F374109

General Info

Members Datasets Scaffolds Average Seq Length
266 203 532 312

Family's Representative Sequence

Representative Sequence 3300025225|Ga0209566_100209|Ga0209566_10020932
Length 361
Sequence MGMTTKNETDAGLATGSQVETAQPPHAAKAPDPLMAPGQPRHSGETVLSVEHLSKTIRGRRIIDDISFDVRAGEVYGFLGPNGSGKTTTIRMLVDLIKPTSGRVLVCGEDVSKHPERALRHVGSIVENPEMYGYLTGWENLDLFARMQDGIGEERIAEVARIVRMDERIHDKIKTYSLGMRQRLGIAQALLGSPKLLILDEPTNGLDPKGIKELRAFIRELAGQGMSVFVSSHLLSEIQLLCDRVAIIDGGRIIATGNVHELIAQAEAYTLWLFEDAEAGLALLSQDARVAITTDRDLASIDEAVLSALPGAIATRIRQEDVAGVVASCAEAGVGVLAVQRVVPTLETLFLALTGGDPYAS

Samples

Sample ID Description Type Environment
1 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
6 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
16 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
17 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
18 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
19 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
20 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
21 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
22 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
24 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
25 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
26 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
27 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
28 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
29 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
30 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
31 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
32 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
33 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
34 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
48 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
49 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
50 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
51 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
52 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
53 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
54 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
55 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
56 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
57 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
58 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
59 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
60 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
61 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
62 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
63 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
64 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
65 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
66 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
67 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
68 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
69 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
70 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
71 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
72 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
73 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
74 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
75 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
76 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
77 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
78 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
79 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
80 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
81 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
82 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
83 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
84 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
85 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
86 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
87 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
88 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
89 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
90 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
91 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
92 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
93 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
94 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
95 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
96 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
97 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
98 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
99 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
100 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
101 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
102 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
103 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
104 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
105 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
106 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
107 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
108 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
109 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
110 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
111 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
112 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
113 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
114 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
115 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
116 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
117 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
118 2643221729 Bacillus sp. Root11 Isolate Unclassified
119 2643221730 Bacillus sp. Root131 Isolate Unclassified
120 2684622632 Bacillus cereus 905 Isolate Unclassified
121 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
122 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
123 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
124 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
125 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
126 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
127 2738541358 Bacillus sp. OV752 Isolate Unclassified
128 2738543006 Bacillus sp. OK077 Isolate Unclassified
129 2738543017 Bacillus sp. OV186 Isolate Unclassified
130 2744054657 Brevibacillus sp. SKDU10 Isolate Unclassified
131 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
132 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
133 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
134 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
135 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
136 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
137 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
138 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
139 2818991441 Niallia circulans 3243 Isolate Rhizosphere
140 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
141 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
142 2857472729 Cohnella sp. R-74144 Isolate Unclassified
143 2857586860 Bacillus sp. R-71935 Isolate Unclassified
144 2857609550 Domibacillus sp. R-71929 Isolate Unclassified
145 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
146 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
147 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
148 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
149 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
150 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
151 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
152 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
153 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
154 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
155 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
156 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
157 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
158 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
159 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
160 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
161 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
162 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
163 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
164 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
165 2938917290 Bacillus sp. CR71 Isolate Unclassified
166 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
167 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
168 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
169 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
170 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
171 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
172 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
173 2965761152 Bacillus sp. COPE52 Isolate Unclassified
174 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
175 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
176 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
177 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
178 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
179 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
180 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
181 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
182 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
183 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
184 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
185 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
186 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
187 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
188 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
189 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
190 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
191 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
192 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
193 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
194 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
195 8022792930 Bacillus sp. Xin Isolate Rhizosphere
196 8023438354 Bacillus sp. BH2 Isolate Unclassified
197 8023444577 Bacillus sp. BH32 Isolate Unclassified
198 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere
199 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
200 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
201 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere
202 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere
203 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 62.03
Metatranscriptomes 0.38
Isolates 37.59

Biome Distribution

Category Percentage (%)
Aerial Root 0.75
Bulb 0
Endosphere 11.28
Nodule 0
Rhizoplane 2.63
Rhizosphere 56.02
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209566_100209 3300025225 Bacteria 59584
2 JGI25162J39368_1003233 3300002737 Bacteria 4996
3 JGI25159J45721_1002398 3300002987 Bacteria 7139
4 JGI25151J46595_10001316 3300003187 Bacteria 17391
5 JGI25151J46595_10001501 3300003187 Bacteria 15656
6 JGI25151J46595_10030280 3300003187 Bacteria 2131
7 Ga0055538_1000271 3300003751 Bacteria 27036
8 Ga0055532_1000086 3300003758 Bacteria 109784
9 Ga0055532_1008879 3300003758 Bacteria 1236
10 Ga0070661_100288325 3300005344 Bacteria 1275
11 Ga0070675_100197015 3300005354 Bacteria 1747
12 Ga0070709_10012033 3300005434 Bacteria 4838
13 Ga0070714_100067475 3300005435 Bacteria 3084
14 Ga0070713_100025800 3300005436 Bacteria 4602
15 Ga0070713_100045463 3300005436 Bacteria 3598
16 Ga0070713_100472187 3300005436 Bacteria 1181
17 Ga0070711_100093206 3300005439 Bacteria 2174
18 Ga0070706_100045560 3300005467 Bacteria 4051
19 Ga0070698_100010358 3300005471 Bacteria 9955
20 Ga0068857_100155405 3300005577 Bacteria 2074
21 Ga0070717_10012511 3300006028 Bacteria 6473
22 Ga0070717_10027390 3300006028 Bacteria 4555
23 Ga0070717_10494180 3300006028 Bacteria 1105
24 Ga0070716_100005185 3300006173 Bacteria 6300
25 Ga0070712_100346494 3300006175 Bacteria 1215
26 Ga0105251_10004824 3300009011 Bacteria 9017
27 Ga0105251_10009934 3300009011 Bacteria 5569
28 Ga0105244_10005380 3300009036 Bacteria 8521
29 Ga0105244_10006890 3300009036 Bacteria 7290
30 Ga0105244_10027742 3300009036 Bacteria 3048
31 Ga0105244_10057467 3300009036 Bacteria 1966
32 Ga0105244_10065460 3300009036 Bacteria 1821
33 Ga0105250_10003552 3300009092 Bacteria 7346
34 Ga0105250_10007749 3300009092 Bacteria 4600
35 Ga0105250_10008954 3300009092 Bacteria 4235
36 Ga0105250_10057436 3300009092 Bacteria 1561
37 Ga0114129_11117872 3300009147 Bacteria 986
38 Ga0105249_10018134 3300009553 Bacteria 6257
39 Ga0105249_10423915 3300009553 Bacteria 1365
40 Ga0105246_10006516 3300011119 Bacteria 7126
41 Ga0157369_10166567 3300013105 Bacteria 2324
42 Ga0157369_10214003 3300013105 Bacteria 2019
43 Ga0206353_10052794 3300020082 Bacteria 4906
44 Ga0209784_100085 3300025224 Bacteria 122828
45 Ga0209784_101673 3300025224 Bacteria 2696
46 Ga0209784_101705 3300025224 Bacteria 2647
47 Ga0209147_100169 3300025229 Bacteria 87841
48 Ga0209147_101642 3300025229 Bacteria 7406
49 Ga0209437_100306 3300025233 Bacteria 67153
50 Ga0209130_1000355 3300025284 Bacteria 52430
51 Ga0209130_1002054 3300025284 Bacteria 10906
52 Ga0209130_1002825 3300025284 Bacteria 8075
53 Ga0209130_1006360 3300025284 Bacteria 3852
54 Ga0209675_1033110 3300025291 Bacteria 1202
55 Ga0209676_1041533 3300025292 Bacteria 1285
56 Ga0209025_1000331 3300025294 Bacteria 104721
57 Ga0209025_1001330 3300025294 Bacteria 33454
58 Ga0209025_1002180 3300025294 Bacteria 21730
59 Ga0209025_1002589 3300025294 Bacteria 18713
60 Ga0209025_1004025 3300025294 Bacteria 13178
61 Ga0209025_1008218 3300025294 Bacteria 7547
62 Ga0209025_1014079 3300025294 Bacteria 4963
63 Ga0209025_1018770 3300025294 Bacteria 3894
64 Ga0209025_1033353 3300025294 Bacteria 2380
65 Ga0207696_1000796 3300025711 Bacteria 20503
66 Ga0207696_1000882 3300025711 Bacteria 18695
67 Ga0207655_1006868 3300025728 Bacteria 7472
68 Ga0207655_1012577 3300025728 Bacteria 4934
69 Ga0207655_1041692 3300025728 Bacteria 1964
70 Ga0207713_1007400 3300025735 Bacteria 6484
71 Ga0207713_1019495 3300025735 Bacteria 3314
72 Ga0207692_10023444 3300025898 Bacteria 2854
73 Ga0207699_10033944 3300025906 Bacteria 2888
74 Ga0207699_10042975 3300025906 Bacteria 2622
75 Ga0207684_10038605 3300025910 Bacteria 4052
76 Ga0207693_10032905 3300025915 Bacteria 4092
77 Ga0207663_10062973 3300025916 Bacteria 2360
78 Ga0207646_10090273 3300025922 Bacteria 2743
79 Ga0207700_10017962 3300025928 Bacteria 4737
80 Ga0207700_10068960 3300025928 Bacteria 2712
81 Ga0207700_10100814 3300025928 Bacteria 2302
82 Ga0207700_10526001 3300025928 Bacteria 1048
83 Ga0207664_10002421 3300025929 Bacteria 12340
84 Ga0207664_10080855 3300025929 Bacteria 2643
85 Ga0207709_10281206 3300025935 Bacteria 1229
86 Ga0207665_10005367 3300025939 Bacteria 8557
87 Ga0209973_1001748 3300027252 Bacteria 1935
88 Ga0209371_1008130 3300027312 Bacteria 3535
89 Ga0265337_1003142 3300028556 Bacteria 7273
90 Ga0265326_10001957 3300028558 Bacteria 7053
91 Ga0265319_1005035 3300028563 Bacteria 6426
92 Ga0265334_10002217 3300028573 Bacteria 9143
93 Ga0265323_10007203 3300028653 Bacteria 4636
94 Ga0265322_10025354 3300028654 Bacteria 1695
95 Ga0265336_10003485 3300028666 Bacteria 6156
96 Ga0265336_10015689 3300028666 Bacteria 2487
97 Ga0265338_10004224 3300028800 Bacteria 19552
98 Ga0265324_10002929 3300029957 Bacteria 8367
99 Ga0237817_10046 3300030083 Bacteria 42105
100 Ga0268256_1003904 3300030500 Bacteria 6466
101 Ga0265332_10009831 3300031238 Bacteria 4263
102 Ga0265340_10010122 3300031247 Bacteria 5051
103 Ga0265316_10047489 3300031344 Bacteria 3396
104 Ga0265313_10037811 3300031595 Bacteria 2409
105 Ga0265314_10015242 3300031711 Bacteria 6105
106 Ga0373953_0006174 3300035117 Bacteria 3935
107 Ga0373956_0012056 3300035119 Bacteria 3575
108 Ga0373955_0006859 3300035172 Bacteria 5207
109 Ga0373935_0022629 3300035692 Bacteria 3856
110 Ga0373933_0041190 3300035724 Bacteria 2725
111 Ga0373937_0046694 3300036401 Bacteria 3960
112 Ga0373925_0000357 3300037068 Bacteria 47600
113 Ga0237819_00023 3300038705 Bacteria 52093
114 Ga0237819_00734 3300038705 Bacteria 10540
115 Ga0439449_0000153 3300042007 Bacteria 23466
116 Ga0439457_009754 3300042014 Bacteria 2225
117 Ga0466967_0000081 3300045976 Bacteria 34669
118 Ga0495653_0056747 3300046463 Bacteria 2983
119 Ga0495607_0150276 3300046501 Bacteria 1193
120 Ga0495608_0114437 3300046511 Bacteria 1732
121 Ga0495628_0053683 3300046516 Bacteria 3179
122 Ga0495587_0077316 3300046536 Bacteria 1932
123 Ga0495609_0090371 3300046538 Bacteria 1332
124 Ga0495622_0105129 3300046557 Bacteria 1293
125 Ga0495667_0187691 3300046559 Bacteria 1325
126 Ga0495634_0084289 3300046642 Bacteria 2072
127 Ga0495635_0039495 3300046663 Bacteria 3264
128 Ga0495661_0064408 3300046665 Bacteria 2163
129 Ga0495661_0107946 3300046665 Bacteria 1556
130 Ga0495646_0060222 3300046680 Bacteria 2265
131 Ga0495613_0195725 3300046689 Bacteria 1427
132 Ga0495660_0042770 3300046810 Bacteria 2502
133 Ga0496102_0106403 3300048905 Bacteria 2611
134 Ga0496110_0028292 3300048913 Bacteria 4813
135 Ga0496110_0300622 3300048913 Bacteria 1462
136 Ga0496112_0109298 3300048915 Bacteria 2735
137 Ga0496115_0070653 3300048918 Bacteria 2830
138 Ga0496116_0000940 3300048919 Bacteria 35871
139 Ga0496116_0007622 3300048919 Bacteria 9556
140 Ga0496116_0049940 3300048919 Bacteria 2791
141 Ga0496116_0144430 3300048919 Bacteria 1332
142 Ga0496117_0005900 3300048920 Bacteria 12652
143 Ga0496118_0157623 3300048921 Bacteria 1409
144 Ga0496119_0000363 3300048922 Bacteria 63665
145 Ga0496120_0000094 3300048923 Bacteria 146405
146 Ga0496120_0009837 3300048923 Bacteria 6736
147 Ga0496121_0083178 3300048924 Bacteria 2527
148 Ga0496121_0137647 3300048924 Bacteria 1817
149 Ga0496122_0003382 3300048925 Bacteria 20997
150 Ga0496122_0013502 3300048925 Bacteria 7991
151 Ga0496122_0026137 3300048925 Bacteria 5047
152 Ga0496122_0036497 3300048925 Bacteria 3973
153 Ga0496122_0043150 3300048925 Bacteria 3537
154 Ga0496122_0233005 3300048925 Bacteria 1045
155 Ga0496123_0010525 3300048926 Bacteria 8160
156 Ga0496124_0000572 3300048927 Bacteria 62388
157 Ga0496124_0041694 3300048927 Bacteria 3958
158 Ga0496124_0063864 3300048927 Bacteria 3075
159 Ga0496125_0000351 3300048928 Bacteria 87146
160 Ga0496125_0016049 3300048928 Bacteria 7210
161 Ga0496125_0117255 3300048928 Bacteria 1910
162 Ga0496126_0001224 3300048929 Bacteria 41721
163 Ga0496126_0012939 3300048929 Bacteria 8519
164 Ga0496126_0190295 3300048929 Bacteria 1738
165 nmdc:mga09592_303385_c1 3300050508 Bacteria 1384
166 Ga0495595_0090754 3300053084 Bacteria 1466
167 2550901867 2548877040 Bacteria 7507281
168 2553391289 2551306519 Bacteria 5465154
169 2563929829 2563366752 Bacteria 4961801
170 2571528476 2571042143 Bacteria 6986194
171 2573040204 2571042588 Bacteria 5045676
172 2578337625 2576861424 Bacteria 5270569
173 2580930602 2579778775 Bacteria 5360914
174 2595089592 2593339131 Bacteria 5116855
175 2601638707 2600255286 Bacteria 5390125
176 2621275963 2619619294 Bacteria 5575484
177 2643738451 2643221543 Bacteria 6628015
178 2644702519 2643221729 Bacteria 6621700
179 2644715149 2643221730 Bacteria 6523787
180 2685153357 2684622632 Bacteria 5380049
181 2698319831 2695420987 Bacteria 6152737
182 2705997270 2703719227 Bacteria 5631989
183 2721508519 2718218445 Bacteria 5113413
184 2723604522 2721755693 Bacteria 6126117
185 2728530318 2728368933 Bacteria 7044283
186 2730135157 2728369359 Bacteria 5621728
187 2739156839 2738541358 Bacteria 5932299
188 2739159597 2738541358 Bacteria 5932299
189 2739209411 2738543006 Bacteria 5904091
190 2739212913 2738543006 Bacteria 5904091
191 2739269669 2738543017 Bacteria 4271950
192 2745168626 2744054657 Bacteria 5016802
193 2753810021 2751185905 Bacteria 6142767
194 2757567841 2757320391 Bacteria 4746095
195 2777761146 2775507177 Bacteria 4384303
196 2777839160 2775507192 Bacteria 4622234
197 2802436793 2802428803 Bacteria 5806948
198 2808869567 2808606364 Bacteria 4465927
199 2817479083 2816332295 Bacteria 4352468
200 2817620903 2816332336 Bacteria 5207640
201 2819568581 2818991441 Bacteria 5062707
202 2819583697 2818991443 Bacteria 6598732
203 2821114244 2821111986 Bacteria 6894338
204 2857474059 2857472729 Bacteria 6568124
205 2857588669 2857586860 Bacteria 4354574
206 2857610700 2857609550 Bacteria 3753890
207 2864737508 2864733723 Bacteria 6770668
208 2865001263 2864997549 Bacteria 5139696
209 2881637036 2881636855 Bacteria 5205297
210 2885527698 2885526491 Bacteria 7164189
211 2888582607 2888578766 Bacteria 6743310
212 2889046342 2889042446 Bacteria 7618936
213 2889055177 2889049205 Bacteria 7524325
214 2889280420 2889276214 Bacteria 5979355
215 2904163665 2904162308 Bacteria 7086713
216 2904493245 2904490793 Bacteria 7046938
217 2904595639 2904595352 Bacteria 6124848
218 2907202249 2907202186 Bacteria 6632024
219 2919162537 2919160200 Bacteria 6929020
220 2919417080 2919414237 Bacteria 5429133
221 2929207546 2929206907 Bacteria 5918291
222 2929210625 2929206907 Bacteria 5918291
223 2929239067 2929233124 Bacteria 5948380
224 2931389791 2931384279 Bacteria 7299545
225 2936341119 2936340661 Bacteria 5139038
226 2936361942 2936361878 Bacteria 5632809
227 2938651913 2938649242 Bacteria 7118381
228 2938923292 2938917290 Bacteria 5914775
229 2939680816 2939679117 Bacteria 6921672
230 2939705647 2939702853 Bacteria 5139229
231 2945991519 2945991243 Bacteria 7008369
232 2946054214 2946053406 Bacteria 6978655
233 2947432161 2947426588 Bacteria 5357194
234 2956902305 2956897341 Bacteria 5447711
235 2964376692 2964375228 Bacteria 4909004
236 2965766686 2965761152 Bacteria 5806513
237 2968560762 2968558590 Bacteria 6956864
238 2971407702 2971403814 Bacteria 7370929
239 2971512226 2971511577 Bacteria 5404012
240 2977256470 2977254563 Bacteria 4828420
241 2979089047 2979083700 Bacteria 5894929
242 2980177321 2980176882 Bacteria 5397533
243 2984529991 2984527788 Bacteria 5288478
244 2984536096 2984532647 Bacteria 5288506
245 2988231896 2988225383 Bacteria 7221625
246 2990277346 2990275345 Bacteria 4887158
247 2996638270 2996632988 Bacteria 6921523
248 2996709487 2996706504 Bacteria 5757485
249 3001897668 3001892409 Bacteria 6328293
250 3006827981 3006826541 Bacteria 4678913
251 3006859412 3006858327 Bacteria 4317835
252 3006972434 3006969106 Bacteria 4739423
253 3006976047 3006973921 Bacteria 4423788
254 3006981957 3006978542 Bacteria 5328100
255 648170567 648028048 Bacteria 5394884
256 8002320567 8002317523 Bacteria 8051857
257 8022626884 8022621104 Bacteria 5241040
258 8022793682 8022792930 Bacteria 5693794
259 8023441540 8023438354 Bacteria 5779374
260 8023449061 8023444577 Bacteria 5661597
261 8046998688 8046991243 Bacteria 8497463
262 8054469483 8054465665 Bacteria 7323556
263 8055635979 8055632911 Bacteria 5283357
264 8057587814 8057582654 Bacteria 5218944
265 8057635554 8057632132 Bacteria 4726859
266 8057980283 8057977335 Bacteria 5694872
267 Ga0209566_100209
268 JGI25162J39368_1003233
269 JGI25159J45721_1002398
270 JGI25151J46595_10001316
271 JGI25151J46595_10001501
272 JGI25151J46595_10030280
273 Ga0055538_1000271
274 Ga0055532_1000086
275 Ga0055532_1008879
276 Ga0070661_100288325
277 Ga0070675_100197015
278 Ga0070709_10012033
279 Ga0070714_100067475
280 Ga0070713_100025800
281 Ga0070713_100045463
282 Ga0070713_100472187
283 Ga0070711_100093206
284 Ga0070706_100045560
285 Ga0070698_100010358
286 Ga0068857_100155405
287 Ga0070717_10012511
288 Ga0070717_10027390
289 Ga0070717_10494180
290 Ga0070716_100005185
291 Ga0070712_100346494
292 Ga0105251_10004824
293 Ga0105251_10009934
294 Ga0105244_10005380
295 Ga0105244_10006890
296 Ga0105244_10027742
297 Ga0105244_10057467
298 Ga0105244_10065460
299 Ga0105250_10003552
300 Ga0105250_10007749
301 Ga0105250_10008954
302 Ga0105250_10057436
303 Ga0114129_11117872
304 Ga0105249_10018134
305 Ga0105249_10423915
306 Ga0105246_10006516
307 Ga0157369_10166567
308 Ga0157369_10214003
309 Ga0206353_10052794
310 Ga0209784_100085
311 Ga0209784_101673
312 Ga0209784_101705
313 Ga0209147_100169
314 Ga0209147_101642
315 Ga0209437_100306
316 Ga0209130_1000355
317 Ga0209130_1002054
318 Ga0209130_1002825
319 Ga0209130_1006360
320 Ga0209675_1033110
321 Ga0209676_1041533
322 Ga0209025_1000331
323 Ga0209025_1001330
324 Ga0209025_1002180
325 Ga0209025_1002589
326 Ga0209025_1004025
327 Ga0209025_1008218
328 Ga0209025_1014079
329 Ga0209025_1018770
330 Ga0209025_1033353
331 Ga0207696_1000796
332 Ga0207696_1000882
333 Ga0207655_1006868
334 Ga0207655_1012577
335 Ga0207655_1041692
336 Ga0207713_1007400
337 Ga0207713_1019495
338 Ga0207692_10023444
339 Ga0207699_10033944
340 Ga0207699_10042975
341 Ga0207684_10038605
342 Ga0207693_10032905
343 Ga0207663_10062973
344 Ga0207646_10090273
345 Ga0207700_10017962
346 Ga0207700_10068960
347 Ga0207700_10100814
348 Ga0207700_10526001
349 Ga0207664_10002421
350 Ga0207664_10080855
351 Ga0207709_10281206
352 Ga0207665_10005367
353 Ga0209973_1001748
354 Ga0209371_1008130
355 Ga0265337_1003142
356 Ga0265326_10001957
357 Ga0265319_1005035
358 Ga0265334_10002217
359 Ga0265323_10007203
360 Ga0265322_10025354
361 Ga0265336_10003485
362 Ga0265336_10015689
363 Ga0265338_10004224
364 Ga0265324_10002929
365 Ga0237817_10046
366 Ga0268256_1003904
367 Ga0265332_10009831
368 Ga0265340_10010122
369 Ga0265316_10047489
370 Ga0265313_10037811
371 Ga0265314_10015242
372 Ga0373953_0006174
373 Ga0373956_0012056
374 Ga0373955_0006859
375 Ga0373935_0022629
376 Ga0373933_0041190
377 Ga0373937_0046694
378 Ga0373925_0000357
379 Ga0237819_00023
380 Ga0237819_00734
381 Ga0439449_0000153
382 Ga0439457_009754
383 Ga0466967_0000081
384 Ga0495653_0056747
385 Ga0495607_0150276
386 Ga0495608_0114437
387 Ga0495628_0053683
388 Ga0495587_0077316
389 Ga0495609_0090371
390 Ga0495622_0105129
391 Ga0495667_0187691
392 Ga0495634_0084289
393 Ga0495635_0039495
394 Ga0495661_0064408
395 Ga0495661_0107946
396 Ga0495646_0060222
397 Ga0495613_0195725
398 Ga0495660_0042770
399 Ga0496102_0106403
400 Ga0496110_0028292
401 Ga0496110_0300622
402 Ga0496112_0109298
403 Ga0496115_0070653
404 Ga0496116_0000940
405 Ga0496116_0007622
406 Ga0496116_0049940
407 Ga0496116_0144430
408 Ga0496117_0005900
409 Ga0496118_0157623
410 Ga0496119_0000363
411 Ga0496120_0000094
412 Ga0496120_0009837
413 Ga0496121_0083178
414 Ga0496121_0137647
415 Ga0496122_0003382
416 Ga0496122_0013502
417 Ga0496122_0026137
418 Ga0496122_0036497
419 Ga0496122_0043150
420 Ga0496122_0233005
421 Ga0496123_0010525
422 Ga0496124_0000572
423 Ga0496124_0041694
424 Ga0496124_0063864
425 Ga0496125_0000351
426 Ga0496125_0016049
427 Ga0496125_0117255
428 Ga0496126_0001224
429 Ga0496126_0012939
430 Ga0496126_0190295
431 nmdc:mga09592_303385_c1
432 Ga0495595_0090754
433 2550901867
434 2553391289
435 2563929829
436 2571528476
437 2573040204
438 2578337625
439 2580930602
440 2595089592
441 2601638707
442 2621275963
443 2643738451
444 2644702519
445 2644715149
446 2685153357
447 2698319831
448 2705997270
449 2721508519
450 2723604522
451 2728530318
452 2730135157
453 2739156839
454 2739159597
455 2739209411
456 2739212913
457 2739269669
458 2745168626
459 2753810021
460 2757567841
461 2777761146
462 2777839160
463 2802436793
464 2808869567
465 2817479083
466 2817620903
467 2819568581
468 2819583697
469 2821114244
470 2857474059
471 2857588669
472 2857610700
473 2864737508
474 2865001263
475 2881637036
476 2885527698
477 2888582607
478 2889046342
479 2889055177
480 2889280420
481 2904163665
482 2904493245
483 2904595639
484 2907202249
485 2919162537
486 2919417080
487 2929207546
488 2929210625
489 2929239067
490 2931389791
491 2936341119
492 2936361942
493 2938651913
494 2938923292
495 2939680816
496 2939705647
497 2945991519
498 2946054214
499 2947432161
500 2956902305
501 2964376692
502 2965766686
503 2968560762
504 2971407702
505 2971512226
506 2977256470
507 2979089047
508 2980177321
509 2984529991
510 2984536096
511 2988231896
512 2990277346
513 2996638270
514 2996709487
515 3001897668
516 3006827981
517 3006859412
518 3006972434
519 3006976047
520 3006981957
521 648170567
522 8002320567
523 8022626884
524 8022793682
525 8023441540
526 8023449061
527 8046998688
528 8054469483
529 8055635979
530 8057587814
531 8057635554
532 8057980283

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

153

238

0.92

PF00005

ABC_tran

ABC transporter

63

204

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vpl-assembly1.cif.gz_A-2 crystal structure of abc transporter atp-binding protein (tm0544) from thermotoga maritima at 2.10 a resolution 0.9396 9 228
6b89-assembly1.cif.gz_A e. coli lptb in complex with adp and novobiocin 0.9304 10 227
6z4w-assembly1.cif.gz_A ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) 0.9304 8 220
5x41-assembly2.cif.gz_D 3.5a resolution structure of a cobalt energy-coupling factor transporter using lcp method-cbimqo 0.9209 6 227
2yz2-assembly1.cif.gz_A crystal structure of the abc transporter in the cobalt transport system 0.9174 10 228
ID Description Score Start End Superfamily
af_P9WQL9_1_244_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9556 7 224 3.40.50.300
af_A4HRM7_2286_2560_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9538 8 228 3.40.50.300
af_Q8T6J0_514_774_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.949 7 224 3.40.50.300
af_P36879_1_236_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9472 6 224 3.40.50.300
af_A1ZBS3_1241_1472_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9411 10 228 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2B9EER2-F1-model_v4 deleted 0.986 8 217
AF-A0A3D2KNM8-F1-model_v4 ABC transporter 0.9688 11 228 GO:0005524
GO:0016887
AF-A0A4Q2Z4N1-F1-model_v4 ABC transporter ATP-binding protein 0.9657 8 224 GO:0005524
GO:0016887
AF-A0A838S8A2-F1-model_v4 ATP-binding cassette domain-containing protein 0.9649 6 224 GO:0005524
GO:0016887
GO:0043215
GO:0046677
GO:1900753
AF-A0A402BF34-F1-model_v4 Glycosyl transferase family 8 0.9632 8 224 GO:0005524
GO:0016740
GO:0016887

Map