F374224

General Info

Members Datasets Scaffolds Average Seq Length
266 134 266 236

Family's Representative Sequence

Representative Sequence 3300038443|Ga0395901_0605746|Ga0395901_0605746_291_1085
Length 264
Sequence MKRCSTCNRTFTDPNLRFCIDDGTPLTDVEPDDDATVVTPRNQDDSWNAVAYQPPRPYVPPAGQAKRRRLWPWLVGIGGAFLLGILVIAIAGVLMVPRITRRVEQAQSNADRRIENSNTAPDTNSNTNSTEHVDAPVPTDHEQVLTQLKDIENEWTVANLNADKKKLDRILADDFVAKDDEGELKSKADYIREIERDTQVDKWEFSNLKLVLTGDRATLTGTITYFIGDQKPTFEFTDKFVWRDGRWQATGAEIKGAGSSGVDV

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
108 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
109 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
112 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
113 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
114 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
115 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
116 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
117 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
118 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
119 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
120 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
121 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
122 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
123 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
124 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
125 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
126 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
127 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
128 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
129 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
130 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
131 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
132 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
133 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
134 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.38
Rhizosphere 99.62
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_915132 2162886011 Unclassified 1809
2 MBSR1b_contig_2244195 2162886012 Bacteria 1112
3 CNAas_1000006 3300000532 Bacteria 12249
4 JGI24751J29686_10000050 3300002459 Bacteria 68540
5 Ga0065714_10002297 3300005288 Bacteria 27065
6 Ga0065712_10067792 3300005290 Bacteria 34297
7 Ga0065712_10097667 3300005290 Unclassified 2136
8 Ga0065715_10027763 3300005293 Bacteria 2133
9 Ga0065715_10089248 3300005293 Bacteria 11909
10 Ga0065715_10127644 3300005293 Unclassified 2082
11 Ga0065707_10005149 3300005295 Bacteria 3363
12 Ga0070690_100062376 3300005330 Bacteria 2404
13 Ga0070690_100516558 3300005330 Unclassified 896
14 Ga0070670_100000439 3300005331 Bacteria 33957
15 Ga0070670_100082108 3300005331 Bacteria 2770
16 Ga0070670_100190615 3300005331 Bacteria 1781
17 Ga0070670_100375001 3300005331 Bacteria 1253
18 Ga0070670_100420535 3300005331 Unclassified 1181
19 Ga0068869_100058321 3300005334 Bacteria 2822
20 Ga0068869_100483221 3300005334 Unclassified 1032
21 Ga0070682_100003960 3300005337 Bacteria 8223
22 Ga0070682_100024319 3300005337 Bacteria 3603
23 Ga0068868_100396413 3300005338 Bacteria 1190
24 Ga0070689_100001531 3300005340 Bacteria 14740
25 Ga0070687_100038772 3300005343 Unclassified 2390
26 Ga0070692_10113831 3300005345 Bacteria 1500
27 Ga0070692_10125498 3300005345 Bacteria 1437
28 Ga0070692_10335707 3300005345 Unclassified 934
29 Ga0070669_100311005 3300005353 Bacteria 1270
30 Ga0070675_100061798 3300005354 Bacteria 3094
31 Ga0070701_10057692 3300005438 Bacteria 2036
32 Ga0070701_10075843 3300005438 Unclassified 1808
33 Ga0070705_100005185 3300005440 Bacteria 6329
34 Ga0070705_100007301 3300005440 Bacteria 5437
35 Ga0070705_100211844 3300005440 Unclassified 1336
36 Ga0070705_100322152 3300005440 Bacteria 1116
37 Ga0070700_100000270 3300005441 Bacteria 27649
38 Ga0070700_100010778 3300005441 Bacteria 5052
39 Ga0070700_100197601 3300005441 Unclassified 1410
40 Ga0070700_100529331 3300005441 Unclassified 912
41 Ga0070694_100029742 3300005444 Bacteria 3567
42 Ga0070694_100031702 3300005444 Bacteria 3466
43 Ga0070694_100056003 3300005444 Bacteria 2676
44 Ga0070694_100188637 3300005444 Unclassified 1530
45 Ga0070708_100198560 3300005445 Bacteria 1877
46 Ga0070681_10007166 3300005458 Bacteria 10860
47 Ga0070681_10196512 3300005458 Bacteria 1936
48 Ga0068867_100111224 3300005459 Bacteria 2104
49 Ga0070706_100000300 3300005467 Bacteria 60347
50 Ga0070707_100113414 3300005468 Bacteria 2630
51 Ga0070698_100049057 3300005471 Bacteria 4312
52 Ga0070699_100002048 3300005518 Bacteria 18222
53 Ga0070699_100012442 3300005518 Bacteria 7341
54 Ga0070699_100232458 3300005518 Bacteria 1644
55 Ga0070679_100255487 3300005530 Bacteria 1708
56 Ga0070679_100528054 3300005530 Bacteria 1124
57 Ga0070697_100261771 3300005536 Unclassified 1481
58 Ga0068853_100138935 3300005539 Unclassified 2180
59 Ga0068853_100210077 3300005539 Bacteria 1774
60 Ga0070695_100038633 3300005545 Bacteria 3013
61 Ga0070695_100111798 3300005545 Bacteria 1855
62 Ga0070696_100012960 3300005546 Bacteria 5596
63 Ga0070696_100096597 3300005546 Bacteria 2112
64 Ga0070696_100282604 3300005546 Bacteria 1265
65 Ga0070693_100063424 3300005547 Bacteria 2154
66 Ga0070704_100270026 3300005549 Bacteria 1405
67 Ga0070664_100670126 3300005564 Bacteria 965
68 Ga0068857_100155449 3300005577 Bacteria 2074
69 Ga0068857_100295092 3300005577 Bacteria 1493
70 Ga0070702_100006879 3300005615 Bacteria 5414
71 Ga0070702_100013427 3300005615 Bacteria 4134
72 Ga0070702_100042881 3300005615 Bacteria 2546
73 Ga0068859_100017580 3300005617 Bacteria 7189
74 Ga0068859_100052538 3300005617 Bacteria 4097
75 Ga0068859_100107264 3300005617 Bacteria 2853
76 Ga0068859_100107324 3300005617 Bacteria 2852
77 Ga0068859_100150718 3300005617 Bacteria 2401
78 Ga0068859_100190445 3300005617 Bacteria 2135
79 Ga0068859_100406713 3300005617 Bacteria 1457
80 Ga0068864_100038030 3300005618 Bacteria 4108
81 Ga0068864_100065649 3300005618 Bacteria 3148
82 Ga0068864_100443137 3300005618 Bacteria 1241
83 Ga0068864_100584700 3300005618 Unclassified 1082
84 Ga0068864_100604482 3300005618 Bacteria 1064
85 Ga0068870_10018695 3300005840 Bacteria 3350
86 Ga0068870_10087985 3300005840 Bacteria 1730
87 Ga0068870_10147482 3300005840 Bacteria 1382
88 Ga0068863_100140776 3300005841 Bacteria 2306
89 Ga0068863_100306942 3300005841 Unclassified 1540
90 Ga0068863_100848093 3300005841 Unclassified 913
91 Ga0068858_100064880 3300005842 Bacteria 3379
92 Ga0068858_100131346 3300005842 Bacteria 2348
93 Ga0068858_100340037 3300005842 Bacteria 1436
94 Ga0068860_100009989 3300005843 Bacteria 9407
95 Ga0068860_100246476 3300005843 Bacteria 1739
96 Ga0068860_100352022 3300005843 Bacteria 1449
97 Ga0068862_100043254 3300005844 Bacteria 3839
98 Ga0081539_10077919 3300005985 Unclassified 1751
99 Ga0097621_100025394 3300006237 Bacteria 4636
100 Ga0068871_100001915 3300006358 Bacteria 14079
101 Ga0068871_100270253 3300006358 Bacteria 1485
102 Ga0075428_100111347 3300006844 Bacteria 2982
103 Ga0075431_100112719 3300006847 Bacteria 2807
104 Ga0075433_10023152 3300006852 Bacteria 5224
105 Ga0075433_10062186 3300006852 Bacteria 3270
106 Ga0075433_10085123 3300006852 Unclassified 2791
107 Ga0075434_100128251 3300006871 Bacteria 2554
108 Ga0075434_100437484 3300006871 Unclassified 1329
109 Ga0068865_100168969 3300006881 Unclassified 1675
110 Ga0097620_100017580 3300006931 Bacteria 7189
111 Ga0097620_100052541 3300006931 Bacteria 4097
112 Ga0097620_100107265 3300006931 Bacteria 2853
113 Ga0097620_100107327 3300006931 Bacteria 2852
114 Ga0097620_100150723 3300006931 Bacteria 2401
115 Ga0097620_100190440 3300006931 Bacteria 2135
116 Ga0097620_100406725 3300006931 Bacteria 1457
117 Ga0075435_100096591 3300007076 Bacteria 2444
118 Ga0105251_10119141 3300009011 Bacteria 1199
119 Ga0105251_10142998 3300009011 Bacteria 1082
120 Ga0105240_10036112 3300009093 Bacteria 6361
121 Ga0105240_10131877 3300009093 Unclassified 2997
122 Ga0111539_10003012 3300009094 Bacteria 22343
123 Ga0111539_10037428 3300009094 Bacteria 5859
124 Ga0111539_10388626 3300009094 Bacteria 1625
125 Ga0105247_10000816 3300009101 Bacteria 23727
126 Ga0105247_10102927 3300009101 Bacteria 1828
127 Ga0105247_10499336 3300009101 Bacteria 886
128 Ga0114129_10210118 3300009147 Bacteria 2631
129 Ga0105243_10005062 3300009148 Bacteria 10343
130 Ga0105243_10058341 3300009148 Bacteria 3076
131 Ga0105243_10232201 3300009148 Unclassified 1637
132 Ga0105243_10641287 3300009148 Bacteria 1028
133 Ga0105241_10086651 3300009174 Bacteria 2463
134 Ga0105241_10177592 3300009174 Bacteria 1764
135 Ga0105241_10208262 3300009174 Unclassified 1637
136 Ga0105241_10342599 3300009174 Bacteria 1295
137 Ga0105241_10594688 3300009174 Bacteria 999
138 Ga0105242_10198412 3300009176 Bacteria 1781
139 Ga0105242_10530915 3300009176 Bacteria 1124
140 Ga0105248_10004560 3300009177 Bacteria 15339
141 Ga0105248_10053625 3300009177 Bacteria 4524
142 Ga0105248_10065615 3300009177 Bacteria 4076
143 Ga0105248_10066082 3300009177 Bacteria 4061
144 Ga0105248_10166506 3300009177 Bacteria 2485
145 Ga0105237_10007314 3300009545 Bacteria 12104
146 Ga0105237_10139042 3300009545 Bacteria 2423
147 Ga0105237_10275644 3300009545 Bacteria 1685
148 Ga0105238_10019792 3300009551 Bacteria 6851
149 Ga0105238_10082569 3300009551 Unclassified 3203
150 Ga0105238_10621799 3300009551 Bacteria 1089
151 Ga0105249_10037230 3300009553 Bacteria 4415
152 Ga0105249_10859043 3300009553 Unclassified 973
153 Ga0105239_10094872 3300010375 Bacteria 3296
154 Ga0105239_10596034 3300010375 Bacteria 1260
155 Ga0105239_10630735 3300010375 Bacteria 1223
156 Ga0105246_10045300 3300011119 Bacteria 2995
157 Ga0105246_10062487 3300011119 Bacteria 2595
158 Ga0157373_10001056 3300013100 Bacteria 21207
159 Ga0157373_10083357 3300013100 Bacteria 2253
160 Ga0163162_10034361 3300013306 Bacteria 5046
161 Ga0163162_10088860 3300013306 Bacteria 3169
162 Ga0157372_10021868 3300013307 Bacteria 6913
163 Ga0157372_10979456 3300013307 Unclassified 980
164 Ga0157375_10141821 3300013308 Bacteria 2530
165 Ga0157375_10276831 3300013308 Unclassified 1841
166 Ga0163163_10000993 3300014325 Bacteria 23985
167 Ga0163163_10114380 3300014325 Bacteria 2729
168 Ga0157380_10775883 3300014326 Bacteria 973
169 Ga0157377_10171425 3300014745 Bacteria 1358
170 Ga0157379_10028983 3300014968 Bacteria 4922
171 Ga0207653_10001165 3300025885 Bacteria 8590
172 Ga0207710_10000753 3300025900 Bacteria 17806
173 Ga0207647_10005868 3300025904 Bacteria 8952
174 Ga0207643_10003726 3300025908 Bacteria 8190
175 Ga0207643_10011379 3300025908 Bacteria 4804
176 Ga0207684_10000367 3300025910 Bacteria 60978
177 Ga0207654_10283031 3300025911 Bacteria 1122
178 Ga0207707_10183017 3300025912 Bacteria 1829
179 Ga0207671_10004111 3300025914 Bacteria 14071
180 Ga0207671_10476447 3300025914 Bacteria 995
181 Ga0207646_10127960 3300025922 Bacteria 2284
182 Ga0207681_10003720 3300025923 Bacteria 9484
183 Ga0207681_10385141 3300025923 Bacteria 1129
184 Ga0207694_10007178 3300025924 Bacteria 8458
185 Ga0207650_10000022 3300025925 Bacteria 318878
186 Ga0207650_10234598 3300025925 Bacteria 1481
187 Ga0207650_10609734 3300025925 Unclassified 918
188 Ga0207659_10043409 3300025926 Bacteria 3158
189 Ga0207686_10143282 3300025934 Bacteria 1655
190 Ga0207686_10191814 3300025934 Bacteria 1457
191 Ga0207709_10001958 3300025935 Bacteria 13463
192 Ga0207709_10083203 3300025935 Unclassified 2069
193 Ga0207670_10001259 3300025936 Bacteria 13381
194 Ga0207670_10526167 3300025936 Bacteria 963
195 Ga0207711_10002927 3300025941 Bacteria 14963
196 Ga0207711_10037446 3300025941 Bacteria 4120
197 Ga0207711_10202005 3300025941 Bacteria 1814
198 Ga0207689_10042379 3300025942 Bacteria 3766
199 Ga0207689_10142702 3300025942 Unclassified 1973
200 Ga0207689_10154510 3300025942 Bacteria 1891
201 Ga0207689_10172800 3300025942 Unclassified 1781
202 Ga0207689_10254311 3300025942 Bacteria 1453
203 Ga0207689_10458788 3300025942 Bacteria 1065
204 Ga0207679_10119240 3300025945 Bacteria 2097
205 Ga0207703_10028204 3300026035 Bacteria 4423
206 Ga0207703_10098805 3300026035 Bacteria 2469
207 Ga0207703_10115491 3300026035 Bacteria 2297
208 Ga0207703_10230622 3300026035 Bacteria 1660
209 Ga0207708_10000087 3300026075 Bacteria 73043
210 Ga0207708_10020250 3300026075 Bacteria 5017
211 Ga0207708_10021633 3300026075 Bacteria 4851
212 Ga0207641_10137282 3300026088 Bacteria 2202
213 Ga0207641_10149617 3300026088 Bacteria 2113
214 Ga0207641_10236525 3300026088 Bacteria 1700
215 Ga0207648_10252005 3300026089 Bacteria 1574
216 Ga0207648_10275836 3300026089 Bacteria 1503
217 Ga0207676_10200073 3300026095 Bacteria 1764
218 Ga0207674_10033440 3300026116 Bacteria 5383
219 Ga0207674_10089116 3300026116 Bacteria 3078
220 Ga0207674_10135278 3300026116 Bacteria 2427
221 Ga0207674_10163586 3300026116 Bacteria 2179
222 Ga0207674_10318998 3300026116 Bacteria 1503
223 Ga0207428_10008809 3300027907 Bacteria 9100
224 Ga0268265_10090677 3300028380 Bacteria 2442
225 Ga0268265_10188549 3300028380 Bacteria 1779
226 Ga0268264_10167900 3300028381 Bacteria 1982
227 Ga0307408_100162191 3300031548 Bacteria 1777
228 Ga0307410_10065959 3300031852 Unclassified 2492
229 Ga0307406_10015088 3300031901 Bacteria 4462
230 Ga0307416_100203010 3300032002 Bacteria 1883
231 Ga0307414_10434319 3300032004 Bacteria 1148
232 Ga0307411_10388223 3300032005 Unclassified 1150
233 Ga0307415_100177111 3300032126 Bacteria 1669
234 Ga0373951_0001796 3300035091 Bacteria 5570
235 Ga0373942_0013571 3300035207 Unclassified 1961
236 Ga0395898_0176300 3300037466 Unclassified 2043
237 Ga0395898_0291554 3300037466 Bacteria 1557
238 Ga0395901_0123803 3300038443 Unclassified 2717
239 Ga0395901_0605746 3300038443 Unclassified 1104
240 Ga0439458_0001417 3300042157 Bacteria 6048
241 Ga0451576_0288140 3300045051 Bacteria 1717
242 Ga0496102_0422757 3300048905 Unclassified 1252
243 Ga0501298_001617 3300049521 Unclassified 3343
244 Ga0501198_008798 3300049649 Bacteria 1471
245 Ga0501206_001686 3300049653 Bacteria 2769
246 Ga0501217_000354 3300049661 Bacteria 7335
247 Ga0501217_020623 3300049661 Unclassified 1550
248 Ga0501223_004086 3300049663 Unclassified 3146
249 Ga0501223_005593 3300049663 Unclassified 2636
250 Ga0501227_036637 3300049665 Bacteria 1198
251 Ga0501235_008711 3300049669 Bacteria 2214
252 Ga0501235_027634 3300049669 Unclassified 1273
253 Ga0501240_003037 3300049673 Bacteria 1838
254 Ga0501225_0065127 3300049705 Unclassified 1029
255 nmdc:mga05p37_101934_c1 3300050507 Bacteria 3535
256 nmdc:mga05p37_67340_c1 3300050507 Bacteria 4405
257 nmdc:mga08y16_21782_c1 3300050511 Bacteria 6763
258 nmdc:mga08y16_66577_c1 3300050511 Unclassified 3759
259 nmdc:mga0n895_228314_c1 3300050512 Unclassified 1890
260 nmdc:mga0n895_28170_c1 3300050512 Bacteria 5343
261 nmdc:mga0n895_467659_c1 3300050512 Unclassified 1272
262 nmdc:mga0rr50_11803_c1 3300050513 Bacteria 5610
263 nmdc:mga0a205_106377_c1 3300050515 Bacteria 2703
264 nmdc:mga0a205_51251_c1 3300050515 Bacteria 3984
265 nmdc:mga0a205_66330_c1 3300050515 Bacteria 3488
266 nmdc:mga0a205_80281_c1 3300050515 Bacteria 3152

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005530 Ga0070679_100528054 Ga0070679_1005280541 171
2 3300005440 Ga0070705_100322152 Ga0070705_1003221522 174
3 3300009174 Ga0105241_10177592 Ga0105241_101775922 177
4 3300005290 Ga0065712_10097667 Ga0065712_100976672 182
5 3300005293 Ga0065715_10127644 Ga0065715_101276443 190
6 3300005337 Ga0070682_100024319 Ga0070682_1000243194 190
7 3300005545 Ga0070695_100111798 Ga0070695_1001117983 190
8 3300005615 Ga0070702_100042881 Ga0070702_1000428813 190
9 3300025904 Ga0207647_10005868 Ga0207647_100058683 190
10 3300005536 Ga0070697_100261771 Ga0070697_1002617712 194
11 3300045051 Ga0451576_0288140 Ga0451576_0288140_767_1570 196
12 3300005345 Ga0070692_10335707 Ga0070692_103357071 197
13 3300005441 Ga0070700_100197601 Ga0070700_1001976012 197
14 3300005842 Ga0068858_100064880 Ga0068858_1000648803 197
15 3300005843 Ga0068860_100009989 Ga0068860_1000099893 197
16 3300006237 Ga0097621_100025394 Ga0097621_1000253943 197
17 3300006358 Ga0068871_100001915 Ga0068871_1000019153 197
18 3300009551 Ga0105238_10082569 Ga0105238_100825693 197
19 3300026035 Ga0207703_10028204 Ga0207703_100282042 197
20 3300026075 Ga0207708_10021633 Ga0207708_100216333 197
21 3300005539 Ga0068853_100210077 Ga0068853_1002100773 198
22 3300006852 Ga0075433_10023152 Ga0075433_100231525 198
23 3300009551 Ga0105238_10621799 Ga0105238_106217992 198
24 3300010375 Ga0105239_10630735 Ga0105239_106307351 198
25 3300014325 Ga0163163_10114380 Ga0163163_101143802 198
26 3300050512 nmdc:mga0n895_28170_c1 nmdc:mga0n895_28170_c1_1023_1823 198
27 3300050515 nmdc:mga0a205_51251_c1 nmdc:mga0a205_51251_c1_241_1041 198
28 3300005330 Ga0070690_100062376 Ga0070690_1000623763 199
29 3300005438 Ga0070701_10057692 Ga0070701_100576922 199
30 3300005577 Ga0068857_100155449 Ga0068857_1001554493 199
31 3300026116 Ga0207674_10089116 Ga0207674_100891164 199
32 3300005618 Ga0068864_100604482 Ga0068864_1006044821 200
33 3300009011 Ga0105251_10119141 Ga0105251_101191412 200
34 3300009101 Ga0105247_10000816 Ga0105247_1000081612 200
35 3300011119 Ga0105246_10045300 Ga0105246_100453004 200
36 3300025900 Ga0207710_10000753 Ga0207710_1000075312 200
37 3300035091 Ga0373951_0001796 Ga0373951_0001796_2934_3755 200
38 3300005331 Ga0070670_100082108 Ga0070670_1000821083 202
39 3300005618 Ga0068864_100065649 Ga0068864_1000656494 202
40 3300006852 Ga0075433_10085123 Ga0075433_100851233 202
41 3300009174 Ga0105241_10208262 Ga0105241_102082622 202
42 3300010375 Ga0105239_10094872 Ga0105239_100948724 202
43 3300025942 Ga0207689_10154510 Ga0207689_101545101 202
44 3300005337 Ga0070682_100003960 Ga0070682_10000396010 203
45 3300005441 Ga0070700_100010778 Ga0070700_1000107785 203
46 3300005841 Ga0068863_100848093 Ga0068863_1008480931 203
47 3300006358 Ga0068871_100270253 Ga0068871_1002702532 203
48 3300009148 Ga0105243_10005062 Ga0105243_100050626 203
49 3300009148 Ga0105243_10232201 Ga0105243_102322013 203
50 3300009174 Ga0105241_10594688 Ga0105241_105946881 203
51 3300009176 Ga0105242_10198412 Ga0105242_101984122 203
52 3300014326 Ga0157380_10775883 Ga0157380_107758831 203
53 3300025911 Ga0207654_10283031 Ga0207654_102830311 203
54 3300025934 Ga0207686_10143282 Ga0207686_101432823 203
55 3300025935 Ga0207709_10001958 Ga0207709_1000195815 203
56 3300026075 Ga0207708_10020250 Ga0207708_100202505 203
57 3300026088 Ga0207641_10236525 Ga0207641_102365252 203
58 3300005530 Ga0070679_100255487 Ga0070679_1002554872 204
59 3300005546 Ga0070696_100096597 Ga0070696_1000965972 204
60 3300006847 Ga0075431_100112719 Ga0075431_1001127193 204
61 3300009011 Ga0105251_10142998 Ga0105251_101429982 204
62 3300014745 Ga0157377_10171425 Ga0157377_101714251 204
63 3300013307 Ga0157372_10979456 Ga0157372_109794562 206
64 3300005331 Ga0070670_100375001 Ga0070670_1003750012 207
65 3300009174 Ga0105241_10342599 Ga0105241_103425992 207
66 3300026116 Ga0207674_10318998 Ga0207674_103189982 207
67 3300005295 Ga0065707_10005149 Ga0065707_100051491 208
68 3300005334 Ga0068869_100058321 Ga0068869_1000583212 208
69 3300005618 Ga0068864_100584700 Ga0068864_1005847002 208
70 3300006852 Ga0075433_10062186 Ga0075433_100621862 208
71 3300006871 Ga0075434_100437484 Ga0075434_1004374841 208
72 3300027907 Ga0207428_10008809 Ga0207428_100088097 208
73 3300032004 Ga0307414_10434319 Ga0307414_104343191 208
74 3300037466 Ga0395898_0176300 Ga0395898_0176300_438_1238 208
75 3300038443 Ga0395901_0123803 Ga0395901_0123803_726_1526 208
76 3300050511 nmdc:mga08y16_21782_c1 nmdc:mga08y16_21782_c1_2078_2881 208
77 3300050512 nmdc:mga0n895_467659_c1 nmdc:mga0n895_467659_c1_421_1224 208
78 3300050515 nmdc:mga0a205_80281_c1 nmdc:mga0a205_80281_c1_183_986 208
79 3300005353 Ga0070669_100311005 Ga0070669_1003110051 210
80 3300005440 Ga0070705_100007301 Ga0070705_1000073016 210
81 3300005617 Ga0068859_100107264 Ga0068859_1001072643 210
82 3300005840 Ga0068870_10018695 Ga0068870_100186953 210
83 3300005844 Ga0068862_100043254 Ga0068862_1000432543 210
84 3300006871 Ga0075434_100128251 Ga0075434_1001282512 210
85 3300006931 Ga0097620_100107265 Ga0097620_1001072653 210
86 3300007076 Ga0075435_100096591 Ga0075435_1000965913 210
87 3300009174 Ga0105241_10086651 Ga0105241_100866512 210
88 3300011119 Ga0105246_10062487 Ga0105246_100624874 210
89 3300013100 Ga0157373_10001056 Ga0157373_1000105615 210
90 3300013306 Ga0163162_10088860 Ga0163162_100888602 210
91 3300025908 Ga0207643_10003726 Ga0207643_100037265 210
92 3300025923 Ga0207681_10385141 Ga0207681_103851412 210
93 3300028380 Ga0268265_10090677 Ga0268265_100906772 210
94 3300050512 nmdc:mga0n895_228314_c1 nmdc:mga0n895_228314_c1_56_853 210
95 3300050513 nmdc:mga0rr50_11803_c1 nmdc:mga0rr50_11803_c1_3896_4720 210
96 3300050515 nmdc:mga0a205_66330_c1 nmdc:mga0a205_66330_c1_1116_1913 210
97 3300002459 JGI24751J29686_10000050 JGI24751J29686_1000005046 211
98 3300005331 Ga0070670_100000439 Ga0070670_10000043926 211
99 3300005468 Ga0070707_100113414 Ga0070707_1001134141 211
100 3300005471 Ga0070698_100049057 Ga0070698_1000490573 211
101 3300005518 Ga0070699_100012442 Ga0070699_1000124424 211
102 3300009094 Ga0111539_10003012 Ga0111539_1000301216 211
103 3300009094 Ga0111539_10388626 Ga0111539_103886262 211
104 3300009176 Ga0105242_10530915 Ga0105242_105309151 211
105 3300013307 Ga0157372_10021868 Ga0157372_100218686 211
106 3300014325 Ga0163163_10000993 Ga0163163_1000099327 211
107 3300025922 Ga0207646_10127960 Ga0207646_101279603 211
108 3300025925 Ga0207650_10000022 Ga0207650_1000002254 211
109 3300025935 Ga0207709_10083203 Ga0207709_100832033 211
110 3300031852 Ga0307410_10065959 Ga0307410_100659593 211
111 3300031901 Ga0307406_10015088 Ga0307406_100150884 211
112 3300032005 Ga0307411_10388223 Ga0307411_103882232 211
113 3300032126 Ga0307415_100177111 Ga0307415_1001771112 211
114 3300049649 Ga0501198_008798 Ga0501198_008798_324_1130 211
115 3300049661 Ga0501217_000354 Ga0501217_000354_1559_2365 211
116 3300049663 Ga0501223_005593 Ga0501223_005593_743_1549 211
117 3300000532 CNAas_1000006 CNAas_100000611 212
118 3300005444 Ga0070694_100188637 Ga0070694_1001886372 212
119 3300005518 Ga0070699_100232458 Ga0070699_1002324582 212
120 3300005564 Ga0070664_100670126 Ga0070664_1006701261 212
121 3300005577 Ga0068857_100295092 Ga0068857_1002950921 212
122 3300005618 Ga0068864_100443137 Ga0068864_1004431372 212
123 3300009177 Ga0105248_10166506 Ga0105248_101665062 212
124 3300014968 Ga0157379_10028983 Ga0157379_100289833 212
125 3300025936 Ga0207670_10526167 Ga0207670_105261671 212
126 3300025942 Ga0207689_10254311 Ga0207689_102543112 212
127 3300025945 Ga0207679_10119240 Ga0207679_101192402 212
128 3300026116 Ga0207674_10163586 Ga0207674_101635862 212
129 3300005617 Ga0068859_100190445 Ga0068859_1001904452 213
130 3300006931 Ga0097620_100190440 Ga0097620_1001904402 213
131 3300009093 Ga0105240_10131877 Ga0105240_101318773 213
132 3300009148 Ga0105243_10058341 Ga0105243_100583412 213
133 3300009177 Ga0105248_10053625 Ga0105248_100536253 213
134 3300025934 Ga0207686_10191814 Ga0207686_101918142 213
135 3300005354 Ga0070675_100061798 Ga0070675_1000617983 214
136 3300005438 Ga0070701_10075843 Ga0070701_100758432 214
137 3300005546 Ga0070696_100282604 Ga0070696_1002826042 214
138 3300005841 Ga0068863_100140776 Ga0068863_1001407763 214
139 3300009553 Ga0105249_10859043 Ga0105249_108590431 214
140 3300025926 Ga0207659_10043409 Ga0207659_100434093 214
141 3300026088 Ga0207641_10137282 Ga0207641_101372823 214
142 2162886012 MBSR1b_contig_2244195 MBSR1b_0619.00007220 215
143 3300005293 Ga0065715_10027763 Ga0065715_100277633 215
144 3300005440 Ga0070705_100005185 Ga0070705_1000051855 215
145 3300005445 Ga0070708_100198560 Ga0070708_1001985603 215
146 3300005458 Ga0070681_10196512 Ga0070681_101965122 215
147 3300005467 Ga0070706_100000300 Ga0070706_1000003009 215
148 3300005840 Ga0068870_10147482 Ga0068870_101474822 215
149 3300009093 Ga0105240_10036112 Ga0105240_100361123 215
150 3300009545 Ga0105237_10139042 Ga0105237_101390422 215
151 3300009553 Ga0105249_10037230 Ga0105249_100372303 215
152 3300013100 Ga0157373_10083357 Ga0157373_100833573 215
153 3300025910 Ga0207684_10000367 Ga0207684_100003678 215
154 3300025912 Ga0207707_10183017 Ga0207707_101830172 215
155 3300025914 Ga0207671_10476447 Ga0207671_104764471 215
156 3300025942 Ga0207689_10172800 Ga0207689_101728001 215
157 3300031548 Ga0307408_100162191 Ga0307408_1001621913 215
158 3300032002 Ga0307416_100203010 Ga0307416_1002030101 215
159 3300037466 Ga0395898_0291554 Ga0395898_0291554_601_1431 215
160 3300005843 Ga0068860_100352022 Ga0068860_1003520221 216
161 3300009551 Ga0105238_10019792 Ga0105238_100197925 216
162 3300010375 Ga0105239_10596034 Ga0105239_105960342 216
163 3300025924 Ga0207694_10007178 Ga0207694_100071785 216
164 3300025942 Ga0207689_10458788 Ga0207689_104587882 216
165 3300026116 Ga0207674_10033440 Ga0207674_100334403 216
166 3300042157 Ga0439458_0001417 Ga0439458_0001417_3913_4713 216
167 3300049521 Ga0501298_001617 Ga0501298_001617_1804_2637 216
168 3300049653 Ga0501206_001686 Ga0501206_001686_1697_2497 216
169 3300049661 Ga0501217_020623 Ga0501217_020623_452_1252 216
170 3300049663 Ga0501223_004086 Ga0501223_004086_311_1111 216
171 3300049665 Ga0501227_036637 Ga0501227_036637_124_957 216
172 3300049669 Ga0501235_027634 Ga0501235_027634_211_1014 216
173 3300005345 Ga0070692_10125498 Ga0070692_101254982 217
174 3300005444 Ga0070694_100031702 Ga0070694_1000317024 217
175 3300005546 Ga0070696_100012960 Ga0070696_1000129605 217
176 3300005547 Ga0070693_100063424 Ga0070693_1000634242 217
177 3300005617 Ga0068859_100107324 Ga0068859_1001073242 217
178 3300006931 Ga0097620_100107327 Ga0097620_1001073272 217
179 3300009147 Ga0114129_10210118 Ga0114129_102101182 217
180 3300009177 Ga0105248_10065615 Ga0105248_100656153 217
181 3300013306 Ga0163162_10034361 Ga0163162_100343614 217
182 3300025941 Ga0207711_10037446 Ga0207711_100374462 217
183 3300026035 Ga0207703_10098805 Ga0207703_100988052 217
184 3300048905 Ga0496102_0422757 Ga0496102_0422757_65_865 217
185 3300049705 Ga0501225_0065127 Ga0501225_0065127_111_923 217
186 3300050507 nmdc:mga05p37_67340_c1 nmdc:mga05p37_67340_c1_2321_3121 217
187 3300050515 nmdc:mga0a205_106377_c1 nmdc:mga0a205_106377_c1_1159_1959 217
188 3300005334 Ga0068869_100483221 Ga0068869_1004832211 218
189 3300005338 Ga0068868_100396413 Ga0068868_1003964132 218
190 3300005440 Ga0070705_100211844 Ga0070705_1002118442 218
191 3300005444 Ga0070694_100029742 Ga0070694_1000297422 218
192 3300005518 Ga0070699_100002048 Ga0070699_10000204816 218
193 3300005539 Ga0068853_100138935 Ga0068853_1001389352 218
194 3300005615 Ga0070702_100006879 Ga0070702_1000068795 218
195 3300009545 Ga0105237_10007314 Ga0105237_100073147 218
196 3300013308 Ga0157375_10276831 Ga0157375_102768313 218
197 3300025885 Ga0207653_10001165 Ga0207653_100011655 218
198 3300025914 Ga0207671_10004111 Ga0207671_100041117 218
199 3300035207 Ga0373942_0013571 Ga0373942_0013571_695_1528 218
200 3300005331 Ga0070670_100190615 Ga0070670_1001906152 219
201 3300025923 Ga0207681_10003720 Ga0207681_100037207 219
202 3300025925 Ga0207650_10234598 Ga0207650_102345982 219
203 3300049669 Ga0501235_008711 Ga0501235_008711_960_1772 219
204 3300049673 Ga0501240_003037 Ga0501240_003037_740_1552 219
205 3300050507 nmdc:mga05p37_101934_c1 nmdc:mga05p37_101934_c1_1836_2645 219
206 3300005330 Ga0070690_100516558 Ga0070690_1005165581 220
207 3300005343 Ga0070687_100038772 Ga0070687_1000387723 220
208 3300005458 Ga0070681_10007166 Ga0070681_1000716610 220
209 3300005459 Ga0068867_100111224 Ga0068867_1001112243 220
210 3300005545 Ga0070695_100038633 Ga0070695_1000386333 220
211 3300005549 Ga0070704_100270026 Ga0070704_1002700262 220
212 3300005615 Ga0070702_100013427 Ga0070702_1000134274 220
213 3300005617 Ga0068859_100017580 Ga0068859_1000175806 220
214 3300005617 Ga0068859_100052538 Ga0068859_1000525384 220
215 3300005617 Ga0068859_100406713 Ga0068859_1004067132 220
216 3300005842 Ga0068858_100131346 Ga0068858_1001313462 220
217 3300005842 Ga0068858_100340037 Ga0068858_1003400371 220
218 3300006844 Ga0075428_100111347 Ga0075428_1001113472 220
219 3300006931 Ga0097620_100017580 Ga0097620_1000175804 220
220 3300006931 Ga0097620_100052541 Ga0097620_1000525413 220
221 3300006931 Ga0097620_100406725 Ga0097620_1004067252 220
222 3300009094 Ga0111539_10037428 Ga0111539_100374283 220
223 3300009101 Ga0105247_10102927 Ga0105247_101029272 220
224 3300009545 Ga0105237_10275644 Ga0105237_102756442 220
225 3300025942 Ga0207689_10042379 Ga0207689_100423793 220
226 3300026035 Ga0207703_10230622 Ga0207703_102306223 220
227 3300026089 Ga0207648_10275836 Ga0207648_102758362 220
228 3300050511 nmdc:mga08y16_66577_c1 nmdc:mga08y16_66577_c1_184_996 220
229 3300005441 Ga0070700_100529331 Ga0070700_1005293311 221
230 3300006881 Ga0068865_100168969 Ga0068865_1001689692 221
231 3300026035 Ga0207703_10115491 Ga0207703_101154912 221
232 3300028380 Ga0268265_10188549 Ga0268265_101885493 221
233 3300005345 Ga0070692_10113831 Ga0070692_101138312 222
234 3300005444 Ga0070694_100056003 Ga0070694_1000560033 222
235 3300005617 Ga0068859_100150718 Ga0068859_1001507184 222
236 3300006931 Ga0097620_100150723 Ga0097620_1001507234 222
237 3300009101 Ga0105247_10499336 Ga0105247_104993361 222
238 3300009177 Ga0105248_10004560 Ga0105248_100045603 222
239 3300025941 Ga0207711_10002927 Ga0207711_100029274 222
240 3300038443 Ga0395901_0605746 Ga0395901_0605746_291_1085 222
241 3300005331 Ga0070670_100420535 Ga0070670_1004205351 223
242 3300005340 Ga0070689_100001531 Ga0070689_1000015313 223
243 3300005618 Ga0068864_100038030 Ga0068864_1000380302 223
244 3300005840 Ga0068870_10087985 Ga0068870_100879851 223
245 3300005841 Ga0068863_100306942 Ga0068863_1003069422 223
246 3300005843 Ga0068860_100246476 Ga0068860_1002464762 223
247 3300009177 Ga0105248_10066082 Ga0105248_100660823 223
248 3300013308 Ga0157375_10141821 Ga0157375_101418213 223
249 3300025908 Ga0207643_10011379 Ga0207643_100113795 223
250 3300025925 Ga0207650_10609734 Ga0207650_106097341 223
251 3300025936 Ga0207670_10001259 Ga0207670_100012593 223
252 3300025941 Ga0207711_10202005 Ga0207711_102020053 223
253 3300025942 Ga0207689_10142702 Ga0207689_101427023 223
254 3300026088 Ga0207641_10149617 Ga0207641_101496173 223
255 3300026089 Ga0207648_10252005 Ga0207648_102520052 223
256 3300026095 Ga0207676_10200073 Ga0207676_102000732 223
257 3300026116 Ga0207674_10135278 Ga0207674_101352784 223
258 3300028381 Ga0268264_10167900 Ga0268264_101679002 223
259 3300005441 Ga0070700_100000270 Ga0070700_10000027022 224
260 3300009148 Ga0105243_10641287 Ga0105243_106412872 224
261 3300026075 Ga0207708_10000087 Ga0207708_1000008714 224
262 2162886011 MRS1b_contig_915132 MRS1b_0155.00002220 226
263 3300005288 Ga0065714_10002297 Ga0065714_100022979 226
264 3300005290 Ga0065712_10067792 Ga0065712_1006779221 226
265 3300005293 Ga0065715_10089248 Ga0065715_100892486 226
266 3300005985 Ga0081539_10077919 Ga0081539_100779192 226

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12680

SnoaL_2

SnoaL-like domain

154

250

0.94

PF14534

DUF4440

Domain of unknown function (DUF4440)

148

249

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2rgq-assembly1.cif.gz_A crystal structure of a protein of unknown function with a cystatin-like fold (npun_r3134) from nostoc punctiforme pcc 73102 at 1.80 a resolution 0.8389 114 225
3bb9-assembly1.cif.gz_A crystal structure of a putative ketosteroid isomerase (sfri_1973) from shewanella frigidimarina ncimb 400 at 1.80 a resolution 0.8191 118 223
3f7s-assembly1.cif.gz_A-2 crystal structure of a ntf2-like protein of unknown function (pp_4556) from pseudomonas putida kt2440 at 2.11 a resolution 0.8182 114 223
2w2c-assembly1.cif.gz_I structure of the tetradecameric oligomerisation domain of calcium- calmodulin dependent protein kinase ii delta 0.8124 110 223
7urw-assembly1.cif.gz_D-2 tetradecameric hub domain of camkii beta 0.809 114 226
ID Description Score Start End Superfamily
af_O01516_3_118_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8202 114 223 3.10.450.50
af_O07237_11_153_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7895 113 226 3.10.450.50
af_Q9VK12_26_248_3.15.10.30 Alpha Beta;Super Roll;Bactericidal permeability-increasing protein; domain 1;TULIP domain 0.7844 171 225 3.15.10.30
af_C6TFP4_1_123_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7843 114 226 3.10.450.50
3fsdA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7837 116 226 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A1M6YAW4-F1-model_v4 SnoaL-like domain-containing protein 0.9561 170 225
AF-C1N7M0-F1-model_v4 Predicted protein 0.9391 170 226
AF-A0A831PQ12-F1-model_v4 Nuclear transport factor 2 family protein 0.9195 169 226
AF-A0A2G5SJS1-F1-model_v4 DUF4440 domain-containing protein 0.9132 166 226
AF-A0A2V5W9C3-F1-model_v4 DUF4440 domain-containing protein 0.9014 130 226

Feature Viewer

pLDDT pTM Quality
76.97 0.55 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map