 127 | 3300031344 | Ga0265316_10049928 | Ga0265316_100499283 | 150 |
| 128 | 3300031595 | Ga0265313_10018970 | Ga0265313_100189703 | 150 |
| 129 | 3300031595 | Ga0265313_10038323 | Ga0265313_100383234 | 150 |
| 130 | 3300031595 | Ga0265313_10329275 | Ga0265313_103292751 | 150 |
| 131 | 3300031712 | Ga0265342_10032996 | Ga0265342_100329965 | 150 |
| 132 | 3300031712 | Ga0265342_10156943 | Ga0265342_101569432 | 150 |
| 133 | 3300035089 | Ga0373944_0025703 | Ga0373944_0025703_1098_1550 | 150 |
| 134 | 3300035113 | Ga0373936_0044277 | Ga0373936_0044277_798_1250 | 150 |
| 135 | 3300035116 | Ga0373945_0069466 | Ga0373945_0069466_123_575 | 150 |
| 136 | 3300035118 | Ga0373954_0054359 | Ga0373954_0054359_33_485 | 150 |
| 137 | 3300035170 | Ga0373943_0006557 | Ga0373943_0006557_2884_3336 | 150 |
| 138 | 3300035170 | Ga0373943_0425647 | Ga0373943_0425647_167_619 | 150 |
| 139 | 3300035172 | Ga0373955_0177815 | Ga0373955_0177815_222_674 | 150 |
| 140 | 3300035410 | Ga0373924_0169555 | Ga0373924_0169555_420_872 | 150 |
| 141 | 3300035692 | Ga0373935_0043565 | Ga0373935_0043565_1968_2420 | 150 |
| 142 | 3300035725 | Ga0373947_0003721 | Ga0373947_0003721_993_1445 | 150 |
| 143 | 3300035725 | Ga0373947_0515948 | Ga0373947_0515948_207_659 | 150 |
| 144 | 3300036401 | Ga0373937_0340204 | Ga0373937_0340204_937_1389 | 150 |
| 145 | 3300037068 | Ga0373925_0099129 | Ga0373925_0099129_889_1341 | 150 |
| 146 | 3300037418 | Ga0395900_0115320 | Ga0395900_0115320_1096_1548 | 150 |
| 147 | 3300037418 | Ga0395900_0183082 | Ga0395900_0183082_975_1427 | 150 |
| 148 | 3300037418 | Ga0395900_0261641 | Ga0395900_0261641_890_1345 | 150 |
| 149 | 3300037418 | Ga0395900_1067564 | Ga0395900_1067564_109_561 | 150 |
| 150 | 3300037466 | Ga0395898_0001313 | Ga0395898_0001313_5624_6076 | 150 |
| 151 | 3300037466 | Ga0395898_0139924 | Ga0395898_0139924_71_544 | 150 |
| 152 | 3300037466 | Ga0395898_0164851 | Ga0395898_0164851_1561_2016 | 150 |
| 153 | 3300037466 | Ga0395898_0261712 | Ga0395898_0261712_1143_1595 | 150 |
| 154 | 3300037471 | Ga0395905_0112750 | Ga0395905_0112750_668_1123 | 150 |
| 155 | 3300037471 | Ga0395905_0323631 | Ga0395905_0323631_226_684 | 150 |
| 156 | 3300037853 | Ga0436364_0477538 | Ga0436364_0477538_38_493 | 150 |
| 157 | 3300038443 | Ga0395901_0002853 | Ga0395901_0002853_15329_15781 | 150 |
| 158 | 3300038443 | Ga0395901_0003265 | Ga0395901_0003265_574_1029 | 150 |
| 159 | 3300039450 | Ga0436363_1330396 | Ga0436363_1330396_87_542 | 150 |
| 160 | 3300041463 | Ga0451804_1125088 | Ga0451804_1125088_12_467 | 150 |
| 161 | 3300042005 | Ga0439448_0272591 | Ga0439448_0272591_123_575 | 150 |
| 162 | 3300044658 | Ga0466972_0033723 | Ga0466972_0033723_1902_2363 | 150 |
| 163 | 3300044683 | Ga0466965_0290975 | Ga0466965_0290975_319_771 | 150 |
| 164 | 3300044684 | Ga0466966_0066575 | Ga0466966_0066575_1708_2160 | 150 |
| 165 | 3300044684 | Ga0466966_0154459 | Ga0466966_0154459_98_550 | 150 |
| 166 | 3300044684 | Ga0466966_0353639 | Ga0466966_0353639_230_682 | 150 |
| 167 | 3300044693 | Ga0466961_0068663 | Ga0466961_0068663_1193_1645 | 150 |
| 168 | 3300044693 | Ga0466961_0176794 | Ga0466961_0176794_113_574 | 150 |
| 169 | 3300044694 | Ga0466963_0003463 | Ga0466963_0003463_1329_1781 | 150 |
| 170 | 3300044694 | Ga0466963_0014657 | Ga0466963_0014657_2075_2527 | 150 |
| 171 | 3300044694 | Ga0466963_0033727 | Ga0466963_0033727_1949_2404 | 150 |
| 172 | 3300044694 | Ga0466963_0081835 | Ga0466963_0081835_1233_1697 | 150 |
| 173 | 3300044706 | Ga0466964_0062823 | Ga0466964_0062823_339_791 | 150 |
| 174 | 3300044719 | Ga0466971_0000387 | Ga0466971_0000387_12011_12463 | 150 |
| 175 | 3300044765 | Ga0466970_0081724 | Ga0466970_0081724_329_781 | 150 |
| 176 | 3300044842 | Ga0466957_0005219 | Ga0466957_0005219_2099_2551 | 150 |
| 177 | 3300044901 | Ga0466960_0105935 | Ga0466960_0105935_336_791 | 150 |
| 178 | 3300044901 | Ga0466960_0388959 | Ga0466960_0388959_292_747 | 150 |
| 179 | 3300045049 | Ga0466959_0068283 | Ga0466959_0068283_138_590 | 150 |
| 180 | 3300045049 | Ga0466959_0072115 | Ga0466959_0072115_1432_1884 | 150 |
| 181 | 3300045049 | Ga0466959_0125138 | Ga0466959_0125138_344_805 | 150 |
| 182 | 3300045836 | Ga0466958_0000662 | Ga0466958_0000662_5350_5802 | 150 |
| 183 | 3300045836 | Ga0466958_0546934 | Ga0466958_0546934_76_528 | 150 |
| 184 | 3300045976 | Ga0466967_0000496 | Ga0466967_0000496_12744_13196 | 150 |
| 185 | 3300045976 | Ga0466967_0005093 | Ga0466967_0005093_3001_3453 | 150 |
| 186 | 3300045976 | Ga0466967_0040876 | Ga0466967_0040876_3371_3835 | 150 |
| 187 | 3300045976 | Ga0466967_0077400 | Ga0466967_0077400_930_1382 | 150 |
| 188 | 3300045976 | Ga0466967_0106020 | Ga0466967_0106020_2070_2525 | 150 |
| 189 | 3300045976 | Ga0466967_0110388 | Ga0466967_0110388_1439_1891 | 150 |
| 190 | 3300045976 | Ga0466967_0916609 | Ga0466967_0916609_261_713 | 150 |
| 191 | 3300045976 | Ga0466967_1073835 | Ga0466967_1073835_205_657 | 150 |
| 192 | 3300045976 | Ga0466967_1323415 | Ga0466967_1323415_211_663 | 150 |
| 193 | 3300046454 | Ga0495592_0130178 | Ga0495592_0130178_557_1009 | 150 |
| 194 | 3300046459 | Ga0495629_0088731 | Ga0495629_0088731_263_715 | 150 |
| 195 | 3300046461 | Ga0495641_0043325 | Ga0495641_0043325_742_1194 | 150 |
| 196 | 3300046461 | Ga0495641_0268759 | Ga0495641_0268759_223_675 | 150 |
| 197 | 3300046462 | Ga0495651_0039549 | Ga0495651_0039549_1609_2061 | 150 |
| 198 | 3300046462 | Ga0495651_0066945 | Ga0495651_0066945_2257_2709 | 150 |
| 199 | 3300046463 | Ga0495653_0037559 | Ga0495653_0037559_190_642 | 150 |
| 200 | 3300046473 | Ga0495582_0033654 | Ga0495582_0033654_1006_1458 | 150 |
| 201 | 3300046476 | Ga0495662_0055336 | Ga0495662_0055336_1235_1687 | 150 |
| 202 | 3300046511 | Ga0495608_0006490 | Ga0495608_0006490_611_1063 | 150 |
| 203 | 3300046511 | Ga0495608_0332217 | Ga0495608_0332217_154_606 | 150 |
| 204 | 3300046514 | Ga0495618_0064255 | Ga0495618_0064255_1656_2108 | 150 |
| 205 | 3300046516 | Ga0495628_0014804 | Ga0495628_0014804_5567_6019 | 150 |
| 206 | 3300046516 | Ga0495628_0030454 | Ga0495628_0030454_545_997 | 150 |
| 207 | 3300046517 | Ga0495630_0016696 | Ga0495630_0016696_2055_2507 | 150 |
| 208 | 3300046517 | Ga0495630_0052435 | Ga0495630_0052435_1128_1580 | 150 |
| 209 | 3300046517 | Ga0495630_0158447 | Ga0495630_0158447_325_777 | 150 |
| 210 | 3300046529 | Ga0495652_0071636 | Ga0495652_0071636_259_711 | 150 |
| 211 | 3300046533 | Ga0495640_0027639 | Ga0495640_0027639_2895_3347 | 150 |
| 212 | 3300046533 | Ga0495640_0055805 | Ga0495640_0055805_125_577 | 150 |
| 213 | 3300046536 | Ga0495587_0013168 | Ga0495587_0013168_838_1290 | 150 |
| 214 | 3300046536 | Ga0495587_0310355 | Ga0495587_0310355_345_797 | 150 |
| 215 | 3300046543 | Ga0495645_0251280 | Ga0495645_0251280_569_1021 | 150 |
| 216 | 3300046559 | Ga0495667_0018250 | Ga0495667_0018250_1020_1472 | 150 |
| 217 | 3300046642 | Ga0495634_0089774 | Ga0495634_0089774_154_606 | 150 |
| 218 | 3300046663 | Ga0495635_0110710 | Ga0495635_0110710_1020_1472 | 150 |
| 219 | 3300046675 | Ga0495657_0003812 | Ga0495657_0003812_5330_5782 | 150 |
| 220 | 3300046675 | Ga0495657_0051910 | Ga0495657_0051910_317_769 | 150 |
| 221 | 3300046678 | Ga0495599_0241117 | Ga0495599_0241117_388_840 | 150 |
| 222 | 3300046679 | Ga0495623_0100429 | Ga0495623_0100429_933_1385 | 150 |
| 223 | 3300046680 | Ga0495646_0051375 | Ga0495646_0051375_2000_2452 | 150 |
| 224 | 3300046683 | Ga0495658_0295374 | Ga0495658_0295374_168_620 | 150 |
| 225 | 3300046689 | Ga0495613_0004233 | Ga0495613_0004233_371_823 | 150 |
| 226 | 3300046809 | Ga0495600_0004479 | Ga0495600_0004479_3990_4442 | 150 |
| 227 | 3300047317 | Ga0495604_0027950 | Ga0495604_0027950_2950_3402 | 150 |
| 228 | 3300047319 | Ga0495674_0004654 | Ga0495674_0004654_3177_3629 | 150 |
| 229 | 3300047322 | Ga0495680_0000965 | Ga0495680_0000965_28105_28557 | 150 |
| 230 | 3300047322 | Ga0495680_0002509 | Ga0495680_0002509_10843_11295 | 150 |
| 231 | 3300047471 | Ga0495684_0017271 | Ga0495684_0017271_1917_2369 | 150 |
| 232 | 3300047471 | Ga0495684_0039666 | Ga0495684_0039666_72_524 | 150 |
| 233 | 3300047673 | Ga0495593_0098374 | Ga0495593_0098374_552_1004 | 150 |
| 234 | 3300048088 | Ga0495602_0045068 | Ga0495602_0045068_1946_2398 | 150 |
| 235 | 3300048088 | Ga0495602_0062936 | Ga0495602_0062936_1971_2423 | 150 |
| 236 | 3300048088 | Ga0495602_0158054 | Ga0495602_0158054_440_892 | 150 |
| 237 | 3300048088 | Ga0495602_0698553 | Ga0495602_0698553_220_672 | 150 |
| 238 | 3300048903 | Ga0496100_0046494 | Ga0496100_0046494_2131_2583 | 150 |
| 239 | 3300048904 | Ga0496101_0073519 | Ga0496101_0073519_680_1132 | 150 |
| 240 | 3300048905 | Ga0496102_0092592 | Ga0496102_0092592_1484_1936 | 150 |
| 241 | 3300048906 | Ga0496103_0152591 | Ga0496103_0152591_228_680 | 150 |
| 242 | 3300048908 | Ga0496105_1363033 | Ga0496105_1363033_51_503 | 150 |
| 243 | 3300048909 | Ga0496106_0027569 | Ga0496106_0027569_3579_4031 | 150 |
| 244 | 3300048909 | Ga0496106_0053060 | Ga0496106_0053060_858_1310 | 150 |
| 245 | 3300048910 | Ga0496107_0063123 | Ga0496107_0063123_1525_1977 | 150 |
| 246 | 3300048910 | Ga0496107_0132220 | Ga0496107_0132220_12_464 | 150 |
| 247 | 3300048917 | Ga0496114_0117918 | Ga0496114_0117918_891_1343 | 150 |
| 248 | 3300048917 | Ga0496114_0145041 | Ga0496114_0145041_233_685 | 150 |
| 249 | 3300048918 | Ga0496115_0314521 | Ga0496115_0314521_297_749 | 150 |
| 250 | 3300049585 | Ga0501069_0043501 | Ga0501069_0043501_282_746 | 150 |
| 251 | 3300049585 | Ga0501069_0062685 | Ga0501069_0062685_1227_1679 | 150 |
| 252 | 3300049586 | Ga0501070_0000677 | Ga0501070_0000677_26126_26590 | 150 |
| 253 | 3300049586 | Ga0501070_0120393 | Ga0501070_0120393_308_760 | 150 |
| 254 | 3300049586 | Ga0501070_0632126 | Ga0501070_0632126_159_611 | 150 |
| 255 | 3300049590 | Ga0501074_0386353 | Ga0501074_0386353_484_948 | 150 |
| 256 | 3300049742 | Ga0501080_0116678 | Ga0501080_0116678_677_1129 | 150 |
| 257 | 3300049742 | Ga0501080_1857139 | Ga0501080_1857139_34_486 | 150 |
| 258 | 3300049822 | Ga0501035_0228576 | Ga0501035_0228576_745_1209 | 150 |
| 259 | 3300049823 | Ga0501044_0551438 | Ga0501044_0551438_335_787 | 150 |
| 260 | 3300050512 | nmdc:mga0n895_82843_c1 | nmdc:mga0n895_82843_c1_253_705 | 150 |
| 261 | 3300050513 | nmdc:mga0rr50_21340_c1 | nmdc:mga0rr50_21340_c1_1667_2119 | 150 |
| 262 | 3300053077 | Ga0495601_0243134 | Ga0495601_0243134_231_683 | 150 |
| 263 | 3300053084 | Ga0495595_0006495 | Ga0495595_0006495_2904_3356 | 150 |
| 264 | 3300053085 | Ga0495619_0009728 | Ga0495619_0009728_3156_3608 | 150 |
| 265 | 3300061719 | Ga0466962_0005515 | Ga0466962_0005515_4712_5164 | 150 |
| 266 | 3300061719 | Ga0466962_0325237 | Ga0466962_0325237_297_749 | 150 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2dxa-assembly1.cif.gz_A | crystal structure of trans editing enzyme prox from e.coli | 0.9244 | 1 | 150 |
| 2dxa-assembly1.cif.gz_A | crystal structure of trans editing enzyme prox from e.coli | 0.9184 | 1 | 150 |
| 1dbx-assembly2.cif.gz_B | crystal structure of cysteinyl-trna(pro) deacylase from h. influenzae (hi1434) | 0.9003 | 2 | 150 |
| 1dbx-assembly2.cif.gz_B | crystal structure of cysteinyl-trna(pro) deacylase from h. influenzae (hi1434) | 0.8886 | 2 | 150 |
| 1dbu-assembly1.cif.gz_A | crystal structure of cysteinyl-trna(pro) deacylase protein from h. influenzae (hi1434) | 0.8881 | 2 | 150 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G0A0_1_158_3.90.960.10 | Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain | 0.9227 | 2 | 148 | 3.90.960.10 |
| af_Q2G0A0_1_158_3.90.960.10 | Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain | 0.8991 | 2 | 148 | 3.90.960.10 |
| 1wdvB00 | Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain | 0.88 | 3 | 150 | 3.90.960.10 |
| 1dbxB00 | Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain | 0.877 | 2 | 150 | 3.90.960.10 |
| af_Q4DLP0_103_258_3.90.960.10 | Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain | 0.8706 | 31 | 148 | 3.90.960.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A840IFR0-F1-model_v4 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase (EC 4.2.-.-) | 0.9735 | 1 | 150 |
GO:0002161
GO:0006412 GO:0016829 |
| AF-A0PRC1-F1-model_v4 | Conserved hypothetical membrane protein | 0.9703 | 46 | 150 |
GO:0002161
GO:0006412 |
| AF-A0A159ZAH5-F1-model_v4 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase (EC 4.2.-.-) | 0.9684 | 1 | 150 |
GO:0002161
GO:0006412 GO:0016829 |
| AF-A0A6L7GBN3-F1-model_v4 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase (EC 4.2.-.-) | 0.9683 | 1 | 150 |
GO:0002161
GO:0006412 GO:0016829 |
| AF-A0A6G2UW32-F1-model_v4 | Cys-tRNA(Pro) deacylase | 0.9672 | 43 | 150 |
GO:0002161
GO:0006412 GO:0016829 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar