F374012

General Info

Members Datasets Scaffolds Average Seq Length
266 183 533 278

Family's Representative Sequence

Representative Sequence 3300007265|Ga0099794_10007773|Ga0099794_100077734
Length 314
Sequence MRIDAHQHFWVYDQSEYAWIDDSMASLRRDFLPNDLKIELGRKGFQGSVAVQARQTLEETRWLLELATDASFILGVVGWVDLRSSNVRSQLEAFAVNPKLVGIRHIVQSEPNDRFLLQPEFLRGISLLEEFDLAYDLLIYPKHLPVAAEFVRRFPRQRFVLDHLAKPPIKSGSLRPWERGMRELGTLPNVFCKLSGLVTEADWQNWKPEHIVPYMDVAFETFGPRRLMIGSDWPVCTLAASYTRAIDLVESYLSQHATEVQDAALGENAQQFWKLGTRQKQLSGDSQHTVGNSKSKREGDAAHASRRGCARNEK

Samples

Sample ID Description Type Environment
1 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
72 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
73 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
74 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
103 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
105 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
106 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
107 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
108 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
109 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
110 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
111 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
112 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
113 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
114 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
115 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
116 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
117 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
118 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
119 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
120 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
122 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
123 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
124 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
125 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
126 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
127 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
128 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
129 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
130 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
131 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
132 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
133 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
134 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
135 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
136 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
137 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
138 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
139 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
140 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
141 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
142 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
143 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
144 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
145 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
146 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
155 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
156 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
157 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
158 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
159 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
160 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
161 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
162 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
163 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
164 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
165 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
166 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
167 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
168 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
169 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
170 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
171 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
172 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
173 2738541284 Pedobacter sp. YR016 Isolate Unclassified
174 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
175 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
176 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
177 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
178 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
179 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
180 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
181 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
182 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
183 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.36
Metatranscriptomes 0.38
Isolates 5.26

Biome Distribution

Category Percentage (%)
Aerial Root 0.38
Bulb 0
Endosphere 6.02
Nodule 0
Rhizoplane 3.76
Rhizosphere 86.47
Stem 0
Stem Tuber 0
Unclassified 8.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0099794_10007773 3300007265 Bacteria 4426
2 SwRhRL2b_contig_1583141 2162886007 Bacteria 3127
3 JGI24737J22298_10014389 3300001990 Bacteria 2569
4 JGI25162J39368_1000130 3300002737 Bacteria 83005
5 rootH2_10032928 3300003320 Bacteria 1281
6 rootH1_10062224 3300003316 Bacteria 2902
7 rootH1_10062224 3300003323 Bacteria 11182
8 rootH1_10156917 3300003323 Bacteria 1460
9 Ga0055535_1008390 3300003761 Bacteria 1871
10 Ga0065714_10004250 3300005288 Bacteria 8027
11 Ga0065704_10072354 3300005289 Bacteria 8680
12 Ga0065704_10097242 3300005289 Bacteria 2403
13 Ga0070658_10150174 3300005327 Bacteria 1950
14 Ga0070683_100020954 3300005329 Bacteria 5829
15 Ga0070690_100447006 3300005330 Bacteria 958
16 Ga0068868_100111438 3300005338 Unclassified 2224
17 Ga0070660_100268058 3300005339 Unclassified 1395
18 Ga0070659_100202599 3300005366 Bacteria 1634
19 Ga0070659_100232334 3300005366 Bacteria 1524
20 Ga0070709_10026424 3300005434 Bacteria 3441
21 Ga0070709_10029300 3300005434 Bacteria 3292
22 Ga0070709_10373011 3300005434 Unclassified 1059
23 Ga0070714_100031893 3300005435 Unclassified 4398
24 Ga0070714_100074602 3300005435 Bacteria 2941
25 Ga0070713_100000164 3300005436 Bacteria 44269
26 Ga0070713_100262046 3300005436 Bacteria 1580
27 Ga0070713_100611905 3300005436 Unclassified 1035
28 Ga0070710_10015235 3300005437 Bacteria 3888
29 Ga0070710_10025282 3300005437 Bacteria 3144
30 Ga0070711_100000108 3300005439 Bacteria 43211
31 Ga0070711_100078475 3300005439 Bacteria 2346
32 Ga0070708_100021463 3300005445 Bacteria 5460
33 Ga0070663_100011896 3300005455 Bacteria 5487
34 Ga0070681_10009438 3300005458 Bacteria 9603
35 Ga0070685_10029859 3300005466 Unclassified 3032
36 Ga0070706_100403821 3300005467 Bacteria 1272
37 Ga0070707_100005949 3300005468 Bacteria 11382
38 Ga0070698_100026441 3300005471 Bacteria 6041
39 Ga0070698_100072416 3300005471 Unclassified 3454
40 Ga0070698_100261987 3300005471 Bacteria 1661
41 Ga0070679_100013533 3300005530 Bacteria 7816
42 Ga0070684_100050638 3300005535 Unclassified 3608
43 Ga0070684_100342456 3300005535 Bacteria 1375
44 Ga0070697_100038330 3300005536 Bacteria 3872
45 Ga0068853_100003970 3300005539 Bacteria 11368
46 Ga0070695_100425228 3300005545 Bacteria 1012
47 Ga0068855_100007117 3300005563 Bacteria 13571
48 Ga0068855_100101628 3300005563 Bacteria 3309
49 Ga0068857_100007884 3300005577 Bacteria 9186
50 Ga0068857_100108575 3300005577 Unclassified 2493
51 Ga0068854_100012154 3300005578 Bacteria 5633
52 Ga0068856_100000956 3300005614 Bacteria 30876
53 Ga0068856_100001034 3300005614 Bacteria 29577
54 Ga0068856_100008715 3300005614 Bacteria 9866
55 Ga0068852_100011399 3300005616 Bacteria 6690
56 Ga0068852_100070577 3300005616 Unclassified 3065
57 Ga0068861_100152810 3300005719 Bacteria 1896
58 Ga0068861_100587811 3300005719 Bacteria 1020
59 Ga0068870_10174209 3300005840 Bacteria 1286
60 Ga0068858_100295892 3300005842 Bacteria 1544
61 Ga0068860_100087170 3300005843 Unclassified 2972
62 Ga0081538_10160209 3300005981 Bacteria 1001
63 Ga0070717_10002066 3300006028 Bacteria 14052
64 Ga0070717_10006005 3300006028 Bacteria 8899
65 Ga0070717_10019401 3300006028 Bacteria 5330
66 Ga0070717_10200572 3300006028 Unclassified 1747
67 Ga0070717_10276922 3300006028 Bacteria 1487
68 Ga0070715_10000722 3300006163 Bacteria 8908
69 Ga0070716_100246920 3300006173 Bacteria 1214
70 Ga0070712_100000226 3300006175 Bacteria 31684
71 Ga0070712_100194862 3300006175 Bacteria 1588
72 Ga0070712_100281666 3300006175 Bacteria 1339
73 Ga0075367_10119530 3300006178 Bacteria 1623
74 Ga0097621_100005987 3300006237 Bacteria 8599
75 Ga0068871_100411067 3300006358 Bacteria 1207
76 Ga0075436_100101276 3300006914 Bacteria 2006
77 Ga0075436_100197508 3300006914 Bacteria 1424
78 Ga0099795_10059787 3300007788 Bacteria 1411
79 Ga0099795_10072198 3300007788 Bacteria 1304
80 Ga0105240_10000996 3300009093 Bacteria 50604
81 Ga0105240_10004683 3300009093 Bacteria 20684
82 Ga0105240_10603223 3300009093 Bacteria 1208
83 Ga0105243_10186003 3300009148 Unclassified 1810
84 Ga0105241_10028265 3300009174 Bacteria 4179
85 Ga0105241_10080390 3300009174 Bacteria 2551
86 Ga0105241_10200275 3300009174 Bacteria 1667
87 Ga0105242_10004024 3300009176 Bacteria 11425
88 Ga0105237_10002720 3300009545 Bacteria 21581
89 Ga0105237_10006569 3300009545 Bacteria 12862
90 Ga0105237_10029792 3300009545 Bacteria 5544
91 Ga0105249_10029519 3300009553 Bacteria 4953
92 Ga0099796_10001593 3300010159 Bacteria 4658
93 Ga0105239_10000001 3300010375 Bacteria 617353
94 Ga0105239_10000012 3300010375 Bacteria 332279
95 Ga0105239_10000280 3300010375 Bacteria 75222
96 Ga0105239_10001779 3300010375 Bacteria 28343
97 Ga0105239_10007264 3300010375 Bacteria 12726
98 Ga0105239_10160061 3300010375 Bacteria 2515
99 Ga0105239_10211008 3300010375 Bacteria 2177
100 Ga0157373_10002161 3300013100 Bacteria 14880
101 Ga0157373_10008374 3300013100 Bacteria 7681
102 Ga0157373_10016796 3300013100 Bacteria 5335
103 Ga0157371_10001207 3300013102 Bacteria 27564
104 Ga0157371_10003341 3300013102 Bacteria 14628
105 Ga0157371_10006315 3300013102 Bacteria 9816
106 Ga0157371_10006892 3300013102 Bacteria 9275
107 Ga0157371_10041247 3300013102 Bacteria 3294
108 Ga0157370_10008543 3300013104 Bacteria 11038
109 Ga0157370_10012448 3300013104 Bacteria 8820
110 Ga0157370_10024060 3300013104 Bacteria 6038
111 Ga0157370_10033293 3300013104 Bacteria 5024
112 Ga0157370_10149378 3300013104 Bacteria 2175
113 Ga0157370_10601560 3300013104 Bacteria 1007
114 Ga0157369_10007521 3300013105 Bacteria 12540
115 Ga0157369_10037830 3300013105 Bacteria 5281
116 Ga0157369_10359958 3300013105 Bacteria 1511
117 Ga0157378_10276134 3300013297 Bacteria 1618
118 Ga0163162_10104653 3300013306 Bacteria 2925
119 Ga0157372_10000737 3300013307 Bacteria 35686
120 Ga0157372_10010016 3300013307 Bacteria 10082
121 Ga0157372_10016663 3300013307 Bacteria 7888
122 Ga0157372_10383403 3300013307 Bacteria 1638
123 Ga0157372_10680645 3300013307 Unclassified 1197
124 Ga0163163_10077545 3300014325 Bacteria 3318
125 Ga0182008_10000020 3300014497 Bacteria 228333
126 Ga0157379_10106352 3300014968 Bacteria 2519
127 Ga0163161_10051937 3300017792 Bacteria 2971
128 Ga0163161_10062406 3300017792 Bacteria 2715
129 Ga0209437_100089 3300025233 Bacteria 250476
130 Ga0209233_1009381 3300025261 Bacteria 2981
131 Ga0209233_1011289 3300025261 Bacteria 2636
132 Ga0209758_1021491 3300025297 Bacteria 3005
133 Ga0207647_10000249 3300025904 Bacteria 44055
134 Ga0207685_10000017 3300025905 Bacteria 146902
135 Ga0207685_10000995 3300025905 Bacteria 5487
136 Ga0207699_10016934 3300025906 Bacteria 3824
137 Ga0207699_10032273 3300025906 Bacteria 2949
138 Ga0207705_10124864 3300025909 Bacteria 1912
139 Ga0207684_10175081 3300025910 Bacteria 1850
140 Ga0207695_10000241 3300025913 Bacteria 142030
141 Ga0207695_10001001 3300025913 Bacteria 50058
142 Ga0207695_10158725 3300025913 Bacteria 2194
143 Ga0207671_10014324 3300025914 Bacteria 6274
144 Ga0207671_10027993 3300025914 Bacteria 4212
145 Ga0207671_10039145 3300025914 Bacteria 3512
146 Ga0207693_10000077 3300025915 Bacteria 87615
147 Ga0207663_10000092 3300025916 Bacteria 42886
148 Ga0207663_10044464 3300025916 Bacteria 2726
149 Ga0207663_10103366 3300025916 Bacteria 1919
150 Ga0207652_10011782 3300025921 Bacteria 7057
151 Ga0207652_10508217 3300025921 Bacteria 1084
152 Ga0207646_10004970 3300025922 Bacteria 14204
153 Ga0207700_10000142 3300025928 Bacteria 42825
154 Ga0207700_10185172 3300025928 Bacteria 1746
155 Ga0207664_10203511 3300025929 Bacteria 1710
156 Ga0207690_10138539 3300025932 Bacteria 1790
157 Ga0207686_10000762 3300025934 Bacteria 19805
158 Ga0207665_10000012 3300025939 Bacteria 143062
159 Ga0207665_10001764 3300025939 Bacteria 14526
160 Ga0207665_10251109 3300025939 Bacteria 1307
161 Ga0207661_10004470 3300025944 Bacteria 9823
162 Ga0207661_10642952 3300025944 Bacteria 975
163 Ga0207667_10000325 3300025949 Bacteria 66276
164 Ga0207667_10001598 3300025949 Bacteria 28473
165 Ga0207667_10060771 3300025949 Bacteria 3955
166 Ga0207712_10561698 3300025961 Unclassified 983
167 Ga0207640_10045885 3300025981 Bacteria 2809
168 Ga0207677_10024704 3300026023 Bacteria 3738
169 Ga0207703_10041653 3300026035 Bacteria 3681
170 Ga0207639_10003261 3300026041 Bacteria 10932
171 Ga0207678_10011696 3300026067 Bacteria 7702
172 Ga0207702_10000161 3300026078 Bacteria 79598
173 Ga0207702_10016715 3300026078 Bacteria 6073
174 Ga0207674_10025715 3300026116 Bacteria 6268
175 Ga0207674_10206606 3300026116 Bacteria 1913
176 Ga0207698_10004190 3300026142 Bacteria 8774
177 Ga0207698_10103866 3300026142 Bacteria 2363
178 Ga0268264_10069103 3300028381 Unclassified 2987
179 Ga0265338_10270096 3300028800 Bacteria 1246
180 Ga0265760_10040504 3300031090 Bacteria 1388
181 Ga0265325_10062060 3300031241 Bacteria 1894
182 Ga0265339_10130977 3300031249 Bacteria 1282
183 Ga0265316_10073533 3300031344 Bacteria 2632
184 Ga0316575_10073276 3300031665 Unclassified 1377
185 Ga0265314_10050800 3300031711 Bacteria 2892
186 Ga0316576_10058014 3300031727 Bacteria 2831
187 Ga0307412_10000001 3300031911 Bacteria 822691
188 Ga0307412_10014768 3300031911 Bacteria 4614
189 Ga0307412_10395755 3300031911 Bacteria 1123
190 Ga0307414_10002739 3300032004 Bacteria 9275
191 Ga0307411_10268363 3300032005 Bacteria 1352
192 Ga0373934_0014866 3300035086 Bacteria 2949
193 Ga0373955_0149965 3300035172 Bacteria 1372
194 Ga0373931_0211310 3300035691 Bacteria 1164
195 Ga0373933_0010479 3300035724 Bacteria 5083
196 Ga0373947_0024277 3300035725 Bacteria 3532
197 Ga0373937_0012143 3300036401 Bacteria 7560
198 Ga0316582_0021148 3300036647 Bacteria 3838
199 Ga0373925_0001655 3300037068 Bacteria 18786
200 Ga0395899_0000001 3300037312 Bacteria 1750322
201 Ga0395900_0031380 3300037418 Bacteria 5459
202 Ga0395900_0413941 3300037418 Bacteria 1310
203 Ga0395901_0718317 3300038443 Bacteria 995
204 Ga0466963_0406967 3300044694 Bacteria 959
205 Ga0495629_0017465 3300046459 Bacteria 5141
206 Ga0495580_0000469 3300046472 Bacteria 33524
207 Ga0495582_0002349 3300046473 Bacteria 10587
208 Ga0495632_0069524 3300046519 Bacteria 1695
209 Ga0495658_0129454 3300046683 Bacteria 1535
210 Ga0495613_0073568 3300046689 Bacteria 2490
211 Ga0495604_0123282 3300047317 Unclassified 1873
212 Ga0495674_0071849 3300047319 Bacteria 2986
213 Ga0495675_0172624 3300047444 Bacteria 1327
214 Ga0495684_0111154 3300047471 Bacteria 2068
215 Ga0495686_0000712 3300047472 Bacteria 44730
216 Ga0495686_0001566 3300047472 Bacteria 24335
217 Ga0495602_0112830 3300048088 Bacteria 2205
218 Ga0496101_0060434 3300048904 Bacteria 2750
219 Ga0496102_0014502 3300048905 Bacteria 6846
220 Ga0496103_0005315 3300048906 Bacteria 7717
221 Ga0496104_0071513 3300048907 Bacteria 3298
222 Ga0496106_0114702 3300048909 Bacteria 2101
223 Ga0496107_0009554 3300048910 Bacteria 6728
224 Ga0496112_0346504 3300048915 Bacteria 1428
225 Ga0496114_0238397 3300048917 Bacteria 1599
226 Ga0496114_0281608 3300048917 Unclassified 1466
227 Ga0496115_0002718 3300048918 Bacteria 12710
228 Ga0501032_0058544 3300049569 Bacteria 2587
229 Ga0501034_0008943 3300049571 Bacteria 10531
230 Ga0501036_0005085 3300049572 Bacteria 10644
231 Ga0501038_0018011 3300049574 Bacteria 6379
232 Ga0501042_0006158 3300049578 Bacteria 7779
233 Ga0501043_0003534 3300049579 Bacteria 12844
234 Ga0501047_0000488 3300049581 Bacteria 43198
235 Ga0501047_0104467 3300049581 Bacteria 2713
236 Ga0501048_0001439 3300049582 Bacteria 18056
237 Ga0501073_0013160 3300049589 Bacteria 6031
238 Ga0501074_0010022 3300049590 Bacteria 6878
239 Ga0501223_022644 3300049663 Unclassified 1227
240 Ga0501044_0039303 3300049823 Bacteria 4936
241 nmdc:mga0k408_217583_c1 3300050493 Unclassified 1140
242 nmdc:mga0n895_267516_c1 3300050512 Bacteria 1734
243 nmdc:mga08x19_104636_c1 3300050514 Bacteria 1881
244 nmdc:mga08x19_450767_c1 3300050514 Unclassified 906
245 Ga0500635_0003154 3300053080 Bacteria 4119
246 Ga0500651_0000357 3300053093 Bacteria 25575
247 Ga0500569_000373 3300053109 Bacteria 7281
248 Ga0500658_0004223 3300053134 Bacteria 5393
249 Ga0500577_0000115 3300053142 Bacteria 19663
250 Ga0500588_0001068 3300053146 Bacteria 4981
251 Ga0500616_0020988 3300053153 Bacteria 3666
252 Ga0500661_003520 3300055283 Bacteria 2939
253 Ga0530510_0263064 3300061734 Bacteria 1287
254 2510284160 2510065053 Bacteria 5005518
255 2510293164 2510065055 Bacteria 5037935
256 2510312658 2510065058 Bacteria 5005894
257 2738763270 2738541284 Bacteria 5199923
258 2774130544 2773857672 Bacteria 4993178
259 2776616124 2775506987 Bacteria 5373360
260 2837269489 2837268691 Bacteria 7850704
261 2844853141 2844852863 Bacteria 3849151
262 2919483566 2919481497 Bacteria 6907839
263 2929241404 2929239360 Bacteria 7745570
264 2974301569 2974298342 Bacteria 4840922
265 2984504012 2984499530 Bacteria 5020881
266 3006497285 3006493962 Bacteria 8825450
267 8056038414 8056037122 Bacteria 3854319
268 Ga0099794_10007773
269 SwRhRL2b_contig_1583141
270 JGI24737J22298_10014389
271 JGI25162J39368_1000130
272 rootH2_10032928
273 rootH1_10062224
274 rootH1_10156917
275 Ga0055535_1008390
276 Ga0065714_10004250
277 Ga0065704_10072354
278 Ga0065704_10097242
279 Ga0070658_10150174
280 Ga0070683_100020954
281 Ga0070690_100447006
282 Ga0068868_100111438
283 Ga0070660_100268058
284 Ga0070659_100202599
285 Ga0070659_100232334
286 Ga0070709_10026424
287 Ga0070709_10029300
288 Ga0070709_10373011
289 Ga0070714_100031893
290 Ga0070714_100074602
291 Ga0070713_100000164
292 Ga0070713_100262046
293 Ga0070713_100611905
294 Ga0070710_10015235
295 Ga0070710_10025282
296 Ga0070711_100000108
297 Ga0070711_100078475
298 Ga0070708_100021463
299 Ga0070663_100011896
300 Ga0070681_10009438
301 Ga0070685_10029859
302 Ga0070706_100403821
303 Ga0070707_100005949
304 Ga0070698_100026441
305 Ga0070698_100072416
306 Ga0070698_100261987
307 Ga0070679_100013533
308 Ga0070684_100050638
309 Ga0070684_100342456
310 Ga0070697_100038330
311 Ga0068853_100003970
312 Ga0070695_100425228
313 Ga0068855_100007117
314 Ga0068855_100101628
315 Ga0068857_100007884
316 Ga0068857_100108575
317 Ga0068854_100012154
318 Ga0068856_100000956
319 Ga0068856_100001034
320 Ga0068856_100008715
321 Ga0068852_100011399
322 Ga0068852_100070577
323 Ga0068861_100152810
324 Ga0068861_100587811
325 Ga0068870_10174209
326 Ga0068858_100295892
327 Ga0068860_100087170
328 Ga0081538_10160209
329 Ga0070717_10002066
330 Ga0070717_10006005
331 Ga0070717_10019401
332 Ga0070717_10200572
333 Ga0070717_10276922
334 Ga0070715_10000722
335 Ga0070716_100246920
336 Ga0070712_100000226
337 Ga0070712_100194862
338 Ga0070712_100281666
339 Ga0075367_10119530
340 Ga0097621_100005987
341 Ga0068871_100411067
342 Ga0075436_100101276
343 Ga0075436_100197508
344 Ga0099795_10059787
345 Ga0099795_10072198
346 Ga0105240_10000996
347 Ga0105240_10004683
348 Ga0105240_10603223
349 Ga0105243_10186003
350 Ga0105241_10028265
351 Ga0105241_10080390
352 Ga0105241_10200275
353 Ga0105242_10004024
354 Ga0105237_10002720
355 Ga0105237_10006569
356 Ga0105237_10029792
357 Ga0105249_10029519
358 Ga0099796_10001593
359 Ga0105239_10000001
360 Ga0105239_10000012
361 Ga0105239_10000280
362 Ga0105239_10001779
363 Ga0105239_10007264
364 Ga0105239_10160061
365 Ga0105239_10211008
366 Ga0157373_10002161
367 Ga0157373_10008374
368 Ga0157373_10016796
369 Ga0157371_10001207
370 Ga0157371_10003341
371 Ga0157371_10006315
372 Ga0157371_10006892
373 Ga0157371_10041247
374 Ga0157370_10008543
375 Ga0157370_10012448
376 Ga0157370_10024060
377 Ga0157370_10033293
378 Ga0157370_10149378
379 Ga0157370_10601560
380 Ga0157369_10007521
381 Ga0157369_10037830
382 Ga0157369_10359958
383 Ga0157378_10276134
384 Ga0163162_10104653
385 Ga0157372_10000737
386 Ga0157372_10010016
387 Ga0157372_10016663
388 Ga0157372_10383403
389 Ga0157372_10680645
390 Ga0163163_10077545
391 Ga0182008_10000020
392 Ga0157379_10106352
393 Ga0163161_10051937
394 Ga0163161_10062406
395 Ga0209437_100089
396 Ga0209233_1009381
397 Ga0209233_1011289
398 Ga0209758_1021491
399 Ga0207647_10000249
400 Ga0207685_10000017
401 Ga0207685_10000995
402 Ga0207699_10016934
403 Ga0207699_10032273
404 Ga0207705_10124864
405 Ga0207684_10175081
406 Ga0207695_10000241
407 Ga0207695_10001001
408 Ga0207695_10158725
409 Ga0207671_10014324
410 Ga0207671_10027993
411 Ga0207671_10039145
412 Ga0207693_10000077
413 Ga0207663_10000092
414 Ga0207663_10044464
415 Ga0207663_10103366
416 Ga0207652_10011782
417 Ga0207652_10508217
418 Ga0207646_10004970
419 Ga0207700_10000142
420 Ga0207700_10185172
421 Ga0207664_10203511
422 Ga0207690_10138539
423 Ga0207686_10000762
424 Ga0207665_10000012
425 Ga0207665_10001764
426 Ga0207665_10251109
427 Ga0207661_10004470
428 Ga0207661_10642952
429 Ga0207667_10000325
430 Ga0207667_10001598
431 Ga0207667_10060771
432 Ga0207712_10561698
433 Ga0207640_10045885
434 Ga0207677_10024704
435 Ga0207703_10041653
436 Ga0207639_10003261
437 Ga0207678_10011696
438 Ga0207702_10000161
439 Ga0207702_10016715
440 Ga0207674_10025715
441 Ga0207674_10206606
442 Ga0207698_10004190
443 Ga0207698_10103866
444 Ga0268264_10069103
445 Ga0265338_10270096
446 Ga0265760_10040504
447 Ga0265325_10062060
448 Ga0265339_10130977
449 Ga0265316_10073533
450 Ga0316575_10073276
451 Ga0265314_10050800
452 Ga0316576_10058014
453 Ga0307412_10000001
454 Ga0307412_10014768
455 Ga0307412_10395755
456 Ga0307414_10002739
457 Ga0307411_10268363
458 Ga0373934_0014866
459 Ga0373955_0149965
460 Ga0373931_0211310
461 Ga0373933_0010479
462 Ga0373947_0024277
463 Ga0373937_0012143
464 Ga0316582_0021148
465 Ga0373925_0001655
466 Ga0395899_0000001
467 Ga0395900_0031380
468 Ga0395900_0413941
469 Ga0395901_0718317
470 Ga0466963_0406967
471 Ga0495629_0017465
472 Ga0495580_0000469
473 Ga0495582_0002349
474 Ga0495632_0069524
475 Ga0495658_0129454
476 Ga0495613_0073568
477 Ga0495604_0123282
478 Ga0495674_0071849
479 Ga0495675_0172624
480 Ga0495684_0111154
481 Ga0495686_0000712
482 Ga0495686_0001566
483 Ga0495602_0112830
484 Ga0496101_0060434
485 Ga0496102_0014502
486 Ga0496103_0005315
487 Ga0496104_0071513
488 Ga0496106_0114702
489 Ga0496107_0009554
490 Ga0496112_0346504
491 Ga0496114_0238397
492 Ga0496114_0281608
493 Ga0496115_0002718
494 Ga0501032_0058544
495 Ga0501034_0008943
496 Ga0501036_0005085
497 Ga0501038_0018011
498 Ga0501042_0006158
499 Ga0501043_0003534
500 Ga0501047_0000488
501 Ga0501047_0104467
502 Ga0501048_0001439
503 Ga0501073_0013160
504 Ga0501074_0010022
505 Ga0501223_022644
506 Ga0501044_0039303
507 nmdc:mga0k408_217583_c1
508 nmdc:mga0n895_267516_c1
509 nmdc:mga08x19_104636_c1
510 nmdc:mga08x19_450767_c1
511 Ga0500635_0003154
512 Ga0500651_0000357
513 Ga0500569_000373
514 Ga0500658_0004223
515 Ga0500577_0000115
516 Ga0500588_0001068
517 Ga0500616_0020988
518 Ga0500661_003520
519 Ga0530510_0263064
520 2510284160
521 2510293164
522 2510312658
523 2738763270
524 2774130544
525 2776616124
526 2837269489
527 2844853141
528 2919483566
529 2929241404
530 2974301569
531 2984504012
532 3006497285
533 8056038414

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04909

Amidohydro_2

Amidohydrolase

3

275

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4do7-assembly2.cif.gz_B crystal structure of an amidohydrolase (cog3618) from burkholderia multivorans (target efi-500235) with bound zn, space group c2 0.9736 1 277
4do7-assembly2.cif.gz_B crystal structure of an amidohydrolase (cog3618) from burkholderia multivorans (target efi-500235) with bound zn, space group c2 0.9701 1 277
4dnm-assembly1.cif.gz_A crystal structure of an amidohydrolase (cog3618) from burkholderia multivorans (target efi-500235) with bound hepes, space group p3221 0.9679 1 277
4dnm-assembly1.cif.gz_A crystal structure of an amidohydrolase (cog3618) from burkholderia multivorans (target efi-500235) with bound hepes, space group p3221 0.9645 1 277
6uvz-assembly3.cif.gz_C error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8321 1 277
ID Description Score Start End Superfamily
4do7B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9736 1 277 3.20.20.140
4do7B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9701 1 277 3.20.20.140
af_A0A0P0W9I9_79_364_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8072 2 274 3.20.20.140
4i6kA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8061 1 275 3.20.20.140
2ffiA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8029 2 275 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A4Q6A7L9-F1-model_v4 Amidohydrolase 0.9998 39 276 GO:0016787
AF-A0A353E271-F1-model_v4 Amidohydrolase 0.9987 168 277 GO:0016787
AF-X1P4S4-F1-model_v4 Amidohydrolase-related domain-containing protein 0.9985 65 277 GO:0016787
AF-A0A1G0P367-F1-model_v4 Amidohydrolase 0.9977 2 275 GO:0016787
AF-A0A4Q5YT14-F1-model_v4 Amidohydrolase 0.9975 2 223 GO:0016787

Map