F374061

General Info

Members Datasets Scaffolds Average Seq Length
266 160 532 195

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_10129578|Ga0105249_101295782
Length 219
Sequence MTLIDSRCRAPSEPGGAAPPRGALDVETVPRDPFTLFDEWFAEARARVAEADAMTLATATHDGAPSARMVLLKAADPRGFTFYTNYESRKGRELEENPRGALVLYWSALRRQVRIEGEVQRITVAESDAYFASRDPRSQLSAAVSPQSRPIASLAALEASARALAASHPDGPVPRPSHWGGFRLVPLTIEFWQGGADRLHDRIAFSRSSNGWAIERLAP

Samples

Sample ID Description Type Environment
1 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
96 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
97 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
98 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
99 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
100 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
101 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
102 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
103 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
104 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
105 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
106 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
107 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
111 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
114 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
115 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
116 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
117 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
118 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
119 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
120 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
121 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
122 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
123 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
124 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
125 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
126 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
127 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
128 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
129 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
130 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
131 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
132 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
133 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
134 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
135 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
136 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
137 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
138 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
139 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
140 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
149 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
150 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
151 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
152 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
153 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
154 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
155 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
157 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
158 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
159 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
160 2932401849 Devosia sp. 2618 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.25
Metatranscriptomes 0
Isolates 0.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.38
Nodule 0
Rhizoplane 5.64
Rhizosphere 93.61
Stem 0
Stem Tuber 0
Unclassified 0.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105249_10129578 3300009553 Bacteria 2406
2 MBSR1b_contig_11115089 2162886012 Bacteria 1012
3 JGI24735J21928_10047847 3300002067 Bacteria 1239
4 Ga0065715_10002487 3300005293 Bacteria 4956
5 Ga0070658_10006843 3300005327 Bacteria 9217
6 Ga0070658_10069548 3300005327 Bacteria 2880
7 Ga0070658_10398570 3300005327 Bacteria 1182
8 Ga0070658_10464228 3300005327 Bacteria 1092
9 Ga0070683_100002329 3300005329 Bacteria 15071
10 Ga0070670_100031653 3300005331 Bacteria 4556
11 Ga0070680_100378559 3300005336 Bacteria 1205
12 Ga0068868_100129147 3300005338 Bacteria 2067
13 Ga0070660_100016711 3300005339 Bacteria 5334
14 Ga0070660_100138986 3300005339 Bacteria 1948
15 Ga0070660_100383396 3300005339 Bacteria 1161
16 Ga0070661_100016605 3300005344 Bacteria 5207
17 Ga0070661_100037627 3300005344 Bacteria 3520
18 Ga0070661_100239875 3300005344 Bacteria 1396
19 Ga0070692_10018337 3300005345 Bacteria 3363
20 Ga0070692_10064964 3300005345 Bacteria 1931
21 Ga0070669_100608531 3300005353 Bacteria 916
22 Ga0070671_100091700 3300005355 Bacteria 2545
23 Ga0070671_100319236 3300005355 Bacteria 1324
24 Ga0070671_100584329 3300005355 Bacteria 965
25 Ga0070673_100527908 3300005364 Bacteria 1070
26 Ga0070673_100879340 3300005364 Bacteria 830
27 Ga0070673_101025921 3300005364 Bacteria 769
28 Ga0070659_100029288 3300005366 Bacteria 4254
29 Ga0070659_100035622 3300005366 Bacteria 3876
30 Ga0070659_100068394 3300005366 Bacteria 2817
31 Ga0070659_100366249 3300005366 Bacteria 1212
32 Ga0070667_100132111 3300005367 Bacteria 2180
33 Ga0070667_100449497 3300005367 Bacteria 1177
34 Ga0070667_101306940 3300005367 Bacteria 679
35 Ga0070714_100008475 3300005435 Bacteria 8032
36 Ga0070663_100013338 3300005455 Bacteria 5236
37 Ga0070663_100156038 3300005455 Bacteria 1754
38 Ga0070662_100080839 3300005457 Bacteria 2420
39 Ga0070662_100610684 3300005457 Bacteria 918
40 Ga0070681_10806964 3300005458 Bacteria 856
41 Ga0068867_100225270 3300005459 Bacteria 1513
42 Ga0070679_101328616 3300005530 Bacteria 665
43 Ga0070684_100302608 3300005535 Bacteria 1467
44 Ga0070684_100318943 3300005535 Bacteria 1427
45 Ga0070684_100850973 3300005535 Bacteria 854
46 Ga0068853_100014196 3300005539 Bacteria 6520
47 Ga0068853_101283490 3300005539 Bacteria 707
48 Ga0068853_101454863 3300005539 Bacteria 663
49 Ga0070696_100195279 3300005546 Bacteria 1508
50 Ga0070665_100285455 3300005548 Bacteria 1652
51 Ga0070664_100048037 3300005564 Bacteria 3606
52 Ga0070664_100048645 3300005564 Bacteria 3583
53 Ga0070664_101066396 3300005564 Bacteria 760
54 Ga0068857_100099290 3300005577 Bacteria 2611
55 Ga0068857_100215660 3300005577 Bacteria 1752
56 Ga0068854_100048957 3300005578 Bacteria 3017
57 Ga0068854_100052483 3300005578 Bacteria 2924
58 Ga0068856_100533782 3300005614 Bacteria 1194
59 Ga0068856_100927302 3300005614 Bacteria 890
60 Ga0068852_100032794 3300005616 Bacteria 4304
61 Ga0068852_100349994 3300005616 Bacteria 1442
62 Ga0068859_100039022 3300005617 Bacteria 4763
63 Ga0068864_100006088 3300005618 Bacteria 9896
64 Ga0068864_100362613 3300005618 Bacteria 1370
65 Ga0068851_10003968 3300005834 Bacteria 6627
66 Ga0068863_100050186 3300005841 Bacteria 3956
67 Ga0068863_100148527 3300005841 Bacteria 2242
68 Ga0068858_100070302 3300005842 Bacteria 3244
69 Ga0068860_100119602 3300005843 Bacteria 2522
70 Ga0068860_101321058 3300005843 Bacteria 742
71 Ga0068862_100001336 3300005844 Bacteria 22904
72 Ga0081539_10008427 3300005985 Bacteria 8992
73 Ga0081539_10033820 3300005985 Bacteria 3104
74 Ga0097621_100195011 3300006237 Bacteria 1756
75 Ga0075430_100108537 3300006846 Bacteria 2315
76 Ga0075431_100000446 3300006847 Bacteria 33843
77 Ga0097620_100039021 3300006931 Bacteria 4763
78 Ga0105251_10023021 3300009011 Bacteria 3223
79 Ga0105247_10010189 3300009101 Bacteria 5692
80 Ga0105248_10000029 3300009177 Bacteria 223366
81 Ga0105248_10044240 3300009177 Bacteria 4994
82 Ga0105237_10212472 3300009545 Bacteria 1934
83 Ga0105249_10582070 3300009553 Bacteria 1172
84 Ga0105246_10206937 3300011119 Bacteria 1529
85 Ga0157373_10156346 3300013100 Bacteria 1604
86 Ga0157373_10246964 3300013100 Bacteria 1262
87 Ga0157371_10002441 3300013102 Bacteria 17716
88 Ga0157371_10066598 3300013102 Bacteria 2550
89 Ga0157369_10001885 3300013105 Bacteria 25291
90 Ga0157369_10007345 3300013105 Bacteria 12686
91 Ga0157369_10140820 3300013105 Bacteria 2552
92 Ga0157374_10854195 3300013296 Bacteria 927
93 Ga0163162_10014767 3300013306 Bacteria 7630
94 Ga0163162_10062996 3300013306 Bacteria 3750
95 Ga0157372_10361678 3300013307 Bacteria 1691
96 Ga0157372_10467297 3300013307 Bacteria 1470
97 Ga0157372_10606320 3300013307 Bacteria 1276
98 Ga0157375_10157743 3300013308 Bacteria 2409
99 Ga0157375_10960292 3300013308 Bacteria 996
100 Ga0157380_10002976 3300014326 Bacteria 11534
101 Ga0157380_10042843 3300014326 Bacteria 3541
102 Ga0157380_10213384 3300014326 Bacteria 1722
103 Ga0157380_10411367 3300014326 Bacteria 1287
104 Ga0182008_10065533 3300014497 Bacteria 1787
105 Ga0157379_10001773 3300014968 Bacteria 17808
106 Ga0157376_11280114 3300014969 Bacteria 763
107 Ga0207656_10001434 3300025321 Bacteria 7903
108 Ga0207647_10072277 3300025904 Bacteria 2080
109 Ga0207647_10089919 3300025904 Bacteria 1832
110 Ga0207645_10203348 3300025907 Bacteria 1303
111 Ga0207705_10002713 3300025909 Bacteria 13555
112 Ga0207705_10032278 3300025909 Bacteria 3741
113 Ga0207705_10123804 3300025909 Bacteria 1920
114 Ga0207705_10277865 3300025909 Bacteria 1281
115 Ga0207705_10294234 3300025909 Bacteria 1244
116 Ga0207705_10362262 3300025909 Bacteria 1118
117 Ga0207657_10004380 3300025919 Bacteria 14945
118 Ga0207649_10018128 3300025920 Bacteria 3997
119 Ga0207649_10024113 3300025920 Bacteria 3532
120 Ga0207649_10064505 3300025920 Bacteria 2316
121 Ga0207649_10118662 3300025920 Bacteria 1780
122 Ga0207649_10248330 3300025920 Bacteria 1280
123 Ga0207649_10554607 3300025920 Bacteria 879
124 Ga0207650_10175676 3300025925 Bacteria 1704
125 Ga0207664_10663958 3300025929 Bacteria 937
126 Ga0207644_10186836 3300025931 Bacteria 1627
127 Ga0207690_10028493 3300025932 Bacteria 3540
128 Ga0207690_10074272 3300025932 Bacteria 2354
129 Ga0207690_10122326 3300025932 Bacteria 1892
130 Ga0207706_10138208 3300025933 Bacteria 2143
131 Ga0207706_10505614 3300025933 Bacteria 1043
132 Ga0207711_10000004 3300025941 Bacteria 870636
133 Ga0207711_10011581 3300025941 Bacteria 7332
134 Ga0207711_10042384 3300025941 Bacteria 3878
135 Ga0207679_10054025 3300025945 Bacteria 2955
136 Ga0207679_10584919 3300025945 Bacteria 1004
137 Ga0207667_10179281 3300025949 Bacteria 2176
138 Ga0207651_10273705 3300025960 Bacteria 1392
139 Ga0207712_10405021 3300025961 Bacteria 1147
140 Ga0207712_10716571 3300025961 Bacteria 874
141 Ga0207668_10176027 3300025972 Bacteria 1683
142 Ga0207640_10098837 3300025981 Bacteria 2041
143 Ga0207640_10259196 3300025981 Bacteria 1354
144 Ga0207640_10280693 3300025981 Bacteria 1308
145 Ga0207640_11284904 3300025981 Bacteria 653
146 Ga0207658_10010678 3300025986 Bacteria 6242
147 Ga0207658_10762849 3300025986 Bacteria 876
148 Ga0207677_10021792 3300026023 Bacteria 3924
149 Ga0207677_10045294 3300026023 Bacteria 2937
150 Ga0207677_11180678 3300026023 Unclassified 700
151 Ga0207703_10028359 3300026035 Bacteria 4413
152 Ga0207639_10090292 3300026041 Bacteria 2450
153 Ga0207678_10014205 3300026067 Bacteria 7001
154 Ga0207678_10055618 3300026067 Bacteria 3408
155 Ga0207702_10047179 3300026078 Bacteria 3628
156 Ga0207702_10113552 3300026078 Bacteria 2413
157 Ga0207641_10113876 3300026088 Bacteria 2402
158 Ga0207648_10159867 3300026089 Bacteria 1990
159 Ga0207676_10120512 3300026095 Bacteria 2211
160 Ga0207676_10351541 3300026095 Bacteria 1363
161 Ga0207674_10000185 3300026116 Bacteria 76519
162 Ga0207683_10011041 3300026121 Bacteria 7697
163 Ga0207698_10014687 3300026142 Bacteria 5215
164 Ga0207698_10102489 3300026142 Bacteria 2376
165 Ga0209974_10064587 3300027876 Bacteria 1242
166 Ga0268266_10000332 3300028379 Bacteria 74181
167 Ga0268266_10135497 3300028379 Bacteria 2205
168 Ga0268265_10001741 3300028380 Bacteria 17506
169 Ga0268264_11087074 3300028381 Bacteria 808
170 Ga0307408_100023687 3300031548 Bacteria 4185
171 Ga0307405_10039609 3300031731 Bacteria 2849
172 Ga0307405_10222299 3300031731 Bacteria 1386
173 Ga0307413_10163215 3300031824 Bacteria 1567
174 Ga0307410_10025567 3300031852 Bacteria 3706
175 Ga0307410_10267638 3300031852 Bacteria 1335
176 Ga0307407_10219943 3300031903 Bacteria 1283
177 Ga0307412_10048695 3300031911 Bacteria 2788
178 Ga0307409_100078201 3300031995 Bacteria 2660
179 Ga0307416_100046761 3300032002 Bacteria 3418
180 Ga0307415_100086675 3300032126 Bacteria 2253
181 Ga0373955_0209753 3300035172 Bacteria 1161
182 Ga0373935_0025830 3300035692 Bacteria 3620
183 Ga0373933_0642294 3300035724 Bacteria 697
184 Ga0373937_0302052 3300036401 Bacteria 1513
185 Ga0373937_0875277 3300036401 Bacteria 847
186 Ga0395899_0005371 3300037312 Bacteria 9949
187 Ga0395899_0175146 3300037312 Bacteria 1509
188 Ga0395899_0218393 3300037312 Bacteria 1321
189 Ga0395899_0242654 3300037312 Bacteria 1239
190 Ga0395900_0018851 3300037418 Bacteria 7038
191 Ga0395900_0125603 3300037418 Bacteria 2631
192 Ga0395900_0333787 3300037418 Bacteria 1493
193 Ga0395900_0380941 3300037418 Bacteria 1378
194 Ga0395900_0688482 3300037418 Bacteria 956
195 Ga0395900_0853395 3300037418 Bacteria 836
196 Ga0395898_0005917 3300037466 Bacteria 13140
197 Ga0395898_0402712 3300037466 Bacteria 1305
198 Ga0395898_0456567 3300037466 Bacteria 1216
199 Ga0395898_1260148 3300037466 Bacteria 669
200 Ga0395905_0001650 3300037471 Bacteria 26378
201 Ga0395905_0003012 3300037471 Bacteria 18251
202 Ga0395905_0098533 3300037471 Bacteria 2745
203 Ga0395905_0140421 3300037471 Bacteria 2273
204 Ga0395905_0161574 3300037471 Bacteria 2105
205 Ga0395905_0196099 3300037471 Bacteria 1893
206 Ga0395905_0356353 3300037471 Bacteria 1355
207 Ga0395901_0000418 3300038443 Bacteria 50129
208 Ga0395901_0006456 3300038443 Bacteria 11883
209 Ga0395901_0192273 3300038443 Bacteria 2140
210 Ga0395901_0238673 3300038443 Bacteria 1896
211 Ga0395901_0393081 3300038443 Bacteria 1425
212 Ga0395901_0712080 3300038443 Bacteria 1000
213 Ga0451837_1609819 3300041494 Bacteria 949
214 Ga0466961_0370241 3300044693 Bacteria 871
215 Ga0466963_0133952 3300044694 Bacteria 1713
216 Ga0466963_0134922 3300044694 Bacteria 1707
217 Ga0466970_0643912 3300044765 Unclassified 616
218 Ga0466957_0043486 3300044842 Bacteria 2720
219 Ga0466957_0225112 3300044842 Bacteria 1240
220 Ga0466958_0043342 3300045836 Bacteria 2710
221 Ga0466967_0011227 3300045976 Bacteria 6770
222 Ga0495582_0120391 3300046473 Bacteria 1479
223 Ga0495628_0095257 3300046516 Bacteria 2300
224 Ga0495667_0253386 3300046559 Bacteria 1120
225 Ga0495668_0010987 3300046616 Bacteria 5449
226 Ga0495669_0054846 3300046684 Bacteria 1794
227 Ga0495680_0619506 3300047322 Bacteria 722
228 Ga0495686_0000511 3300047472 Bacteria 56027
229 Ga0496100_0178176 3300048903 Bacteria 1536
230 Ga0496101_0090155 3300048904 Bacteria 2280
231 Ga0496102_0424088 3300048905 Bacteria 1249
232 Ga0496103_0067788 3300048906 Bacteria 2229
233 Ga0496104_0087629 3300048907 Bacteria 2973
234 Ga0496104_0385334 3300048907 Bacteria 1314
235 Ga0496106_0598060 3300048909 Bacteria 883
236 Ga0496107_0023938 3300048910 Bacteria 4317
237 Ga0496107_0025942 3300048910 Bacteria 4153
238 Ga0496108_0007974 3300048911 Bacteria 8590
239 Ga0496109_0020290 3300048912 Bacteria 5868
240 Ga0496110_0315169 3300048913 Bacteria 1424
241 Ga0496111_0269207 3300048914 Bacteria 1264
242 Ga0496112_0006543 3300048915 Bacteria 10249
243 Ga0496113_0012038 3300048916 Bacteria 5801
244 Ga0501031_0136837 3300049568 Bacteria 1600
245 Ga0501032_0018046 3300049569 Bacteria 4949
246 Ga0501033_0002298 3300049570 Bacteria 16318
247 Ga0501034_0036971 3300049571 Bacteria 4944
248 Ga0501036_0331231 3300049572 Bacteria 1272
249 Ga0501037_0000076 3300049573 Bacteria 92049
250 Ga0501038_0015333 3300049574 Bacteria 6967
251 Ga0501038_0361679 3300049574 Bacteria 1128
252 Ga0501043_0000039 3300049579 Bacteria 119155
253 Ga0501067_0016272 3300049583 Bacteria 4110
254 Ga0501069_0000022 3300049585 Bacteria 119155
255 Ga0501069_0118137 3300049585 Bacteria 1513
256 Ga0501070_0000080 3300049586 Bacteria 81734
257 Ga0501074_0000046 3300049590 Bacteria 57165
258 Ga0501249_070509 3300049679 Bacteria 816
259 Ga0501080_0004742 3300049742 Bacteria 12123
260 Ga0501083_0000050 3300049744 Bacteria 86199
261 Ga0501035_0000318 3300049822 Bacteria 55751
262 Ga0501044_0000147 3300049823 Bacteria 86591
263 Ga0500604_0020676 3300053151 Bacteria 1855
264 Ga0466962_0140908 3300061719 Bacteria 1168
265 2896429388 2896429255 Bacteria 2557483
266 2932404381 2932401849 Bacteria 4262978
267 Ga0105249_10129578
268 MBSR1b_contig_11115089
269 JGI24735J21928_10047847
270 Ga0065715_10002487
271 Ga0070658_10006843
272 Ga0070658_10069548
273 Ga0070658_10398570
274 Ga0070658_10464228
275 Ga0070683_100002329
276 Ga0070670_100031653
277 Ga0070680_100378559
278 Ga0068868_100129147
279 Ga0070660_100016711
280 Ga0070660_100138986
281 Ga0070660_100383396
282 Ga0070661_100016605
283 Ga0070661_100037627
284 Ga0070661_100239875
285 Ga0070692_10018337
286 Ga0070692_10064964
287 Ga0070669_100608531
288 Ga0070671_100091700
289 Ga0070671_100319236
290 Ga0070671_100584329
291 Ga0070673_100527908
292 Ga0070673_100879340
293 Ga0070673_101025921
294 Ga0070659_100029288
295 Ga0070659_100035622
296 Ga0070659_100068394
297 Ga0070659_100366249
298 Ga0070667_100132111
299 Ga0070667_100449497
300 Ga0070667_101306940
301 Ga0070714_100008475
302 Ga0070663_100013338
303 Ga0070663_100156038
304 Ga0070662_100080839
305 Ga0070662_100610684
306 Ga0070681_10806964
307 Ga0068867_100225270
308 Ga0070679_101328616
309 Ga0070684_100302608
310 Ga0070684_100318943
311 Ga0070684_100850973
312 Ga0068853_100014196
313 Ga0068853_101283490
314 Ga0068853_101454863
315 Ga0070696_100195279
316 Ga0070665_100285455
317 Ga0070664_100048037
318 Ga0070664_100048645
319 Ga0070664_101066396
320 Ga0068857_100099290
321 Ga0068857_100215660
322 Ga0068854_100048957
323 Ga0068854_100052483
324 Ga0068856_100533782
325 Ga0068856_100927302
326 Ga0068852_100032794
327 Ga0068852_100349994
328 Ga0068859_100039022
329 Ga0068864_100006088
330 Ga0068864_100362613
331 Ga0068851_10003968
332 Ga0068863_100050186
333 Ga0068863_100148527
334 Ga0068858_100070302
335 Ga0068860_100119602
336 Ga0068860_101321058
337 Ga0068862_100001336
338 Ga0081539_10008427
339 Ga0081539_10033820
340 Ga0097621_100195011
341 Ga0075430_100108537
342 Ga0075431_100000446
343 Ga0097620_100039021
344 Ga0105251_10023021
345 Ga0105247_10010189
346 Ga0105248_10000029
347 Ga0105248_10044240
348 Ga0105237_10212472
349 Ga0105249_10582070
350 Ga0105246_10206937
351 Ga0157373_10156346
352 Ga0157373_10246964
353 Ga0157371_10002441
354 Ga0157371_10066598
355 Ga0157369_10001885
356 Ga0157369_10007345
357 Ga0157369_10140820
358 Ga0157374_10854195
359 Ga0163162_10014767
360 Ga0163162_10062996
361 Ga0157372_10361678
362 Ga0157372_10467297
363 Ga0157372_10606320
364 Ga0157375_10157743
365 Ga0157375_10960292
366 Ga0157380_10002976
367 Ga0157380_10042843
368 Ga0157380_10213384
369 Ga0157380_10411367
370 Ga0182008_10065533
371 Ga0157379_10001773
372 Ga0157376_11280114
373 Ga0207656_10001434
374 Ga0207647_10072277
375 Ga0207647_10089919
376 Ga0207645_10203348
377 Ga0207705_10002713
378 Ga0207705_10032278
379 Ga0207705_10123804
380 Ga0207705_10277865
381 Ga0207705_10294234
382 Ga0207705_10362262
383 Ga0207657_10004380
384 Ga0207649_10018128
385 Ga0207649_10024113
386 Ga0207649_10064505
387 Ga0207649_10118662
388 Ga0207649_10248330
389 Ga0207649_10554607
390 Ga0207650_10175676
391 Ga0207664_10663958
392 Ga0207644_10186836
393 Ga0207690_10028493
394 Ga0207690_10074272
395 Ga0207690_10122326
396 Ga0207706_10138208
397 Ga0207706_10505614
398 Ga0207711_10000004
399 Ga0207711_10011581
400 Ga0207711_10042384
401 Ga0207679_10054025
402 Ga0207679_10584919
403 Ga0207667_10179281
404 Ga0207651_10273705
405 Ga0207712_10405021
406 Ga0207712_10716571
407 Ga0207668_10176027
408 Ga0207640_10098837
409 Ga0207640_10259196
410 Ga0207640_10280693
411 Ga0207640_11284904
412 Ga0207658_10010678
413 Ga0207658_10762849
414 Ga0207677_10021792
415 Ga0207677_10045294
416 Ga0207677_11180678
417 Ga0207703_10028359
418 Ga0207639_10090292
419 Ga0207678_10014205
420 Ga0207678_10055618
421 Ga0207702_10047179
422 Ga0207702_10113552
423 Ga0207641_10113876
424 Ga0207648_10159867
425 Ga0207676_10120512
426 Ga0207676_10351541
427 Ga0207674_10000185
428 Ga0207683_10011041
429 Ga0207698_10014687
430 Ga0207698_10102489
431 Ga0209974_10064587
432 Ga0268266_10000332
433 Ga0268266_10135497
434 Ga0268265_10001741
435 Ga0268264_11087074
436 Ga0307408_100023687
437 Ga0307405_10039609
438 Ga0307405_10222299
439 Ga0307413_10163215
440 Ga0307410_10025567
441 Ga0307410_10267638
442 Ga0307407_10219943
443 Ga0307412_10048695
444 Ga0307409_100078201
445 Ga0307416_100046761
446 Ga0307415_100086675
447 Ga0373955_0209753
448 Ga0373935_0025830
449 Ga0373933_0642294
450 Ga0373937_0302052
451 Ga0373937_0875277
452 Ga0395899_0005371
453 Ga0395899_0175146
454 Ga0395899_0218393
455 Ga0395899_0242654
456 Ga0395900_0018851
457 Ga0395900_0125603
458 Ga0395900_0333787
459 Ga0395900_0380941
460 Ga0395900_0688482
461 Ga0395900_0853395
462 Ga0395898_0005917
463 Ga0395898_0402712
464 Ga0395898_0456567
465 Ga0395898_1260148
466 Ga0395905_0001650
467 Ga0395905_0003012
468 Ga0395905_0098533
469 Ga0395905_0140421
470 Ga0395905_0161574
471 Ga0395905_0196099
472 Ga0395905_0356353
473 Ga0395901_0000418
474 Ga0395901_0006456
475 Ga0395901_0192273
476 Ga0395901_0238673
477 Ga0395901_0393081
478 Ga0395901_0712080
479 Ga0451837_1609819
480 Ga0466961_0370241
481 Ga0466963_0133952
482 Ga0466963_0134922
483 Ga0466970_0643912
484 Ga0466957_0043486
485 Ga0466957_0225112
486 Ga0466958_0043342
487 Ga0466967_0011227
488 Ga0495582_0120391
489 Ga0495628_0095257
490 Ga0495667_0253386
491 Ga0495668_0010987
492 Ga0495669_0054846
493 Ga0495680_0619506
494 Ga0495686_0000511
495 Ga0496100_0178176
496 Ga0496101_0090155
497 Ga0496102_0424088
498 Ga0496103_0067788
499 Ga0496104_0087629
500 Ga0496104_0385334
501 Ga0496106_0598060
502 Ga0496107_0023938
503 Ga0496107_0025942
504 Ga0496108_0007974
505 Ga0496109_0020290
506 Ga0496110_0315169
507 Ga0496111_0269207
508 Ga0496112_0006543
509 Ga0496113_0012038
510 Ga0501031_0136837
511 Ga0501032_0018046
512 Ga0501033_0002298
513 Ga0501034_0036971
514 Ga0501036_0331231
515 Ga0501037_0000076
516 Ga0501038_0015333
517 Ga0501038_0361679
518 Ga0501043_0000039
519 Ga0501067_0016272
520 Ga0501069_0000022
521 Ga0501069_0118137
522 Ga0501070_0000080
523 Ga0501074_0000046
524 Ga0501249_070509
525 Ga0501080_0004742
526 Ga0501083_0000050
527 Ga0501035_0000318
528 Ga0501044_0000147
529 Ga0500604_0020676
530 Ga0466962_0140908
531 2896429388
532 2932404381

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10590

PNP_phzG_C

Pyridoxine 5'-phosphate oxidase C-terminal dimerisation region

179

219

0.98

PF01243

Putative_PNPOx

Pyridoxamine 5'-phosphate oxidase

41

126

0.96

PF12766

Pyridox_oxase_2

Pyridoxamine 5'-phosphate oxidase

35

123

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1jnw-assembly1.cif.gz_A-2 active site structure of e. coli pyridoxine 5'-phosphate oxidase 0.9151 1 185
6ylz-assembly1.cif.gz_AAA-2 x-ray structure of the k72i,y129f,r133l, h199a quadruple mutant of pnp-oxidase from e. coli 0.9151 1 185
4hmx-assembly1.cif.gz_A crystal structure of phzg from burkholderia lata 383 in complex with tetrahydrophenazine-1-carboxylic acid 0.9138 7 185
1jnw-assembly1.cif.gz_A-2 active site structure of e. coli pyridoxine 5'-phosphate oxidase 0.9103 1 185
6ylz-assembly1.cif.gz_AAA-2 x-ray structure of the k72i,y129f,r133l, h199a quadruple mutant of pnp-oxidase from e. coli 0.9103 1 185
ID Description Score Start End Superfamily
af_A0A1R3LXN8_584_738_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9282 4 135 2.30.110.10
af_Q9VHZ5_37_246_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9269 7 185 2.30.110.10
af_Q54YS6_26_227_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9269 6 185 2.30.110.10
af_Q9UTQ1_28_231_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.918 3 185 2.30.110.10
af_Q9LTX3_323_519_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9154 1 174 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A3D4K823-F1-model_v4 Pyridoxamine 5'-phosphate oxidase (EC 1.4.3.5) 0.972 35 185 GO:0004733
GO:0008615
GO:0010181
AF-A0A356SFP4-F1-model_v4 Pyridoxamine 5'-phosphate oxidase (EC 1.4.3.5) 0.971 32 158 GO:0004733
GO:0008615
GO:0010181
AF-A0A7X6VWK3-F1-model_v4 Pyridoxamine 5'-phosphate oxidase (EC 1.4.3.5) 0.9691 36 185 GO:0004733
GO:0008615
GO:0010181
AF-A0A4Q3MTL8-F1-model_v4 deleted 0.9661 47 185
AF-A0A3D4K823-F1-model_v4 Pyridoxamine 5'-phosphate oxidase (EC 1.4.3.5) 0.9657 35 185 GO:0004733
GO:0008615
GO:0010181

Map