F374216

General Info

Members Datasets Scaffolds Average Seq Length
266 204 532 291

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0018487|Ga0395899_0018487_713_1699
Length 328
Sequence MPSRLAASAQMFTMAQSDVLPTNTLPVRVSRLLRIRGAGVALPYVFVGPTVACLVVFGVLPIAVAAVVSLTNLDITGLGDHSAIRFVGLGNYRELFRDPAFWQALRNTALYIGVGVPTLVVGSLSIAIALNRSSSRFFRALRVFYFFPAITAIVAISLIWGYLYNSQFGLLNYMLSEVGLGPVQWLSDPTIAKFSVALVAIWRGSGLDIIIFLAALQAIPTEYYEAASLDGASDRRQIFDITIPLLKFAIFFVTVTTLISWMQFFDEPYVLTGGGPVNATTSVSLYIYQQGFSSNEFGFASAASIVLFAIIAVVTGLQLRARTRSERG

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
8 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
48 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
56 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
75 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
80 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
118 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
119 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
120 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
121 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
122 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
123 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
124 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
125 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
126 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
127 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
128 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
129 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
135 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
136 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
137 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
138 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
139 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
140 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
141 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
142 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
143 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
144 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
145 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
146 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
147 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
148 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
149 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
150 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
151 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
152 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
153 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
154 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
155 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
156 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
157 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
158 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
163 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
164 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
165 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
166 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
167 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
168 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
169 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
170 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
171 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
172 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
173 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
174 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
175 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
176 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
177 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
178 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
179 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
180 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
181 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
182 2547132374 Acidovorax radicis N35 Isolate Unclassified
183 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
184 2643221658 Variovorax sp. Root411 Isolate Unclassified
185 2643221672 Variovorax sp. Root434 Isolate Unclassified
186 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
187 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
188 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
189 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
190 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
191 2818991441 Niallia circulans 3243 Isolate Rhizosphere
192 2818991459 Paenibacillus sp. 597 Isolate Unclassified
193 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
194 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
195 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
196 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
197 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
198 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
199 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
200 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
201 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
202 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
203 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere
204 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.6
Metatranscriptomes 0
Isolates 9.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.17
Nodule 0
Rhizoplane 0.75
Rhizosphere 72.56
Stem 0
Stem Tuber 0
Unclassified 4.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0018487 3300037312 Bacteria 5298
2 MBSR1b_contig_5309271 2162886012 Bacteria 1141
3 JGI24739J22299_10011042 3300001989 Bacteria 3340
4 JGI24737J22298_10004975 3300001990 Bacteria 4606
5 JGI24735J21928_10000310 3300002067 Bacteria 16871
6 JGI25151J46595_10042733 3300003187 Bacteria 1629
7 Ga0055536_1001124 3300003781 Bacteria 16799
8 Ga0055540_1001164 3300003792 Bacteria 16364
9 Ga0055531_10001612 3300003794 Bacteria 16364
10 Ga0055541_1003379 3300003841 Bacteria 3014
11 Ga0065712_10002903 3300005290 Bacteria 6943
12 Ga0065715_10210971 3300005293 Bacteria 1308
13 Ga0070658_10026288 3300005327 Bacteria 4669
14 Ga0070676_10128195 3300005328 Bacteria 1601
15 Ga0070670_100189258 3300005331 Bacteria 1787
16 Ga0070670_100203674 3300005331 Bacteria 1720
17 Ga0068869_100087305 3300005334 Bacteria 2340
18 Ga0070680_100035265 3300005336 Bacteria 4038
19 Ga0070682_100110901 3300005337 Unclassified 1828
20 Ga0068868_100294349 3300005338 Bacteria 1377
21 Ga0070689_100439120 3300005340 Bacteria 1109
22 Ga0070668_100133955 3300005347 Bacteria 1991
23 Ga0070675_100056577 3300005354 Bacteria 3232
24 Ga0070673_100061301 3300005364 Bacteria 2984
25 Ga0070688_100014217 3300005365 Bacteria 4506
26 Ga0070708_100302114 3300005445 Bacteria 1507
27 Ga0070663_100188688 3300005455 Bacteria 1603
28 Ga0070662_100181862 3300005457 Bacteria 1658
29 Ga0070681_10020655 3300005458 Bacteria 6598
30 Ga0068867_100187397 3300005459 Bacteria 1649
31 Ga0070706_100000004 3300005467 Bacteria 281790
32 Ga0070706_100000756 3300005467 Bacteria 36194
33 Ga0070706_100001200 3300005467 Bacteria 27738
34 Ga0070707_100000002 3300005468 Bacteria 291540
35 Ga0070707_100016581 3300005468 Bacteria 6915
36 Ga0070707_100024476 3300005468 Bacteria 5719
37 Ga0070698_100005054 3300005471 Bacteria 14456
38 Ga0070698_100024789 3300005471 Bacteria 6254
39 Ga0070698_100468841 3300005471 Bacteria 1195
40 Ga0070699_100000073 3300005518 Bacteria 95396
41 Ga0070699_100000448 3300005518 Bacteria 39507
42 Ga0070699_100014251 3300005518 Bacteria 6839
43 Ga0070699_100166772 3300005518 Bacteria 1951
44 Ga0070672_100205943 3300005543 Bacteria 1646
45 Ga0070665_100328455 3300005548 Bacteria 1534
46 Ga0070704_100002876 3300005549 Bacteria 9760
47 Ga0068855_100036708 3300005563 Bacteria 5830
48 Ga0068857_100122395 3300005577 Bacteria 2343
49 Ga0068857_100327260 3300005577 Bacteria 1416
50 Ga0068856_100017717 3300005614 Bacteria 6907
51 Ga0068852_100008490 3300005616 Bacteria 7574
52 Ga0068852_100509991 3300005616 Bacteria 1199
53 Ga0068860_100137417 3300005843 Bacteria 2347
54 Ga0068860_100138715 3300005843 Bacteria 2336
55 Ga0068862_100012178 3300005844 Bacteria 7110
56 Ga0068862_100063329 3300005844 Bacteria 3182
57 Ga0081455_10000157 3300005937 Bacteria 82320
58 Ga0075365_10005050 3300006038 Bacteria 7079
59 Ga0075365_10136757 3300006038 Bacteria 1699
60 Ga0075363_100019648 3300006048 Bacteria 3379
61 Ga0075364_10017757 3300006051 Bacteria 4448
62 Ga0075432_10002267 3300006058 Bacteria 6398
63 Ga0075432_10015909 3300006058 Bacteria 2569
64 Ga0075362_10005574 3300006177 Bacteria 4621
65 Ga0075362_10007431 3300006177 Bacteria 4150
66 Ga0075367_10196036 3300006178 Bacteria 1261
67 Ga0075369_10015772 3300006186 Bacteria 3038
68 Ga0075369_10020924 3300006186 Bacteria 2683
69 Ga0075366_10019014 3300006195 Bacteria 3970
70 Ga0075370_10002003 3300006353 Bacteria 9238
71 Ga0075370_10043475 3300006353 Bacteria 2539
72 Ga0075370_10049927 3300006353 Bacteria 2372
73 Ga0075431_100020202 3300006847 Bacteria 6803
74 Ga0075431_100222528 3300006847 Bacteria 1925
75 Ga0075429_100330074 3300006880 Bacteria 1335
76 Ga0105251_10000072 3300009011 Bacteria 97611
77 Ga0105244_10136386 3300009036 Bacteria 1182
78 Ga0105240_10116941 3300009093 Bacteria 3216
79 Ga0114129_10051929 3300009147 Bacteria 5754
80 Ga0105241_10084291 3300009174 Bacteria 2495
81 Ga0105242_10011179 3300009176 Bacteria 6897
82 Ga0105248_10028464 3300009177 Bacteria 6225
83 Ga0105237_10241762 3300009545 Unclassified 1806
84 Ga0105249_10049714 3300009553 Bacteria 3823
85 Ga0105239_10011698 3300010375 Bacteria 9794
86 Ga0157373_10002729 3300013100 Bacteria 13373
87 Ga0157373_10016214 3300013100 Bacteria 5437
88 Ga0157371_10154009 3300013102 Unclassified 1640
89 Ga0157370_10007600 3300013104 Bacteria 11774
90 Ga0157369_10080632 3300013105 Bacteria 3484
91 Ga0157369_10292959 3300013105 Unclassified 1694
92 Ga0157369_10380065 3300013105 Unclassified 1466
93 Ga0157374_10249478 3300013296 Bacteria 1746
94 Ga0157372_10060348 3300013307 Bacteria 4244
95 Ga0157372_10141489 3300013307 Bacteria 2772
96 Ga0163163_10024763 3300014325 Bacteria 5714
97 Ga0182008_10003892 3300014497 Bacteria 8857
98 Ga0157377_10057946 3300014745 Bacteria 2204
99 Ga0182006_1004194 3300015261 Bacteria 7150
100 Ga0182007_10027457 3300015262 Bacteria 1962
101 Ga0163161_10003436 3300017792 Bacteria 11101
102 Ga0209566_101134 3300025225 Bacteria 10077
103 Ga0209676_1001463 3300025292 Bacteria 22075
104 Ga0209025_1007785 3300025294 Bacteria 7883
105 Ga0209050_1003252 3300025298 Bacteria 12235
106 Ga0209051_1000112 3300025303 Bacteria 152667
107 Ga0209257_1000290 3300025304 Bacteria 110826
108 Ga0207713_1000651 3300025735 Bacteria 33250
109 Ga0207653_10013030 3300025885 Bacteria 2601
110 Ga0207647_10001798 3300025904 Bacteria 16432
111 Ga0207647_10152011 3300025904 Bacteria 1353
112 Ga0207645_10069358 3300025907 Bacteria 2255
113 Ga0207643_10053575 3300025908 Bacteria 2292
114 Ga0207705_10030980 3300025909 Bacteria 3817
115 Ga0207705_10066844 3300025909 Bacteria 2601
116 Ga0207705_10181410 3300025909 Bacteria 1589
117 Ga0207684_10000003 3300025910 Bacteria 766933
118 Ga0207684_10000033 3300025910 Bacteria 291567
119 Ga0207684_10000436 3300025910 Bacteria 55372
120 Ga0207684_10032488 3300025910 Bacteria 4438
121 Ga0207684_10063130 3300025910 Bacteria 3145
122 Ga0207654_10189185 3300025911 Unclassified 1348
123 Ga0207707_10153743 3300025912 Bacteria 2012
124 Ga0207695_10044137 3300025913 Bacteria 4744
125 Ga0207695_10138262 3300025913 Bacteria 2387
126 Ga0207660_10043442 3300025917 Bacteria 3158
127 Ga0207660_10054547 3300025917 Bacteria 2853
128 Ga0207657_10030038 3300025919 Bacteria 4937
129 Ga0207652_10006229 3300025921 Bacteria 9632
130 Ga0207652_10012079 3300025921 Bacteria 6972
131 Ga0207646_10000007 3300025922 Bacteria 478285
132 Ga0207646_10000043 3300025922 Bacteria 184713
133 Ga0207646_10000608 3300025922 Bacteria 46550
134 Ga0207681_10018051 3300025923 Bacteria 4439
135 Ga0207650_10207118 3300025925 Bacteria 1574
136 Ga0207650_10388003 3300025925 Bacteria 1154
137 Ga0207706_10308116 3300025933 Bacteria 1379
138 Ga0207686_10025179 3300025934 Bacteria 3457
139 Ga0207691_10052341 3300025940 Bacteria 3729
140 Ga0207691_10132477 3300025940 Bacteria 2201
141 Ga0207711_10210142 3300025941 Bacteria 1777
142 Ga0207667_10026314 3300025949 Bacteria 6358
143 Ga0207667_10247815 3300025949 Bacteria 1822
144 Ga0207667_10410086 3300025949 Bacteria 1379
145 Ga0207651_10012098 3300025960 Bacteria 4864
146 Ga0207668_10207827 3300025972 Bacteria 1564
147 Ga0207658_10431262 3300025986 Unclassified 1164
148 Ga0207677_10359908 3300026023 Bacteria 1222
149 Ga0207708_10047592 3300026075 Bacteria 3264
150 Ga0207702_10117336 3300026078 Bacteria 2376
151 Ga0207641_10020468 3300026088 Bacteria 5433
152 Ga0207648_10566400 3300026089 Bacteria 1045
153 Ga0207674_10013678 3300026116 Bacteria 8989
154 Ga0207674_10461003 3300026116 Bacteria 1228
155 Ga0209371_1004626 3300027312 Bacteria 5878
156 Ga0207428_10007942 3300027907 Bacteria 9639
157 Ga0207428_10235840 3300027907 Bacteria 1368
158 Ga0268265_10215519 3300028380 Bacteria 1676
159 Ga0268265_10417715 3300028380 Bacteria 1244
160 Ga0268264_10193807 3300028381 Bacteria 1854
161 Ga0268256_1004385 3300030500 Bacteria 5878
162 Ga0307513_10253637 3300031456 Bacteria 1554
163 Ga0307408_100019940 3300031548 Bacteria 4518
164 Ga0307514_10002316 3300031649 Bacteria 20059
165 Ga0316576_10009774 3300031727 Bacteria 6209
166 Ga0316576_10262773 3300031727 Unclassified 1295
167 Ga0316578_10007964 3300031728 Bacteria 5355
168 Ga0316577_10000027 3300031733 Bacteria 32477
169 Ga0316577_10009266 3300031733 Bacteria 5295
170 Ga0307413_10319946 3300031824 Bacteria 1185
171 Ga0307406_10002334 3300031901 Bacteria 10308
172 Ga0307411_10091441 3300032005 Bacteria 2125
173 Ga0316585_10019743 3300032137 Bacteria 2057
174 Ga0316582_0035463 3300036647 Bacteria 3081
175 Ga0316582_0197605 3300036647 Unclassified 1371
176 Ga0316584_0097142 3300036712 Bacteria 2205
177 Ga0316584_0293309 3300036712 Unclassified 1179
178 Ga0395899_0001898 3300037312 Bacteria 17259
179 Ga0395900_0009425 3300037418 Bacteria 10007
180 Ga0395900_0031405 3300037418 Bacteria 5456
181 Ga0395898_0018679 3300037466 Bacteria 7067
182 Ga0395905_0010250 3300037471 Bacteria 9129
183 Ga0395901_0005316 3300038443 Bacteria 13011
184 Ga0436365_0372307 3300039437 Bacteria 2935
185 Ga0439436_0002300 3300041404 Bacteria 5730
186 Ga0451853_1296168 3300041512 Bacteria 1209
187 Ga0450906_004124 3300042145 Bacteria 3073
188 Ga0439434_0008180 3300042435 Bacteria 3065
189 Ga0450918_000920 3300042531 Bacteria 6158
190 Ga0453684_0009075 3300044712 Bacteria 17528
191 Ga0453684_0011651 3300044712 Bacteria 14677
192 Ga0453684_0297408 3300044712 Bacteria 1836
193 Ga0453684_0996881 3300044712 Bacteria 891
194 Ga0495590_0000076 3300046457 Bacteria 68651
195 Ga0495650_0001393 3300046471 Bacteria 23768
196 Ga0495652_0315312 3300046529 Bacteria 1132
197 Ga0495656_0198315 3300046615 Bacteria 995
198 Ga0495625_0000262 3300046660 Bacteria 81925
199 Ga0495672_0007930 3300047320 Bacteria 7917
200 Ga0496104_0085520 3300048907 Bacteria 3010
201 Ga0496112_0207372 3300048915 Bacteria 1917
202 Ga0496116_0030095 3300048919 Bacteria 3905
203 Ga0496118_0171358 3300048921 Bacteria 1325
204 Ga0496119_0042486 3300048922 Bacteria 2881
205 Ga0496120_0005961 3300048923 Bacteria 9494
206 Ga0496121_0150326 3300048924 Bacteria 1714
207 Ga0496121_0255317 3300048924 Bacteria 1213
208 Ga0496122_0001773 3300048925 Bacteria 33062
209 Ga0496123_0003752 3300048926 Bacteria 16659
210 Ga0496123_0127290 3300048926 Bacteria 1419
211 Ga0496125_0001369 3300048928 Bacteria 35869
212 Ga0496126_0010953 3300048929 Bacteria 9445
213 Ga0496126_0032334 3300048929 Bacteria 4929
214 Ga0501032_0099833 3300049569 Bacteria 1923
215 Ga0501034_0137878 3300049571 Bacteria 2420
216 Ga0501038_0024455 3300049574 Bacteria 5389
217 Ga0501038_0299373 3300049574 Bacteria 1263
218 Ga0501039_0331584 3300049575 Unclassified 1196
219 Ga0501074_0093177 3300049590 Bacteria 2157
220 Ga0501035_0046544 3300049822 Bacteria 3902
221 nmdc:mga03683_2188_c1 3300050489 Bacteria 6036
222 nmdc:mga03n38_36223_c1 3300050490 Bacteria 2120
223 nmdc:mga03n38_840_c1 3300050490 Bacteria 8228
224 nmdc:mga00v17_1686_c1 3300050491 Bacteria 11498
225 nmdc:mga00v17_25565_c1 3300050491 Bacteria 3433
226 nmdc:mga0yw44_12818_c1 3300050492 Bacteria 4386
227 nmdc:mga0yw44_2039_c1 3300050492 Bacteria 8418
228 nmdc:mga0yw44_8231_c1 3300050492 Bacteria 5182
229 nmdc:mga0k408_7624_c1 3300050493 Bacteria 5781
230 nmdc:mga06z11_21625_c1 3300050494 Bacteria 2992
231 nmdc:mga07m45_2911_c1 3300050496 Bacteria 8114
232 nmdc:mga05p37_43693_c1 3300050507 Bacteria 5513
233 nmdc:mga06r32_19804_c1 3300050510 Bacteria 6184
234 Ga0500651_0000211 3300053093 Bacteria 36797
235 Ga0500650_0000754 3300053098 Bacteria 8798
236 Ga0500556_0000145 3300053104 Bacteria 59342
237 Ga0500562_002665 3300053108 Bacteria 4440
238 Ga0500593_003959 3300053117 Bacteria 5681
239 Ga0500608_000928 3300053122 Bacteria 10532
240 Ga0500655_030534 3300053133 Bacteria 1037
241 Ga0500620_000678 3300053155 Bacteria 5827
242 2513231078 2513020051 Bacteria 6053213
243 2548497758 2547132374 Bacteria 5530232
244 2644160230 2643221628 Bacteria 5745828
245 2644325391 2643221658 Bacteria 6064537
246 2644326059 2643221658 Bacteria 6064537
247 2644398161 2643221672 Bacteria 6322190
248 2644526384 2643221694 Bacteria 4392972
249 2644671059 2643221722 Bacteria 4247614
250 2730137788 2728369359 Bacteria 5621728
251 2774398110 2773857763 Bacteria 4180068
252 2802440216 2802428803 Bacteria 5806948
253 2819568959 2818991441 Bacteria 5062707
254 2819672515 2818991459 Bacteria 8736032
255 2852647854 2852646457 Bacteria 3408613
256 2857736724 2857733635 Bacteria 3532004
257 2889277756 2889276214 Bacteria 5979355
258 2904600027 2904595352 Bacteria 6124848
259 2929207260 2929206907 Bacteria 5918291
260 2939659314 2939657138 Bacteria 3740283
261 2945973700 2945972063 Bacteria 6086495
262 2946033790 2946033335 Bacteria 3835514
263 2996708910 2996706504 Bacteria 5757485
264 648168238 648028048 Bacteria 5394884
265 8054284285 8054280661 Bacteria 4232245
266 8056581110 8056579771 Bacteria 5840325
267 Ga0395899_0018487
268 MBSR1b_contig_5309271
269 JGI24739J22299_10011042
270 JGI24737J22298_10004975
271 JGI24735J21928_10000310
272 JGI25151J46595_10042733
273 Ga0055536_1001124
274 Ga0055540_1001164
275 Ga0055531_10001612
276 Ga0055541_1003379
277 Ga0065712_10002903
278 Ga0065715_10210971
279 Ga0070658_10026288
280 Ga0070676_10128195
281 Ga0070670_100189258
282 Ga0070670_100203674
283 Ga0068869_100087305
284 Ga0070680_100035265
285 Ga0070682_100110901
286 Ga0068868_100294349
287 Ga0070689_100439120
288 Ga0070668_100133955
289 Ga0070675_100056577
290 Ga0070673_100061301
291 Ga0070688_100014217
292 Ga0070708_100302114
293 Ga0070663_100188688
294 Ga0070662_100181862
295 Ga0070681_10020655
296 Ga0068867_100187397
297 Ga0070706_100000004
298 Ga0070706_100000756
299 Ga0070706_100001200
300 Ga0070707_100000002
301 Ga0070707_100016581
302 Ga0070707_100024476
303 Ga0070698_100005054
304 Ga0070698_100024789
305 Ga0070698_100468841
306 Ga0070699_100000073
307 Ga0070699_100000448
308 Ga0070699_100014251
309 Ga0070699_100166772
310 Ga0070672_100205943
311 Ga0070665_100328455
312 Ga0070704_100002876
313 Ga0068855_100036708
314 Ga0068857_100122395
315 Ga0068857_100327260
316 Ga0068856_100017717
317 Ga0068852_100008490
318 Ga0068852_100509991
319 Ga0068860_100137417
320 Ga0068860_100138715
321 Ga0068862_100012178
322 Ga0068862_100063329
323 Ga0081455_10000157
324 Ga0075365_10005050
325 Ga0075365_10136757
326 Ga0075363_100019648
327 Ga0075364_10017757
328 Ga0075432_10002267
329 Ga0075432_10015909
330 Ga0075362_10005574
331 Ga0075362_10007431
332 Ga0075367_10196036
333 Ga0075369_10015772
334 Ga0075369_10020924
335 Ga0075366_10019014
336 Ga0075370_10002003
337 Ga0075370_10043475
338 Ga0075370_10049927
339 Ga0075431_100020202
340 Ga0075431_100222528
341 Ga0075429_100330074
342 Ga0105251_10000072
343 Ga0105244_10136386
344 Ga0105240_10116941
345 Ga0114129_10051929
346 Ga0105241_10084291
347 Ga0105242_10011179
348 Ga0105248_10028464
349 Ga0105237_10241762
350 Ga0105249_10049714
351 Ga0105239_10011698
352 Ga0157373_10002729
353 Ga0157373_10016214
354 Ga0157371_10154009
355 Ga0157370_10007600
356 Ga0157369_10080632
357 Ga0157369_10292959
358 Ga0157369_10380065
359 Ga0157374_10249478
360 Ga0157372_10060348
361 Ga0157372_10141489
362 Ga0163163_10024763
363 Ga0182008_10003892
364 Ga0157377_10057946
365 Ga0182006_1004194
366 Ga0182007_10027457
367 Ga0163161_10003436
368 Ga0209566_101134
369 Ga0209676_1001463
370 Ga0209025_1007785
371 Ga0209050_1003252
372 Ga0209051_1000112
373 Ga0209257_1000290
374 Ga0207713_1000651
375 Ga0207653_10013030
376 Ga0207647_10001798
377 Ga0207647_10152011
378 Ga0207645_10069358
379 Ga0207643_10053575
380 Ga0207705_10030980
381 Ga0207705_10066844
382 Ga0207705_10181410
383 Ga0207684_10000003
384 Ga0207684_10000033
385 Ga0207684_10000436
386 Ga0207684_10032488
387 Ga0207684_10063130
388 Ga0207654_10189185
389 Ga0207707_10153743
390 Ga0207695_10044137
391 Ga0207695_10138262
392 Ga0207660_10043442
393 Ga0207660_10054547
394 Ga0207657_10030038
395 Ga0207652_10006229
396 Ga0207652_10012079
397 Ga0207646_10000007
398 Ga0207646_10000043
399 Ga0207646_10000608
400 Ga0207681_10018051
401 Ga0207650_10207118
402 Ga0207650_10388003
403 Ga0207706_10308116
404 Ga0207686_10025179
405 Ga0207691_10052341
406 Ga0207691_10132477
407 Ga0207711_10210142
408 Ga0207667_10026314
409 Ga0207667_10247815
410 Ga0207667_10410086
411 Ga0207651_10012098
412 Ga0207668_10207827
413 Ga0207658_10431262
414 Ga0207677_10359908
415 Ga0207708_10047592
416 Ga0207702_10117336
417 Ga0207641_10020468
418 Ga0207648_10566400
419 Ga0207674_10013678
420 Ga0207674_10461003
421 Ga0209371_1004626
422 Ga0207428_10007942
423 Ga0207428_10235840
424 Ga0268265_10215519
425 Ga0268265_10417715
426 Ga0268264_10193807
427 Ga0268256_1004385
428 Ga0307513_10253637
429 Ga0307408_100019940
430 Ga0307514_10002316
431 Ga0316576_10009774
432 Ga0316576_10262773
433 Ga0316578_10007964
434 Ga0316577_10000027
435 Ga0316577_10009266
436 Ga0307413_10319946
437 Ga0307406_10002334
438 Ga0307411_10091441
439 Ga0316585_10019743
440 Ga0316582_0035463
441 Ga0316582_0197605
442 Ga0316584_0097142
443 Ga0316584_0293309
444 Ga0395899_0001898
445 Ga0395900_0009425
446 Ga0395900_0031405
447 Ga0395898_0018679
448 Ga0395905_0010250
449 Ga0395901_0005316
450 Ga0436365_0372307
451 Ga0439436_0002300
452 Ga0451853_1296168
453 Ga0450906_004124
454 Ga0439434_0008180
455 Ga0450918_000920
456 Ga0453684_0009075
457 Ga0453684_0011651
458 Ga0453684_0297408
459 Ga0453684_0996881
460 Ga0495590_0000076
461 Ga0495650_0001393
462 Ga0495652_0315312
463 Ga0495656_0198315
464 Ga0495625_0000262
465 Ga0495672_0007930
466 Ga0496104_0085520
467 Ga0496112_0207372
468 Ga0496116_0030095
469 Ga0496118_0171358
470 Ga0496119_0042486
471 Ga0496120_0005961
472 Ga0496121_0150326
473 Ga0496121_0255317
474 Ga0496122_0001773
475 Ga0496123_0003752
476 Ga0496123_0127290
477 Ga0496125_0001369
478 Ga0496126_0010953
479 Ga0496126_0032334
480 Ga0501032_0099833
481 Ga0501034_0137878
482 Ga0501038_0024455
483 Ga0501038_0299373
484 Ga0501039_0331584
485 Ga0501074_0093177
486 Ga0501035_0046544
487 nmdc:mga03683_2188_c1
488 nmdc:mga03n38_36223_c1
489 nmdc:mga03n38_840_c1
490 nmdc:mga00v17_1686_c1
491 nmdc:mga00v17_25565_c1
492 nmdc:mga0yw44_12818_c1
493 nmdc:mga0yw44_2039_c1
494 nmdc:mga0yw44_8231_c1
495 nmdc:mga0k408_7624_c1
496 nmdc:mga06z11_21625_c1
497 nmdc:mga07m45_2911_c1
498 nmdc:mga05p37_43693_c1
499 nmdc:mga06r32_19804_c1
500 Ga0500651_0000211
501 Ga0500650_0000754
502 Ga0500556_0000145
503 Ga0500562_002665
504 Ga0500593_003959
505 Ga0500608_000928
506 Ga0500655_030534
507 Ga0500620_000678
508 2513231078
509 2548497758
510 2644160230
511 2644325391
512 2644326059
513 2644398161
514 2644526384
515 2644671059
516 2730137788
517 2774398110
518 2802440216
519 2819568959
520 2819672515
521 2852647854
522 2857736724
523 2889277756
524 2904600027
525 2929207260
526 2939659314
527 2945973700
528 2946033790
529 2996708910
530 648168238
531 8054284285
532 8056581110

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

101

325

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4jbw-assembly2.cif.gz_H crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.9074 50 280
4jbw-assembly1.cif.gz_F crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.904 49 282
3pv0-assembly1.cif.gz_F crystal structure of a pre-translocation state mbp-maltose transporter complex without nucleotide 0.8855 49 279
8ja7-assembly1.cif.gz_A cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose 0.8831 7 282
2r6g-assembly1.cif.gz_F the crystal structure of the e. coli maltose transporter 0.8805 49 278
ID Description Score Start End Superfamily
af_P71896_49_286_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9583 50 286 1.10.3720.10
af_O53484_49_294_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.952 50 287 1.10.3720.10
af_P71896_49_286_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9426 50 286 1.10.3720.10
af_I6XFF3_60_302_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9384 50 286 1.10.3720.10
af_P10905_52_292_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9366 50 288 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A3D4B173-F1-model_v4 Sugar ABC transporter permease 0.9722 40 286 GO:0005886
GO:0055085
AF-A0A7W1FAI0-F1-model_v4 Sugar ABC transporter permease 0.9703 33 287 GO:0005886
GO:0055085
AF-A0A4Y8ZUB0-F1-model_v4 Sugar ABC transporter permease 0.966 35 281 GO:0005886
GO:0055085
AF-A0A502C5C2-F1-model_v4 deleted 0.9651 39 287
AF-A0A3S9QQK5-F1-model_v4 Sugar ABC transporter permease 0.9649 63 280 GO:0005886
GO:0055085

Map