F374149

General Info

Members Datasets Scaffolds Average Seq Length
266 161 261 149

Family's Representative Sequence

Representative Sequence 3300027876|Ga0209974_10011025|Ga0209974_100110256
Length 151
Sequence MRRVRLASEAFDPHEELRRFAETRTSAGGIVSFLGQVRQEEGDPVEALELRHYAPLTLPGMDELALRAETRWPLIATLVIHRIGVMVPGDPIVLVACAARHRRDAFEAADFLMDHLKSSAWFWKREKTAEGWRWIEPRGQDYADLARWAED

Samples

Sample ID Description Type Environment
1 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
2 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
3 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
4 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
5 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
35 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
42 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
76 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
81 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
82 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
83 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
84 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
85 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
86 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
87 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
88 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
89 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
90 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
91 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
92 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
93 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
94 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
95 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
96 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
97 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
98 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
99 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
100 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
101 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
102 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
103 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
104 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
105 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
106 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
107 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
108 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
109 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
110 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
111 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
112 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
113 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
114 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
115 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
116 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
117 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
118 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
119 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
120 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
121 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
122 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
123 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
124 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
125 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
126 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
127 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
128 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
129 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
130 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
131 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
132 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
133 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
134 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
135 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
136 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
137 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
138 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
139 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
140 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
141 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
142 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
149 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
150 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
151 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
152 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
153 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
154 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
155 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
156 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
157 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
158 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
159 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
160 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
161 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.12
Metatranscriptomes 0
Isolates 1.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.78
Nodule 0
Rhizoplane 7.14
Rhizosphere 68.8
Stem 0
Stem Tuber 0
Unclassified 11.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24748J21848_1002266 3300002074 Bacteria 2158
2 JGI24751J29686_10000070 3300002459 Bacteria 59622
3 Ga0055530_10021415 3300003791 Bacteria 1906
4 Ga0065704_10070490 3300005289 Bacteria 22609
5 Ga0065707_10084843 3300005295 Bacteria 6711
6 Ga0070658_10079120 3300005327 Bacteria 2699
7 Ga0070690_100111694 3300005330 Bacteria 1825
8 Ga0070670_100212286 3300005331 Bacteria 1683
9 Ga0070666_10013849 3300005335 Bacteria 5125
10 Ga0070666_10073352 3300005335 Bacteria 2331
11 Ga0070666_11101893 3300005335 Bacteria 590
12 Ga0070660_100044715 3300005339 Bacteria 3388
13 Ga0070660_101272617 3300005339 Bacteria 624
14 Ga0070668_100367274 3300005347 Bacteria 1222
15 Ga0070668_100958886 3300005347 Bacteria 767
16 Ga0070669_100000492 3300005353 Bacteria 29848
17 Ga0070669_100001266 3300005353 Bacteria 18324
18 Ga0070669_100547789 3300005353 Bacteria 964
19 Ga0070671_100000003 3300005355 Bacteria 270186
20 Ga0070671_100008715 3300005355 Bacteria 8138
21 Ga0070671_100552860 3300005355 Bacteria 993
22 Ga0070667_100000596 3300005367 Bacteria 35305
23 Ga0070667_100001888 3300005367 Bacteria 18600
24 Ga0070667_100388172 3300005367 Bacteria 1269
25 Ga0070667_100418448 3300005367 Bacteria 1221
26 Ga0070667_100618519 3300005367 Bacteria 999
27 Ga0070705_100044034 3300005440 Bacteria 2562
28 Ga0070663_100680152 3300005455 Bacteria 873
29 Ga0070707_100339145 3300005468 Bacteria 1460
30 Ga0070679_100004124 3300005530 Bacteria 13399
31 Ga0070679_100020808 3300005530 Bacteria 6399
32 Ga0070679_100223094 3300005530 Bacteria 1845
33 Ga0070679_100392011 3300005530 Bacteria 1335
34 Ga0070684_101424066 3300005535 Bacteria 653
35 Ga0070665_100004063 3300005548 Bacteria 15396
36 Ga0070665_100321180 3300005548 Bacteria 1552
37 Ga0068855_100003943 3300005563 Bacteria 18111
38 Ga0068855_100044402 3300005563 Bacteria 5259
39 Ga0068855_101187969 3300005563 Bacteria 794
40 Ga0068852_100104768 3300005616 Bacteria 2561
41 Ga0068859_100091034 3300005617 Bacteria 3101
42 Ga0068859_100346406 3300005617 Bacteria 1580
43 Ga0068859_103178335 3300005617 Bacteria 500
44 Ga0068864_100158984 3300005618 Bacteria 2053
45 Ga0068863_100005101 3300005841 Bacteria 12954
46 Ga0068858_100003668 3300005842 Bacteria 15206
47 Ga0068858_100130059 3300005842 Bacteria 2360
48 Ga0068858_100292134 3300005842 Bacteria 1554
49 Ga0068860_100018416 3300005843 Bacteria 6793
50 Ga0068860_100024198 3300005843 Bacteria 5872
51 Ga0068860_100026435 3300005843 Bacteria 5595
52 Ga0068860_100073275 3300005843 Bacteria 3255
53 Ga0068862_100075760 3300005844 Bacteria 2911
54 Ga0068862_100567067 3300005844 Bacteria 1086
55 Ga0075365_10072164 3300006038 Bacteria 2325
56 Ga0075363_100005460 3300006048 Bacteria 5658
57 Ga0075363_100025154 3300006048 Bacteria 3033
58 Ga0075362_10000033 3300006177 Bacteria 50782
59 Ga0075362_10001290 3300006177 Bacteria 7936
60 Ga0075367_10032202 3300006178 Bacteria 3015
61 Ga0075367_10084541 3300006178 Bacteria 1924
62 Ga0075369_10009867 3300006186 Bacteria 3724
63 Ga0075369_10185316 3300006186 Bacteria 958
64 Ga0075366_10000058 3300006195 Bacteria 40618
65 Ga0075366_10112277 3300006195 Unclassified 1640
66 Ga0075370_10000139 3300006353 Bacteria 24533
67 Ga0097620_100091033 3300006931 Bacteria 3101
68 Ga0097620_100346417 3300006931 Bacteria 1580
69 Ga0097620_103176856 3300006931 Bacteria 500
70 Ga0105251_10145566 3300009011 Bacteria 1071
71 Ga0105250_10008207 3300009092 Bacteria 4445
72 Ga0105240_11514592 3300009093 Bacteria 703
73 Ga0105247_10185694 3300009101 Bacteria 1390
74 Ga0105247_10287910 3300009101 Bacteria 1135
75 Ga0105241_11210077 3300009174 Bacteria 716
76 Ga0105248_10035903 3300009177 Bacteria 5544
77 Ga0105248_10060330 3300009177 Bacteria 4258
78 Ga0105248_10226064 3300009177 Bacteria 2106
79 Ga0105248_10254607 3300009177 Bacteria 1976
80 Ga0105248_10909316 3300009177 Bacteria 994
81 Ga0105249_10071480 3300009553 Bacteria 3206
82 Ga0105249_10151237 3300009553 Bacteria 2235
83 Ga0105239_10834503 3300010375 Bacteria 1056
84 Ga0157371_10121245 3300013102 Bacteria 1859
85 Ga0163162_10075148 3300013306 Bacteria 3439
86 Ga0157379_11299013 3300014968 Bacteria 702
87 Ga0209050_1000924 3300025298 Bacteria 38702
88 Ga0207696_1005004 3300025711 Bacteria 5585
89 Ga0207713_1012386 3300025735 Bacteria 4566
90 Ga0207680_10062523 3300025903 Bacteria 2275
91 Ga0207680_10411243 3300025903 Bacteria 957
92 Ga0207705_10001064 3300025909 Bacteria 22327
93 Ga0207705_10096504 3300025909 Bacteria 2170
94 Ga0207705_10667443 3300025909 Bacteria 808
95 Ga0207660_10179171 3300025917 Bacteria 1645
96 Ga0207657_10009136 3300025919 Bacteria 10001
97 Ga0207657_10586726 3300025919 Bacteria 870
98 Ga0207657_10924205 3300025919 Bacteria 672
99 Ga0207657_11125704 3300025919 Bacteria 599
100 Ga0207652_10058594 3300025921 Bacteria 3318
101 Ga0207652_10111475 3300025921 Bacteria 2426
102 Ga0207652_10145297 3300025921 Bacteria 2122
103 Ga0207652_10356442 3300025921 Bacteria 1320
104 Ga0207652_10621645 3300025921 Bacteria 967
105 Ga0207646_10287817 3300025922 Bacteria 1485
106 Ga0207681_10001389 3300025923 Bacteria 15634
107 Ga0207681_10001632 3300025923 Bacteria 14465
108 Ga0207644_10006574 3300025931 Bacteria 7573
109 Ga0207644_10034098 3300025931 Bacteria 3562
110 Ga0207644_10440059 3300025931 Bacteria 1070
111 Ga0207690_10160590 3300025932 Unclassified 1675
112 Ga0207690_10522234 3300025932 Bacteria 962
113 Ga0207711_10109617 3300025941 Bacteria 2453
114 Ga0207711_10137724 3300025941 Bacteria 2194
115 Ga0207711_10272209 3300025941 Bacteria 1558
116 Ga0207711_10398139 3300025941 Bacteria 1279
117 Ga0207711_10724042 3300025941 Bacteria 928
118 Ga0207667_10012325 3300025949 Bacteria 9861
119 Ga0207667_10025766 3300025949 Bacteria 6433
120 Ga0207667_10641704 3300025949 Bacteria 1068
121 Ga0207712_10011598 3300025961 Bacteria 5619
122 Ga0207712_10092955 3300025961 Bacteria 2224
123 Ga0207668_10060962 3300025972 Bacteria 2650
124 Ga0207658_10001159 3300025986 Bacteria 21112
125 Ga0207658_10006559 3300025986 Bacteria 7937
126 Ga0207658_10396067 3300025986 Bacteria 1213
127 Ga0207658_10542279 3300025986 Bacteria 1040
128 Ga0207703_10001372 3300026035 Bacteria 22250
129 Ga0207703_10064656 3300026035 Bacteria 3004
130 Ga0207703_10116409 3300026035 Bacteria 2288
131 Ga0207678_10069155 3300026067 Bacteria 3028
132 Ga0207678_10077426 3300026067 Bacteria 2848
133 Ga0207678_10096627 3300026067 Bacteria 2524
134 Ga0207702_10864501 3300026078 Bacteria 895
135 Ga0207641_10005768 3300026088 Bacteria 10516
136 Ga0207676_10174867 3300026095 Bacteria 1874
137 Ga0207698_10176420 3300026142 Bacteria 1888
138 Ga0209813_10000081 3300027866 Bacteria 35059
139 Ga0209974_10011025 3300027876 Bacteria 3043
140 Ga0268266_10014912 3300028379 Bacteria 6674
141 Ga0268265_10056447 3300028380 Bacteria 2987
142 Ga0268264_10006783 3300028381 Bacteria 9618
143 Ga0268264_10034093 3300028381 Bacteria 4186
144 Ga0268264_10215525 3300028381 Bacteria 1765
145 Ga0307508_10041096 3300031616 Bacteria 4151
146 Ga0307405_10076231 3300031731 Bacteria 2175
147 Ga0307413_10282808 3300031824 Bacteria 1249
148 Ga0307412_10117433 3300031911 Bacteria 1910
149 Ga0307409_100195774 3300031995 Bacteria 1804
150 Ga0373932_0049822 3300035112 Bacteria 1239
151 Ga0373953_0258262 3300035117 Bacteria 758
152 Ga0373946_0072105 3300035171 Bacteria 1494
153 Ga0373931_0020597 3300035691 Bacteria 3301
154 Ga0373927_0073121 3300035695 Bacteria 2220
155 Ga0373947_0038300 3300035725 Bacteria 2848
156 Ga0316582_0509953 3300036647 Bacteria 829
157 Ga0316584_0363417 3300036712 Bacteria 1037
158 Ga0373925_0156912 3300037068 Bacteria 1790
159 Ga0451833_1339892 3300041491 Bacteria 1214
160 Ga0453684_0462864 3300044712 Bacteria 1410
161 Ga0451576_0000007 3300045051 Bacteria 782228
162 Ga0495627_002345 3300046453 Bacteria 9260
163 Ga0495650_0003966 3300046471 Bacteria 10402
164 Ga0495596_0000040 3300046500 Bacteria 93322
165 Ga0495596_0001722 3300046500 Bacteria 12303
166 Ga0495607_0009588 3300046501 Bacteria 6543
167 Ga0495583_0059233 3300046506 Bacteria 1717
168 Ga0495606_0087704 3300046507 Bacteria 1920
169 Ga0495610_0000015 3300046512 Bacteria 391489
170 Ga0495610_0001956 3300046512 Bacteria 17724
171 Ga0495610_0010248 3300046512 Bacteria 5841
172 Ga0495616_0063440 3300046513 Bacteria 1806
173 Ga0495620_0023001 3300046515 Bacteria 2989
174 Ga0495620_0103149 3300046515 Bacteria 1135
175 Ga0495632_0000216 3300046519 Bacteria 58320
176 Ga0495632_0081962 3300046519 Bacteria 1538
177 Ga0495643_0000201 3300046522 Bacteria 93295
178 Ga0495643_0003554 3300046522 Bacteria 11336
179 Ga0495643_0024747 3300046522 Bacteria 3403
180 Ga0495643_0226135 3300046522 Bacteria 885
181 Ga0495609_0009827 3300046538 Bacteria 4614
182 Ga0495633_0117860 3300046558 Bacteria 1230
183 Ga0495668_0300289 3300046616 Bacteria 880
184 Ga0495625_0012709 3300046660 Bacteria 6810
185 Ga0495625_0104416 3300046660 Bacteria 1942
186 Ga0495671_0332043 3300046692 Bacteria 730
187 Ga0495681_0000207 3300047470 Bacteria 48809
188 Ga0495681_0284163 3300047470 Bacteria 644
189 Ga0495615_0000279 3300048090 Bacteria 9418
190 Ga0495626_0000877 3300048091 Bacteria 26762
191 Ga0496100_0247523 3300048903 Bacteria 1317
192 Ga0496101_0136243 3300048904 Bacteria 1868
193 Ga0496102_0001054 3300048905 Bacteria 25520
194 Ga0496103_0000289 3300048906 Bacteria 47033
195 Ga0496104_0000474 3300048907 Bacteria 34558
196 Ga0496105_0442118 3300048908 Bacteria 1027
197 Ga0496107_0095193 3300048910 Bacteria 2179
198 Ga0496108_0097491 3300048911 Bacteria 2505
199 Ga0496109_0895075 3300048912 Bacteria 825
200 Ga0496110_0513381 3300048913 Bacteria 1090
201 Ga0496110_1470357 3300048913 Bacteria 591
202 Ga0496111_0132455 3300048914 Bacteria 1845
203 Ga0496111_0138921 3300048914 Bacteria 1800
204 Ga0496112_0589891 3300048915 Bacteria 1043
205 Ga0496113_0018727 3300048916 Bacteria 4827
206 Ga0496113_0298981 3300048916 Bacteria 1289
207 Ga0496114_0312298 3300048917 Bacteria 1388
208 Ga0496115_0154846 3300048918 Bacteria 1893
209 Ga0496115_0165613 3300048918 Bacteria 1828
210 Ga0496116_0000062 3300048919 Bacteria 271104
211 Ga0496117_0004523 3300048920 Bacteria 15262
212 Ga0496118_0004825 3300048921 Bacteria 15724
213 Ga0496119_0009738 3300048922 Bacteria 8181
214 Ga0496120_0008930 3300048923 Bacteria 7178
215 Ga0496121_0006782 3300048924 Bacteria 14038
216 Ga0496121_0057301 3300048924 Bacteria 3230
217 Ga0496121_0698553 3300048924 Bacteria 611
218 Ga0496122_0002883 3300048925 Bacteria 23539
219 Ga0496122_0005558 3300048925 Bacteria 14935
220 Ga0496122_0033342 3300048925 Bacteria 4237
221 Ga0496122_0160162 3300048925 Bacteria 1374
222 Ga0496122_0379237 3300048925 Bacteria 726
223 Ga0496123_0001993 3300048926 Bacteria 26408
224 Ga0496123_0007196 3300048926 Bacteria 10559
225 Ga0496123_0041482 3300048926 Bacteria 3189
226 Ga0496124_0000441 3300048927 Bacteria 73415
227 Ga0496124_0015561 3300048927 Bacteria 7284
228 Ga0496124_0023902 3300048927 Bacteria 5566
229 Ga0496124_0065910 3300048927 Bacteria 3018
230 Ga0496125_0009916 3300048928 Bacteria 9686
231 Ga0496125_0062486 3300048928 Bacteria 2977
232 Ga0496126_0000637 3300048929 Bacteria 65311
233 Ga0496126_0000802 3300048929 Bacteria 56265
234 Ga0496126_0002207 3300048929 Bacteria 26960
235 Ga0496126_0097975 3300048929 Bacteria 2569
236 Ga0501032_0317602 3300049569 Bacteria 1006
237 Ga0501034_0349586 3300049571 Bacteria 1407
238 Ga0501036_0560372 3300049572 Bacteria 949
239 Ga0501037_0585939 3300049573 Bacteria 750
240 Ga0501039_0205164 3300049575 Bacteria 1550
241 Ga0501047_0207951 3300049581 Bacteria 1816
242 Ga0501044_0110516 3300049823 Bacteria 2757
243 nmdc:mga03683_32_c1 3300050489 Bacteria 68182
244 nmdc:mga03683_41155_c1 3300050489 Bacteria 1898
245 nmdc:mga03683_67348_c1 3300050489 Bacteria 1524
246 nmdc:mga03n38_6055_c1 3300050490 Bacteria 3842
247 nmdc:mga00v17_1556_c1 3300050491 Bacteria 11982
248 nmdc:mga0k408_17456_c1 3300050493 Bacteria 3999
249 nmdc:mga0k408_7_c1 3300050493 Bacteria 164270
250 nmdc:mga06z11_904_c1 3300050494 Bacteria 10791
251 nmdc:mga04h51_172_c1 3300050495 Bacteria 18653
252 nmdc:mga07m45_100224_c1 3300050496 Bacteria 1663
253 nmdc:mga07m45_15_c1 3300050496 Bacteria 152740
254 nmdc:mga07m45_3_c1 3300050496 Bacteria 421414
255 nmdc:mga07m45_41346_c1 3300050496 Bacteria 2581
256 nmdc:mga0sz30_32775_c1 3300050516 Bacteria 2156
257 nmdc:mga0sz30_36047_c1 3300050516 Bacteria 2067
258 Ga0500607_001731 3300053121 Bacteria 18963
259 Ga0500590_067018 3300053148 Bacteria 1791
260 Ga0500636_0369786 3300053177 Unclassified 677
261 Ga0500645_003023 3300053730 Bacteria 7095

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049569 Ga0501032_0317602 Ga0501032_0317602_512_979 132
2 3300031731 Ga0307405_10076231 Ga0307405_100762314 139
3 3300031911 Ga0307412_10117433 Ga0307412_101174333 139
4 3300049573 Ga0501037_0585939 Ga0501037_0585939_299_724 140
5 iso_pu_bacteria 2510917021 2511129462 142
6 iso_pu_bacteria 3000865235 3000865331 142
7 iso_pu_bacteria 8054302542 8054305369 142
8 3300005468 Ga0070707_100339145 Ga0070707_1003391453 143
9 3300025922 Ga0207646_10287817 Ga0207646_102878171 143
10 3300025961 Ga0207712_10092955 Ga0207712_100929552 143
11 iso_pu_bacteria 2643221588 2643948661 143
12 iso_pu_bacteria 2818991438 2819554109 143
13 3300031824 Ga0307413_10282808 Ga0307413_102828083 145
14 3300031995 Ga0307409_100195774 Ga0307409_1001957741 145
15 3300005327 Ga0070658_10079120 Ga0070658_100791204 146
16 3300005339 Ga0070660_100044715 Ga0070660_1000447154 146
17 3300005339 Ga0070660_101272617 Ga0070660_1012726171 146
18 3300005353 Ga0070669_100547789 Ga0070669_1005477893 146
19 3300005367 Ga0070667_100001888 Ga0070667_10000188814 146
20 3300005367 Ga0070667_100418448 Ga0070667_1004184482 146
21 3300005455 Ga0070663_100680152 Ga0070663_1006801522 146
22 3300005530 Ga0070679_100004124 Ga0070679_10000412417 146
23 3300005530 Ga0070679_100020808 Ga0070679_1000208082 146
24 3300005530 Ga0070679_100223094 Ga0070679_1002230941 146
25 3300005530 Ga0070679_100392011 Ga0070679_1003920113 146
26 3300005535 Ga0070684_101424066 Ga0070684_1014240661 146
27 3300005563 Ga0068855_101187969 Ga0068855_1011879692 146
28 3300005617 Ga0068859_103178335 Ga0068859_1031783351 146
29 3300005841 Ga0068863_100005101 Ga0068863_10000510112 146
30 3300005842 Ga0068858_100130059 Ga0068858_1001300593 146
31 3300005843 Ga0068860_100073275 Ga0068860_1000732752 146
32 3300006186 Ga0075369_10185316 Ga0075369_101853161 146
33 3300006195 Ga0075366_10112277 Ga0075366_101122772 146
34 3300006931 Ga0097620_103176856 Ga0097620_1031768561 146
35 3300009177 Ga0105248_10254607 Ga0105248_102546071 146
36 3300013102 Ga0157371_10121245 Ga0157371_101212453 146
37 3300025909 Ga0207705_10001064 Ga0207705_1000106417 146
38 3300025909 Ga0207705_10096504 Ga0207705_100965043 146
39 3300025917 Ga0207660_10179171 Ga0207660_101791712 146
40 3300025919 Ga0207657_10009136 Ga0207657_100091366 146
41 3300025919 Ga0207657_10586726 Ga0207657_105867262 146
42 3300025919 Ga0207657_10924205 Ga0207657_109242052 146
43 3300025919 Ga0207657_11125704 Ga0207657_111257042 146
44 3300025921 Ga0207652_10058594 Ga0207652_100585943 146
45 3300025921 Ga0207652_10111475 Ga0207652_101114753 146
46 3300025921 Ga0207652_10145297 Ga0207652_101452974 146
47 3300025921 Ga0207652_10356442 Ga0207652_103564422 146
48 3300025921 Ga0207652_10621645 Ga0207652_106216452 146
49 3300025931 Ga0207644_10034098 Ga0207644_100340985 146
50 3300025932 Ga0207690_10160590 Ga0207690_101605902 146
51 3300025932 Ga0207690_10522234 Ga0207690_105222342 146
52 3300025941 Ga0207711_10137724 Ga0207711_101377242 146
53 3300025949 Ga0207667_10641704 Ga0207667_106417043 146
54 3300025986 Ga0207658_10006559 Ga0207658_1000655911 146
55 3300025986 Ga0207658_10542279 Ga0207658_105422793 146
56 3300026035 Ga0207703_10064656 Ga0207703_100646564 146
57 3300026067 Ga0207678_10069155 Ga0207678_100691555 146
58 3300026067 Ga0207678_10077426 Ga0207678_100774262 146
59 3300026067 Ga0207678_10096627 Ga0207678_100966271 146
60 3300026088 Ga0207641_10005768 Ga0207641_100057686 146
61 3300027876 Ga0209974_10011025 Ga0209974_100110256 146
62 3300028381 Ga0268264_10034093 Ga0268264_100340932 146
63 3300035112 Ga0373932_0049822 Ga0373932_0049822_668_1108 146
64 3300046453 Ga0495627_002345 Ga0495627_002345_115_567 146
65 3300046471 Ga0495650_0003966 Ga0495650_0003966_8562_9014 146
66 3300046500 Ga0495596_0000040 Ga0495596_0000040_54880_55320 146
67 3300046501 Ga0495607_0009588 Ga0495607_0009588_3150_3608 146
68 3300046506 Ga0495583_0059233 Ga0495583_0059233_518_958 146
69 3300046512 Ga0495610_0000015 Ga0495610_0000015_358427_358879 146
70 3300046512 Ga0495610_0010248 Ga0495610_0010248_736_1197 146
71 3300046513 Ga0495616_0063440 Ga0495616_0063440_117_560 146
72 3300046515 Ga0495620_0023001 Ga0495620_0023001_1861_2313 146
73 3300046515 Ga0495620_0103149 Ga0495620_0103149_596_1048 146
74 3300046519 Ga0495632_0000216 Ga0495632_0000216_18814_19254 146
75 3300046519 Ga0495632_0081962 Ga0495632_0081962_187_627 146
76 3300046522 Ga0495643_0000201 Ga0495643_0000201_1565_2026 146
77 3300046522 Ga0495643_0003554 Ga0495643_0003554_9852_10310 146
78 3300046522 Ga0495643_0024747 Ga0495643_0024747_1602_2042 146
79 3300046538 Ga0495609_0009827 Ga0495609_0009827_1829_2269 146
80 3300046558 Ga0495633_0117860 Ga0495633_0117860_748_1209 146
81 3300046616 Ga0495668_0300289 Ga0495668_0300289_126_566 146
82 3300046660 Ga0495625_0012709 Ga0495625_0012709_4368_4808 146
83 3300046660 Ga0495625_0104416 Ga0495625_0104416_638_1078 146
84 3300046692 Ga0495671_0332043 Ga0495671_0332043_275_715 146
85 3300047470 Ga0495681_0000207 Ga0495681_0000207_17048_17500 146
86 3300047470 Ga0495681_0284163 Ga0495681_0284163_95_535 146
87 3300048090 Ga0495615_0000279 Ga0495615_0000279_8887_9330 146
88 3300048908 Ga0496105_0442118 Ga0496105_0442118_523_966 146
89 3300048913 Ga0496110_1470357 Ga0496110_1470357_121_564 146
90 3300048925 Ga0496122_0002883 Ga0496122_0002883_1928_2368 146
91 3300048926 Ga0496123_0007196 Ga0496123_0007196_8232_8672 146
92 3300048927 Ga0496124_0065910 Ga0496124_0065910_718_1158 146
93 3300048929 Ga0496126_0097975 Ga0496126_0097975_504_947 146
94 3300049571 Ga0501034_0349586 Ga0501034_0349586_492_938 146
95 3300049572 Ga0501036_0560372 Ga0501036_0560372_63_509 146
96 3300049575 Ga0501039_0205164 Ga0501039_0205164_427_873 146
97 3300049581 Ga0501047_0207951 Ga0501047_0207951_58_504 146
98 3300049823 Ga0501044_0110516 Ga0501044_0110516_1090_1536 146
99 3300050489 nmdc:mga03683_67348_c1 nmdc:mga03683_67348_c1_45_491 146
100 3300050516 nmdc:mga0sz30_32775_c1 nmdc:mga0sz30_32775_c1_1637_2083 146
101 3300053148 Ga0500590_067018 Ga0500590_067018_233_673 146
102 3300002074 JGI24748J21848_1002266 JGI24748J21848_10022664 147
103 3300002459 JGI24751J29686_10000070 JGI24751J29686_1000007055 147
104 3300003791 Ga0055530_10021415 Ga0055530_100214151 147
105 3300005289 Ga0065704_10070490 Ga0065704_1007049014 147
106 3300005295 Ga0065707_10084843 Ga0065707_100848435 147
107 3300005330 Ga0070690_100111694 Ga0070690_1001116943 147
108 3300005331 Ga0070670_100212286 Ga0070670_1002122863 147
109 3300005335 Ga0070666_10013849 Ga0070666_100138493 147
110 3300005335 Ga0070666_10073352 Ga0070666_100733522 147
111 3300005335 Ga0070666_11101893 Ga0070666_111018931 147
112 3300005347 Ga0070668_100367274 Ga0070668_1003672743 147
113 3300005347 Ga0070668_100958886 Ga0070668_1009588861 147
114 3300005353 Ga0070669_100000492 Ga0070669_10000049219 147
115 3300005353 Ga0070669_100001266 Ga0070669_1000012668 147
116 3300005355 Ga0070671_100000003 Ga0070671_10000000385 147
117 3300005355 Ga0070671_100008715 Ga0070671_1000087158 147
118 3300005355 Ga0070671_100552860 Ga0070671_1005528602 147
119 3300005367 Ga0070667_100000596 Ga0070667_10000059622 147
120 3300005367 Ga0070667_100388172 Ga0070667_1003881723 147
121 3300005367 Ga0070667_100618519 Ga0070667_1006185191 147
122 3300005440 Ga0070705_100044034 Ga0070705_1000440342 147
123 3300005548 Ga0070665_100004063 Ga0070665_10000406315 147
124 3300005548 Ga0070665_100321180 Ga0070665_1003211803 147
125 3300005563 Ga0068855_100003943 Ga0068855_1000039438 147
126 3300005563 Ga0068855_100044402 Ga0068855_1000444023 147
127 3300005616 Ga0068852_100104768 Ga0068852_1001047683 147
128 3300005617 Ga0068859_100091034 Ga0068859_1000910346 147
129 3300005617 Ga0068859_100346406 Ga0068859_1003464063 147
130 3300005618 Ga0068864_100158984 Ga0068864_1001589843 147
131 3300005842 Ga0068858_100003668 Ga0068858_1000036686 147
132 3300005842 Ga0068858_100292134 Ga0068858_1002921342 147
133 3300005843 Ga0068860_100018416 Ga0068860_1000184168 147
134 3300005843 Ga0068860_100024198 Ga0068860_1000241983 147
135 3300005843 Ga0068860_100026435 Ga0068860_1000264352 147
136 3300005844 Ga0068862_100075760 Ga0068862_1000757606 147
137 3300005844 Ga0068862_100567067 Ga0068862_1005670672 147
138 3300006038 Ga0075365_10072164 Ga0075365_100721643 147
139 3300006048 Ga0075363_100005460 Ga0075363_1000054607 147
140 3300006048 Ga0075363_100025154 Ga0075363_1000251543 147
141 3300006177 Ga0075362_10000033 Ga0075362_1000003320 147
142 3300006177 Ga0075362_10001290 Ga0075362_100012908 147
143 3300006178 Ga0075367_10032202 Ga0075367_100322023 147
144 3300006178 Ga0075367_10084541 Ga0075367_100845413 147
145 3300006186 Ga0075369_10009867 Ga0075369_100098675 147
146 3300006195 Ga0075366_10000058 Ga0075366_1000005820 147
147 3300006353 Ga0075370_10000139 Ga0075370_1000013926 147
148 3300006931 Ga0097620_100091033 Ga0097620_1000910331 147
149 3300006931 Ga0097620_100346417 Ga0097620_1003464172 147
150 3300009011 Ga0105251_10145566 Ga0105251_101455662 147
151 3300009092 Ga0105250_10008207 Ga0105250_100082077 147
152 3300009093 Ga0105240_11514592 Ga0105240_115145922 147
153 3300009101 Ga0105247_10185694 Ga0105247_101856942 147
154 3300009101 Ga0105247_10287910 Ga0105247_102879103 147
155 3300009174 Ga0105241_11210077 Ga0105241_112100771 147
156 3300009177 Ga0105248_10035903 Ga0105248_100359033 147
157 3300009177 Ga0105248_10060330 Ga0105248_100603307 147
158 3300009177 Ga0105248_10226064 Ga0105248_102260643 147
159 3300009177 Ga0105248_10909316 Ga0105248_109093163 147
160 3300009553 Ga0105249_10071480 Ga0105249_100714805 147
161 3300009553 Ga0105249_10151237 Ga0105249_101512373 147
162 3300010375 Ga0105239_10834503 Ga0105239_108345031 147
163 3300013306 Ga0163162_10075148 Ga0163162_100751485 147
164 3300014968 Ga0157379_11299013 Ga0157379_112990131 147
165 3300025298 Ga0209050_1000924 Ga0209050_100092436 147
166 3300025711 Ga0207696_1005004 Ga0207696_10050048 147
167 3300025735 Ga0207713_1012386 Ga0207713_10123867 147
168 3300025903 Ga0207680_10062523 Ga0207680_100625232 147
169 3300025903 Ga0207680_10411243 Ga0207680_104112433 147
170 3300025909 Ga0207705_10667443 Ga0207705_106674431 147
171 3300025923 Ga0207681_10001389 Ga0207681_100013891 147
172 3300025923 Ga0207681_10001632 Ga0207681_100016323 147
173 3300025931 Ga0207644_10006574 Ga0207644_100065744 147
174 3300025931 Ga0207644_10440059 Ga0207644_104400592 147
175 3300025941 Ga0207711_10109617 Ga0207711_101096173 147
176 3300025941 Ga0207711_10272209 Ga0207711_102722093 147
177 3300025941 Ga0207711_10398139 Ga0207711_103981392 147
178 3300025941 Ga0207711_10724042 Ga0207711_107240421 147
179 3300025949 Ga0207667_10012325 Ga0207667_100123253 147
180 3300025949 Ga0207667_10025766 Ga0207667_100257668 147
181 3300025961 Ga0207712_10011598 Ga0207712_100115988 147
182 3300025972 Ga0207668_10060962 Ga0207668_100609622 147
183 3300025986 Ga0207658_10001159 Ga0207658_1000115915 147
184 3300025986 Ga0207658_10396067 Ga0207658_103960673 147
185 3300026035 Ga0207703_10001372 Ga0207703_1000137213 147
186 3300026035 Ga0207703_10116409 Ga0207703_101164093 147
187 3300026078 Ga0207702_10864501 Ga0207702_108645012 147
188 3300026095 Ga0207676_10174867 Ga0207676_101748673 147
189 3300026142 Ga0207698_10176420 Ga0207698_101764202 147
190 3300027866 Ga0209813_10000081 Ga0209813_1000008122 147
191 3300028379 Ga0268266_10014912 Ga0268266_100149124 147
192 3300028380 Ga0268265_10056447 Ga0268265_100564476 147
193 3300028381 Ga0268264_10006783 Ga0268264_100067838 147
194 3300028381 Ga0268264_10215525 Ga0268264_102155253 147
195 3300031616 Ga0307508_10041096 Ga0307508_100410966 147
196 3300035117 Ga0373953_0258262 Ga0373953_0258262_203_664 147
197 3300035171 Ga0373946_0072105 Ga0373946_0072105_798_1259 147
198 3300035691 Ga0373931_0020597 Ga0373931_0020597_1024_1470 147
199 3300035695 Ga0373927_0073121 Ga0373927_0073121_509_970 147
200 3300035725 Ga0373947_0038300 Ga0373947_0038300_129_590 147
201 3300036647 Ga0316582_0509953 Ga0316582_0509953_105_551 147
202 3300036712 Ga0316584_0363417 Ga0316584_0363417_106_552 147
203 3300037068 Ga0373925_0156912 Ga0373925_0156912_700_1161 147
204 3300041491 Ga0451833_1339892 Ga0451833_1339892_733_1203 147
205 3300044712 Ga0453684_0462864 Ga0453684_0462864_132_584 147
206 3300045051 Ga0451576_0000007 Ga0451576_0000007_638258_638707 147
207 3300046500 Ga0495596_0001722 Ga0495596_0001722_8258_8704 147
208 3300046507 Ga0495606_0087704 Ga0495606_0087704_1236_1682 147
209 3300046512 Ga0495610_0001956 Ga0495610_0001956_9395_9841 147
210 3300046522 Ga0495643_0226135 Ga0495643_0226135_244_690 147
211 3300048091 Ga0495626_0000877 Ga0495626_0000877_7858_8304 147
212 3300048903 Ga0496100_0247523 Ga0496100_0247523_363_821 147
213 3300048904 Ga0496101_0136243 Ga0496101_0136243_853_1311 147
214 3300048905 Ga0496102_0001054 Ga0496102_0001054_9219_9677 147
215 3300048906 Ga0496103_0000289 Ga0496103_0000289_9198_9656 147
216 3300048907 Ga0496104_0000474 Ga0496104_0000474_33107_33565 147
217 3300048910 Ga0496107_0095193 Ga0496107_0095193_1477_1935 147
218 3300048911 Ga0496108_0097491 Ga0496108_0097491_1539_1985 147
219 3300048912 Ga0496109_0895075 Ga0496109_0895075_95_541 147
220 3300048913 Ga0496110_0513381 Ga0496110_0513381_317_763 147
221 3300048914 Ga0496111_0132455 Ga0496111_0132455_637_1083 147
222 3300048914 Ga0496111_0138921 Ga0496111_0138921_990_1436 147
223 3300048915 Ga0496112_0589891 Ga0496112_0589891_547_993 147
224 3300048916 Ga0496113_0018727 Ga0496113_0018727_4206_4664 147
225 3300048916 Ga0496113_0298981 Ga0496113_0298981_616_1062 147
226 3300048917 Ga0496114_0312298 Ga0496114_0312298_678_1124 147
227 3300048918 Ga0496115_0154846 Ga0496115_0154846_1073_1519 147
228 3300048918 Ga0496115_0165613 Ga0496115_0165613_1095_1553 147
229 3300048919 Ga0496116_0000062 Ga0496116_0000062_96286_96732 147
230 3300048920 Ga0496117_0004523 Ga0496117_0004523_5586_6044 147
231 3300048921 Ga0496118_0004825 Ga0496118_0004825_10865_11323 147
232 3300048922 Ga0496119_0009738 Ga0496119_0009738_6459_6917 147
233 3300048923 Ga0496120_0008930 Ga0496120_0008930_612_1070 147
234 3300048924 Ga0496121_0006782 Ga0496121_0006782_5220_5666 147
235 3300048924 Ga0496121_0057301 Ga0496121_0057301_101_559 147
236 3300048924 Ga0496121_0698553 Ga0496121_0698553_103_561 147
237 3300048925 Ga0496122_0005558 Ga0496122_0005558_5795_6241 147
238 3300048925 Ga0496122_0033342 Ga0496122_0033342_3503_3961 147
239 3300048925 Ga0496122_0160162 Ga0496122_0160162_757_1221 147
240 3300048925 Ga0496122_0379237 Ga0496122_0379237_112_558 147
241 3300048926 Ga0496123_0001993 Ga0496123_0001993_8618_9064 147
242 3300048926 Ga0496123_0041482 Ga0496123_0041482_2455_2913 147
243 3300048927 Ga0496124_0000441 Ga0496124_0000441_28454_28900 147
244 3300048927 Ga0496124_0015561 Ga0496124_0015561_1158_1604 147
245 3300048927 Ga0496124_0023902 Ga0496124_0023902_1333_1797 147
246 3300048928 Ga0496125_0009916 Ga0496125_0009916_8281_8727 147
247 3300048928 Ga0496125_0062486 Ga0496125_0062486_2065_2523 147
248 3300048929 Ga0496126_0000637 Ga0496126_0000637_18308_18754 147
249 3300048929 Ga0496126_0000802 Ga0496126_0000802_9975_10433 147
250 3300048929 Ga0496126_0002207 Ga0496126_0002207_4483_4929 147
251 3300050489 nmdc:mga03683_32_c1 nmdc:mga03683_32_c1_52453_52899 147
252 3300050489 nmdc:mga03683_41155_c1 nmdc:mga03683_41155_c1_1342_1794 147
253 3300050490 nmdc:mga03n38_6055_c1 nmdc:mga03n38_6055_c1_216_662 147
254 3300050491 nmdc:mga00v17_1556_c1 nmdc:mga00v17_1556_c1_4582_5034 147
255 3300050493 nmdc:mga0k408_17456_c1 nmdc:mga0k408_17456_c1_2836_3288 147
256 3300050493 nmdc:mga0k408_7_c1 nmdc:mga0k408_7_c1_140194_140640 147
257 3300050494 nmdc:mga06z11_904_c1 nmdc:mga06z11_904_c1_6773_7225 147
258 3300050495 nmdc:mga04h51_172_c1 nmdc:mga04h51_172_c1_5708_6160 147
259 3300050496 nmdc:mga07m45_100224_c1 nmdc:mga07m45_100224_c1_506_964 147
260 3300050496 nmdc:mga07m45_15_c1 nmdc:mga07m45_15_c1_44288_44740 147
261 3300050496 nmdc:mga07m45_3_c1 nmdc:mga07m45_3_c1_61879_62325 147
262 3300050496 nmdc:mga07m45_41346_c1 nmdc:mga07m45_41346_c1_1832_2278 147
263 3300050516 nmdc:mga0sz30_36047_c1 nmdc:mga0sz30_36047_c1_483_935 147
264 3300053121 Ga0500607_001731 Ga0500607_001731_9718_10176 147
265 3300053177 Ga0500636_0369786 Ga0500636_0369786_123_581 147
266 3300053730 Ga0500645_003023 Ga0500645_003023_4307_4762 147

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02391

MoaE

MoaE protein

6

119

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nvi-assembly1.cif.gz_E-2 orthorhombic crystal form of molybdopterin synthase 0.8904 1 145
1nvi-assembly1.cif.gz_E-2 orthorhombic crystal form of molybdopterin synthase 0.8846 1 145
2omd-assembly1.cif.gz_A crystal structure of molybdopterin converting factor subunit 2 (aq_2181) from aquifex aeolicus vf5 0.8819 28 125
1nvj-assembly1.cif.gz_A deletion mutant (delta 141) of molybdopterin synthase 0.8666 1 123
1nvj-assembly1.cif.gz_B deletion mutant (delta 141) of molybdopterin synthase 0.8631 1 122
ID Description Score Start End Superfamily
1fmaE00 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.8948 1 145 3.90.1170.40
1fmaE00 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.889 1 145 3.90.1170.40
2omdA00 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.8819 28 125 3.90.1170.40
af_P9WJR1_4_141_3.90.1170.40 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.8508 7 133 3.90.1170.40
1nvjC00 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.8443 1 123 3.90.1170.40
ID Description Score Start End GO Terms
AF-A0A4Q5SDT8-F1-model_v4 Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (MPT synthase subunit 2) (Molybdenum cofactor biosynthesis protein E) (Molybdopterin-converting factor large subunit) (Molybdopterin-converting factor subunit 2) 0.9448 2 104 GO:0006777
GO:0030366
AF-A0A437H1P9-F1-model_v4 Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (MPT synthase subunit 2) (Molybdenum cofactor biosynthesis protein E) (Molybdopterin-converting factor large subunit) (Molybdopterin-converting factor subunit 2) 0.9437 3 145 GO:0006777
GO:0030366
AF-A0A3D1P0E0-F1-model_v4 Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (MPT synthase subunit 2) (Molybdenum cofactor biosynthesis protein E) (Molybdopterin-converting factor large subunit) (Molybdopterin-converting factor subunit 2) 0.9425 1 145 GO:0006777
GO:0030366
AF-A0A222EWI1-F1-model_v4 deleted 0.9411 4 145
AF-A0A0H0XNW8-F1-model_v4 Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (MPT synthase subunit 2) (Molybdenum cofactor biosynthesis protein E) (Molybdopterin-converting factor large subunit) (Molybdopterin-converting factor subunit 2) 0.9399 5 145 GO:0006777
GO:0030366

Feature Viewer

pLDDT pTM Quality
91.26 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map