F374001

General Info

Members Datasets Scaffolds Average Seq Length
266 176 532 298

Family's Representative Sequence

Representative Sequence 3300006852|Ga0075433_10105289|Ga0075433_101052893
Length 354
Sequence MSQLGVKRTWVDAPHMSAFDPKRTCQFVVQGASQVVSAALRSAWRLIYRGSDMQVEFVTTDVFTDRQFGGNPLAVVSNGTGLSTSQMQAIAAEFNLAETTFVLPPEKPENTAKVRIFTPRAELPFAGHPNVGTAFVLGQRGECHGRPIQGNTLQFEEIAGLVRIELWRDASAVIGARLAAPQPLAVIEDVEPEVIAEVCTISATDIETGHHRPCIASCGMSFVFAELKDLRALAAAQPRTDAFARHLPMDRVTGVHLYVRDSSNGSDIQSRMFAPLYGVPEDPATGSANVALIGLLAHLHPEADLRLAKTIRQGIEMGRPSRLMASADKSAGRVIATQIGGTCVPMMRGVLELR

Samples

Sample ID Description Type Environment
1 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
4 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
18 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
19 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
20 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
21 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
22 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
23 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
24 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
25 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
28 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
37 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
38 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
39 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
40 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
41 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
42 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
43 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
44 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
45 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
57 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
59 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
60 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
61 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
62 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
63 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
64 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
65 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
66 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
67 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
68 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
69 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
70 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
71 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
72 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
73 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
74 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
75 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
76 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
77 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
78 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
79 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
80 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
81 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
82 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
83 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
84 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
85 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
86 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
87 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
88 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
89 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
90 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
91 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
92 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
93 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
94 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
95 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
96 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
97 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
98 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
99 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
100 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
101 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
102 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
103 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
104 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
105 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
106 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
107 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
108 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
109 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
110 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
111 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
112 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
113 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
114 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
115 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
116 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
117 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
118 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
119 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
120 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
121 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
122 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
123 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
124 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
125 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
126 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
127 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
128 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
129 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
130 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
131 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
132 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
133 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
134 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
135 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
136 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
137 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
138 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
139 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
140 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
141 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
142 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
143 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
144 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
145 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
146 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
147 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
148 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
149 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
150 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
151 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
152 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
153 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
154 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
155 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
156 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
157 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
158 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
159 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
161 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
162 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
163 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
164 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
165 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
166 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
167 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
168 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
169 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
170 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
171 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
172 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
173 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
174 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
175 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
176 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.12
Metatranscriptomes 1.13
Isolates 0.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.76
Nodule 0
Rhizoplane 9.77
Rhizosphere 81.2
Stem 0
Stem Tuber 0
Unclassified 4.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075433_10105289 3300006852 Bacteria 2499
2 Ga0070670_100126716 3300005331 Bacteria 2204
3 Ga0070671_100270220 3300005355 Bacteria 1445
4 Ga0070673_100206498 3300005364 Unclassified 1694
5 Ga0070709_10110360 3300005434 Bacteria 1848
6 Ga0070713_100013434 3300005436 Bacteria 6046
7 Ga0070713_100637950 3300005436 Bacteria 1014
8 Ga0070710_10097334 3300005437 Bacteria 1746
9 Ga0070711_100004860 3300005439 Bacteria 7978
10 Ga0070700_100295517 3300005441 Bacteria 1180
11 Ga0070694_100165410 3300005444 Bacteria 1626
12 Ga0070708_100035838 3300005445 Bacteria 4324
13 Ga0070681_10506705 3300005458 Bacteria 1120
14 Ga0068867_100106791 3300005459 Bacteria 2145
15 Ga0070706_100322030 3300005467 Bacteria 1442
16 Ga0070679_100045370 3300005530 Bacteria 4380
17 Ga0070697_100265895 3300005536 Bacteria 1469
18 Ga0068864_100583537 3300005618 Bacteria 1083
19 Ga0068862_100000992 3300005844 Bacteria 27151
20 Ga0081455_10006235 3300005937 Bacteria 12842
21 Ga0081455_10006355 3300005937 Bacteria 12683
22 Ga0081540_1033274 3300005983 Bacteria 2802
23 Ga0075365_10023274 3300006038 Bacteria 3894
24 Ga0075365_10043823 3300006038 Bacteria 2930
25 Ga0075365_10118026 3300006038 Bacteria 1828
26 Ga0075432_10079560 3300006058 Bacteria 1187
27 Ga0075362_10014215 3300006177 Bacteria 3207
28 Ga0075430_100026700 3300006846 Bacteria 4911
29 Ga0075430_100053443 3300006846 Bacteria 3401
30 Ga0075431_100061085 3300006847 Bacteria 3889
31 Ga0075431_100189100 3300006847 Bacteria 2110
32 Ga0075433_10105388 3300006852 Bacteria 2498
33 Ga0075434_100159789 3300006871 Bacteria 2273
34 Ga0068865_100052225 3300006881 Bacteria 2832
35 Ga0099794_10008757 3300007265 Bacteria 4215
36 Ga0105240_10021842 3300009093 Bacteria 8503
37 Ga0111539_10215523 3300009094 Bacteria 2236
38 Ga0114129_10016330 3300009147 Bacteria 10568
39 Ga0114129_10282189 3300009147 Bacteria 2219
40 Ga0114129_11130407 3300009147 Bacteria 979
41 Ga0105243_10039827 3300009148 Bacteria 3666
42 Ga0105248_10006126 3300009177 Bacteria 13196
43 Ga0105238_10321709 3300009551 Bacteria 1533
44 Ga0105249_10520849 3300009553 Bacteria 1236
45 Ga0163162_10023884 3300013306 Bacteria 6033
46 Ga0163163_10398959 3300014325 Unclassified 1434
47 Ga0182008_10051226 3300014497 Bacteria 2048
48 Ga0157376_10119730 3300014969 Bacteria 2331
49 Ga0182006_1014686 3300015261 Bacteria 3372
50 Ga0213874_10074770 3300021377 Bacteria 1087
51 Ga0213876_10127624 3300021384 Bacteria 1351
52 Ga0213875_10001744 3300021388 Bacteria 13628
53 Ga0213875_10077267 3300021388 Bacteria 1554
54 Ga0224572_1006535 3300024225 Bacteria 2111
55 Ga0207647_10025522 3300025904 Bacteria 3881
56 Ga0207699_10184446 3300025906 Bacteria 1404
57 Ga0207695_10030745 3300025913 Bacteria 5908
58 Ga0207652_10052345 3300025921 Bacteria 3504
59 Ga0207700_10593386 3300025928 Bacteria 985
60 Ga0207664_10114120 3300025929 Bacteria 2251
61 Ga0207644_10022426 3300025931 Bacteria 4315
62 Ga0207644_10059680 3300025931 Bacteria 2759
63 Ga0207644_10234030 3300025931 Bacteria 1461
64 Ga0207704_10052977 3300025938 Bacteria 2463
65 Ga0207711_10143675 3300025941 Unclassified 2148
66 Ga0207708_10007195 3300026075 Bacteria 8229
67 Ga0207674_10024659 3300026116 Bacteria 6422
68 Ga0207428_10002317 3300027907 Bacteria 19065
69 Ga0268265_10000501 3300028380 Bacteria 40501
70 Ga0265334_10009271 3300028573 Bacteria 4164
71 Ga0265760_10087059 3300031090 Unclassified 974
72 Ga0316575_10003861 3300031665 Bacteria 5230
73 Ga0316579_10012146 3300031691 Bacteria 3678
74 Ga0265314_10009509 3300031711 Bacteria 8196
75 Ga0265314_10025192 3300031711 Bacteria 4493
76 Ga0316578_10022798 3300031728 Bacteria 3496
77 Ga0316577_10010428 3300031733 Bacteria 5016
78 Ga0316583_10012369 3300032133 Bacteria 3078
79 Ga0316585_10004793 3300032137 Bacteria 3790
80 Ga0316580_10005835 3300032139 Bacteria 3613
81 Ga0316593_10097242 3300032168 Bacteria 1041
82 Ga0316596_1002769 3300033541 Bacteria 3782
83 Ga0373930_0012707 3300034816 Bacteria 1541
84 Ga0373926_0042298 3300035083 Bacteria 1629
85 Ga0373944_0006637 3300035089 Unclassified 3075
86 Ga0373923_0023407 3300035111 Bacteria 2430
87 Ga0373936_0004135 3300035113 Bacteria 5473
88 Ga0373945_0003041 3300035116 Bacteria 5273
89 Ga0373953_0008880 3300035117 Bacteria 3433
90 Ga0373953_0048560 3300035117 Bacteria 1710
91 Ga0373954_0210271 3300035118 Unclassified 956
92 Ga0373956_0080833 3300035119 Bacteria 1491
93 Ga0373943_0009871 3300035170 Bacteria 4275
94 Ga0373946_0001307 3300035171 Bacteria 8617
95 Ga0373955_0009090 3300035172 Bacteria 4640
96 Ga0373924_0032826 3300035410 Bacteria 2093
97 Ga0373924_0062332 3300035410 Bacteria 1562
98 Ga0373924_0120973 3300035410 Bacteria 1136
99 Ga0373931_0042730 3300035691 Unclassified 2384
100 Ga0373935_0013616 3300035692 Bacteria 4910
101 Ga0373935_0185171 3300035692 Bacteria 1431
102 Ga0373927_0000739 3300035695 Bacteria 24968
103 Ga0373927_0006556 3300035695 Bacteria 7929
104 Ga0373927_0018951 3300035695 Bacteria 4515
105 Ga0373927_0107323 3300035695 Bacteria 1819
106 Ga0373933_0000205 3300035724 Bacteria 39388
107 Ga0373933_0003800 3300035724 Bacteria 8346
108 Ga0373947_0016685 3300035725 Bacteria 4219
109 Ga0373947_0030630 3300035725 Bacteria 3162
110 Ga0373947_0052403 3300035725 Bacteria 2458
111 Ga0373947_0156456 3300035725 Bacteria 1471
112 Ga0373937_0018380 3300036401 Bacteria 6243
113 Ga0373937_0019399 3300036401 Bacteria 6086
114 Ga0373937_0066979 3300036401 Bacteria 3308
115 Ga0373937_0083147 3300036401 Bacteria 2962
116 Ga0316582_0017632 3300036647 Bacteria 4136
117 Ga0316584_0015212 3300036712 Bacteria 5498
118 Ga0373925_0023843 3300037068 Bacteria 4464
119 Ga0373925_0092359 3300037068 Bacteria 2315
120 Ga0395899_0052443 3300037312 Bacteria 3023
121 Ga0395900_0006833 3300037418 Bacteria 11839
122 Ga0395900_0012182 3300037418 Bacteria 8791
123 Ga0395898_0031432 3300037466 Bacteria 5304
124 Ga0316581_0003180 3300037588 Bacteria 4056
125 Ga0436364_0385885 3300037853 Bacteria 4042
126 Ga0436364_0621060 3300037853 Bacteria 18950
127 Ga0436364_1201996 3300037853 Bacteria 2411
128 Ga0436364_1538316 3300037853 Bacteria 3186
129 Ga0395901_0001121 3300038443 Bacteria 28447
130 Ga0395901_0007415 3300038443 Bacteria 11066
131 Ga0436365_0360252 3300039437 Bacteria 1625
132 Ga0436365_0646688 3300039437 Bacteria 1056
133 Ga0436360_0359250 3300039438 Bacteria 1612
134 Ga0436360_0579912 3300039438 Bacteria 7163
135 Ga0436363_0364434 3300039450 Bacteria 2069
136 Ga0436362_0467063 3300039453 Bacteria 5884
137 Ga0466967_0010527 3300045976 Bacteria 6944
138 Ga0466967_0538608 3300045976 Bacteria 1148
139 Ga0495592_0001581 3300046454 Bacteria 15887
140 Ga0495592_0022968 3300046454 Bacteria 4746
141 Ga0495592_0163657 3300046454 Bacteria 1529
142 Ga0495592_0205293 3300046454 Unclassified 1327
143 Ga0495603_0005043 3300046455 Bacteria 7890
144 Ga0495629_0000117 3300046459 Bacteria 70838
145 Ga0495629_0215862 3300046459 Bacteria 1324
146 Ga0495641_0002234 3300046461 Bacteria 15449
147 Ga0495641_0024740 3300046461 Bacteria 2958
148 Ga0495653_0119301 3300046463 Bacteria 1883
149 Ga0495580_0004634 3300046472 Bacteria 11548
150 Ga0495580_0034737 3300046472 Bacteria 3628
151 Ga0495580_0190120 3300046472 Bacteria 1416
152 Ga0495582_0000648 3300046473 Bacteria 19122
153 Ga0495639_0000163 3300046475 Bacteria 34576
154 Ga0495662_0000078 3300046476 Bacteria 34824
155 Ga0495662_0068530 3300046476 Bacteria 1718
156 Ga0495664_0132805 3300046477 Bacteria 1508
157 Ga0495594_0003919 3300046499 Bacteria 7653
158 Ga0495594_0034838 3300046499 Bacteria 2740
159 Ga0495608_0001149 3300046511 Bacteria 18746
160 Ga0495618_0080686 3300046514 Bacteria 2076
161 Ga0495628_0124172 3300046516 Bacteria 1978
162 Ga0495628_0232068 3300046516 Bacteria 1383
163 Ga0495628_0303739 3300046516 Unclassified 1181
164 Ga0495630_0010491 3300046517 Bacteria 6692
165 Ga0495630_0011086 3300046517 Bacteria 6520
166 Ga0495630_0038136 3300046517 Bacteria 3594
167 Ga0495630_0129262 3300046517 Bacteria 1918
168 Ga0495666_0024141 3300046526 Bacteria 3005
169 Ga0495666_0102736 3300046526 Bacteria 1346
170 Ga0495652_0031052 3300046529 Bacteria 4681
171 Ga0495652_0117920 3300046529 Bacteria 2122
172 Ga0495665_0000296 3300046531 Bacteria 25045
173 Ga0495640_0023919 3300046533 Bacteria 4444
174 Ga0495640_0041954 3300046533 Bacteria 3195
175 Ga0495640_0104507 3300046533 Bacteria 1856
176 Ga0495640_0262802 3300046533 Bacteria 1078
177 Ga0495622_0002444 3300046557 Bacteria 9006
178 Ga0495667_0006355 3300046559 Bacteria 8015
179 Ga0495634_0000996 3300046642 Bacteria 26710
180 Ga0495634_0003062 3300046642 Bacteria 13607
181 Ga0495611_0028305 3300046648 Bacteria 2453
182 Ga0495635_0000514 3300046663 Bacteria 24491
183 Ga0495635_0143326 3300046663 Bacteria 1627
184 Ga0495635_0299047 3300046663 Bacteria 1079
185 Ga0495588_0005009 3300046674 Bacteria 5882
186 Ga0495646_0327518 3300046680 Bacteria 806
187 Ga0495647_0000732 3300046681 Bacteria 9712
188 Ga0495647_0004457 3300046681 Bacteria 4550
189 Ga0495658_0033113 3300046683 Unclassified 2828
190 Ga0495658_0047856 3300046683 Bacteria 2409
191 Ga0495658_0149636 3300046683 Bacteria 1433
192 Ga0495613_0001521 3300046689 Bacteria 17651
193 Ga0495613_0068999 3300046689 Bacteria 2578
194 Ga0495613_0078342 3300046689 Bacteria 2404
195 Ga0495624_0002980 3300046690 Bacteria 12661
196 Ga0495624_0008293 3300046690 Bacteria 7263
197 Ga0495624_0106424 3300046690 Bacteria 1726
198 Ga0495600_0013461 3300046809 Bacteria 5140
199 Ga0495581_0000222 3300047315 Bacteria 26831
200 Ga0495581_0046224 3300047315 Bacteria 2515
201 Ga0495581_0084935 3300047315 Bacteria 1835
202 Ga0495604_0005366 3300047317 Bacteria 10165
203 Ga0495674_0001713 3300047319 Bacteria 21564
204 Ga0495674_0052654 3300047319 Bacteria 3581
205 Ga0495674_0062723 3300047319 Bacteria 3235
206 Ga0495674_0100123 3300047319 Bacteria 2466
207 Ga0495674_0170700 3300047319 Bacteria 1815
208 Ga0495676_0051466 3300047321 Bacteria 3294
209 Ga0495680_0001126 3300047322 Bacteria 29477
210 Ga0495680_0093832 3300047322 Bacteria 2246
211 Ga0495684_0029470 3300047471 Bacteria 4212
212 Ga0495593_0000476 3300047673 Bacteria 22569
213 Ga0495593_0008794 3300047673 Bacteria 5864
214 Ga0495614_0024876 3300048089 Bacteria 2584
215 Ga0496100_0004716 3300048903 Bacteria 7268
216 Ga0496101_0013382 3300048904 Bacteria 5493
217 Ga0496101_0092437 3300048904 Unclassified 2252
218 Ga0496102_0358178 3300048905 Bacteria 1373
219 Ga0496103_0161023 3300048906 Bacteria 1439
220 Ga0496104_0002323 3300048907 Bacteria 16428
221 Ga0496104_0024156 3300048907 Bacteria 5592
222 Ga0496104_0482018 3300048907 Bacteria 1152
223 Ga0496105_0031263 3300048908 Bacteria 4365
224 Ga0496106_0009386 3300048909 Bacteria 7229
225 Ga0496107_0005390 3300048910 Bacteria 8752
226 Ga0496107_0167154 3300048910 Bacteria 1631
227 Ga0496108_0028765 3300048911 Bacteria 4598
228 Ga0496108_0065596 3300048911 Bacteria 3060
229 Ga0496109_0009764 3300048912 Bacteria 8191
230 Ga0496109_0033892 3300048912 Bacteria 4596
231 Ga0496109_0103264 3300048912 Bacteria 2645
232 Ga0496110_0002430 3300048913 Bacteria 13955
233 Ga0496110_0008784 3300048913 Bacteria 8141
234 Ga0496111_0012229 3300048914 Bacteria 5806
235 Ga0496111_0033031 3300048914 Bacteria 3691
236 Ga0496112_0008924 3300048915 Bacteria 8999
237 Ga0496112_0020302 3300048915 Bacteria 6294
238 Ga0496112_0337167 3300048915 Unclassified 1451
239 Ga0496113_0165735 3300048916 Bacteria 1748
240 Ga0496115_0095400 3300048918 Bacteria 2434
241 Ga0496118_0176268 3300048921 Bacteria 1298
242 Ga0496126_0088524 3300048929 Bacteria 2727
243 Ga0501034_0233125 3300049571 Bacteria 1789
244 Ga0501069_0089251 3300049585 Bacteria 1743
245 nmdc:mga00v17_94354_c1 3300050491 Bacteria 1882
246 nmdc:mga0yw44_153777_c1 3300050492 Bacteria 1502
247 nmdc:mga0yw44_251884_c1 3300050492 Bacteria 1175
248 nmdc:mga0k408_55111_c1 3300050493 Bacteria 2305
249 nmdc:mga05p37_163364_c1 3300050507 Bacteria 2719
250 nmdc:mga05p37_686_c1 3300050507 Bacteria 37503
251 nmdc:mga09592_6024_c1 3300050508 Bacteria 9892
252 nmdc:mga09592_6623_c1 3300050508 Bacteria 9438
253 nmdc:mga0qj67_35903_c1 3300050509 Bacteria 3876
254 nmdc:mga0qj67_53409_c1 3300050509 Bacteria 3199
255 nmdc:mga0qj67_5690_c1 3300050509 Bacteria 9114
256 nmdc:mga06r32_6630_c1 3300050510 Bacteria 10406
257 nmdc:mga08y16_38581_c1 3300050511 Bacteria 5015
258 nmdc:mga0rr50_115521_c1 3300050513 Bacteria 2130
259 nmdc:mga0a205_119581_c1 3300050515 Bacteria 2533
260 nmdc:mga0a205_39837_c1 3300050515 Bacteria 4523
261 Ga0495601_0161590 3300053077 Bacteria 1464
262 Ga0495619_0085493 3300053085 Bacteria 2130
263 Ga0500641_0000660 3300053096 Bacteria 12418
264 Ga0500636_0032159 3300053177 Bacteria 3105
265 2585283815 2582581308 Bacteria 7413247
266 8054564737 8054563764 Bacteria 5592885
267 Ga0075433_10105289
268 Ga0070670_100126716
269 Ga0070671_100270220
270 Ga0070673_100206498
271 Ga0070709_10110360
272 Ga0070713_100013434
273 Ga0070713_100637950
274 Ga0070710_10097334
275 Ga0070711_100004860
276 Ga0070700_100295517
277 Ga0070694_100165410
278 Ga0070708_100035838
279 Ga0070681_10506705
280 Ga0068867_100106791
281 Ga0070706_100322030
282 Ga0070679_100045370
283 Ga0070697_100265895
284 Ga0068864_100583537
285 Ga0068862_100000992
286 Ga0081455_10006235
287 Ga0081455_10006355
288 Ga0081540_1033274
289 Ga0075365_10023274
290 Ga0075365_10043823
291 Ga0075365_10118026
292 Ga0075432_10079560
293 Ga0075362_10014215
294 Ga0075430_100026700
295 Ga0075430_100053443
296 Ga0075431_100061085
297 Ga0075431_100189100
298 Ga0075433_10105388
299 Ga0075434_100159789
300 Ga0068865_100052225
301 Ga0099794_10008757
302 Ga0105240_10021842
303 Ga0111539_10215523
304 Ga0114129_10016330
305 Ga0114129_10282189
306 Ga0114129_11130407
307 Ga0105243_10039827
308 Ga0105248_10006126
309 Ga0105238_10321709
310 Ga0105249_10520849
311 Ga0163162_10023884
312 Ga0163163_10398959
313 Ga0182008_10051226
314 Ga0157376_10119730
315 Ga0182006_1014686
316 Ga0213874_10074770
317 Ga0213876_10127624
318 Ga0213875_10001744
319 Ga0213875_10077267
320 Ga0224572_1006535
321 Ga0207647_10025522
322 Ga0207699_10184446
323 Ga0207695_10030745
324 Ga0207652_10052345
325 Ga0207700_10593386
326 Ga0207664_10114120
327 Ga0207644_10022426
328 Ga0207644_10059680
329 Ga0207644_10234030
330 Ga0207704_10052977
331 Ga0207711_10143675
332 Ga0207708_10007195
333 Ga0207674_10024659
334 Ga0207428_10002317
335 Ga0268265_10000501
336 Ga0265334_10009271
337 Ga0265760_10087059
338 Ga0316575_10003861
339 Ga0316579_10012146
340 Ga0265314_10009509
341 Ga0265314_10025192
342 Ga0316578_10022798
343 Ga0316577_10010428
344 Ga0316583_10012369
345 Ga0316585_10004793
346 Ga0316580_10005835
347 Ga0316593_10097242
348 Ga0316596_1002769
349 Ga0373930_0012707
350 Ga0373926_0042298
351 Ga0373944_0006637
352 Ga0373923_0023407
353 Ga0373936_0004135
354 Ga0373945_0003041
355 Ga0373953_0008880
356 Ga0373953_0048560
357 Ga0373954_0210271
358 Ga0373956_0080833
359 Ga0373943_0009871
360 Ga0373946_0001307
361 Ga0373955_0009090
362 Ga0373924_0032826
363 Ga0373924_0062332
364 Ga0373924_0120973
365 Ga0373931_0042730
366 Ga0373935_0013616
367 Ga0373935_0185171
368 Ga0373927_0000739
369 Ga0373927_0006556
370 Ga0373927_0018951
371 Ga0373927_0107323
372 Ga0373933_0000205
373 Ga0373933_0003800
374 Ga0373947_0016685
375 Ga0373947_0030630
376 Ga0373947_0052403
377 Ga0373947_0156456
378 Ga0373937_0018380
379 Ga0373937_0019399
380 Ga0373937_0066979
381 Ga0373937_0083147
382 Ga0316582_0017632
383 Ga0316584_0015212
384 Ga0373925_0023843
385 Ga0373925_0092359
386 Ga0395899_0052443
387 Ga0395900_0006833
388 Ga0395900_0012182
389 Ga0395898_0031432
390 Ga0316581_0003180
391 Ga0436364_0385885
392 Ga0436364_0621060
393 Ga0436364_1201996
394 Ga0436364_1538316
395 Ga0395901_0001121
396 Ga0395901_0007415
397 Ga0436365_0360252
398 Ga0436365_0646688
399 Ga0436360_0359250
400 Ga0436360_0579912
401 Ga0436363_0364434
402 Ga0436362_0467063
403 Ga0466967_0010527
404 Ga0466967_0538608
405 Ga0495592_0001581
406 Ga0495592_0022968
407 Ga0495592_0163657
408 Ga0495592_0205293
409 Ga0495603_0005043
410 Ga0495629_0000117
411 Ga0495629_0215862
412 Ga0495641_0002234
413 Ga0495641_0024740
414 Ga0495653_0119301
415 Ga0495580_0004634
416 Ga0495580_0034737
417 Ga0495580_0190120
418 Ga0495582_0000648
419 Ga0495639_0000163
420 Ga0495662_0000078
421 Ga0495662_0068530
422 Ga0495664_0132805
423 Ga0495594_0003919
424 Ga0495594_0034838
425 Ga0495608_0001149
426 Ga0495618_0080686
427 Ga0495628_0124172
428 Ga0495628_0232068
429 Ga0495628_0303739
430 Ga0495630_0010491
431 Ga0495630_0011086
432 Ga0495630_0038136
433 Ga0495630_0129262
434 Ga0495666_0024141
435 Ga0495666_0102736
436 Ga0495652_0031052
437 Ga0495652_0117920
438 Ga0495665_0000296
439 Ga0495640_0023919
440 Ga0495640_0041954
441 Ga0495640_0104507
442 Ga0495640_0262802
443 Ga0495622_0002444
444 Ga0495667_0006355
445 Ga0495634_0000996
446 Ga0495634_0003062
447 Ga0495611_0028305
448 Ga0495635_0000514
449 Ga0495635_0143326
450 Ga0495635_0299047
451 Ga0495588_0005009
452 Ga0495646_0327518
453 Ga0495647_0000732
454 Ga0495647_0004457
455 Ga0495658_0033113
456 Ga0495658_0047856
457 Ga0495658_0149636
458 Ga0495613_0001521
459 Ga0495613_0068999
460 Ga0495613_0078342
461 Ga0495624_0002980
462 Ga0495624_0008293
463 Ga0495624_0106424
464 Ga0495600_0013461
465 Ga0495581_0000222
466 Ga0495581_0046224
467 Ga0495581_0084935
468 Ga0495604_0005366
469 Ga0495674_0001713
470 Ga0495674_0052654
471 Ga0495674_0062723
472 Ga0495674_0100123
473 Ga0495674_0170700
474 Ga0495676_0051466
475 Ga0495680_0001126
476 Ga0495680_0093832
477 Ga0495684_0029470
478 Ga0495593_0000476
479 Ga0495593_0008794
480 Ga0495614_0024876
481 Ga0496100_0004716
482 Ga0496101_0013382
483 Ga0496101_0092437
484 Ga0496102_0358178
485 Ga0496103_0161023
486 Ga0496104_0002323
487 Ga0496104_0024156
488 Ga0496104_0482018
489 Ga0496105_0031263
490 Ga0496106_0009386
491 Ga0496107_0005390
492 Ga0496107_0167154
493 Ga0496108_0028765
494 Ga0496108_0065596
495 Ga0496109_0009764
496 Ga0496109_0033892
497 Ga0496109_0103264
498 Ga0496110_0002430
499 Ga0496110_0008784
500 Ga0496111_0012229
501 Ga0496111_0033031
502 Ga0496112_0008924
503 Ga0496112_0020302
504 Ga0496112_0337167
505 Ga0496113_0165735
506 Ga0496115_0095400
507 Ga0496118_0176268
508 Ga0496126_0088524
509 Ga0501034_0233125
510 Ga0501069_0089251
511 nmdc:mga00v17_94354_c1
512 nmdc:mga0yw44_153777_c1
513 nmdc:mga0yw44_251884_c1
514 nmdc:mga0k408_55111_c1
515 nmdc:mga05p37_163364_c1
516 nmdc:mga05p37_686_c1
517 nmdc:mga09592_6024_c1
518 nmdc:mga09592_6623_c1
519 nmdc:mga0qj67_35903_c1
520 nmdc:mga0qj67_53409_c1
521 nmdc:mga0qj67_5690_c1
522 nmdc:mga06r32_6630_c1
523 nmdc:mga08y16_38581_c1
524 nmdc:mga0rr50_115521_c1
525 nmdc:mga0a205_119581_c1
526 nmdc:mga0a205_39837_c1
527 Ga0495601_0161590
528 Ga0495619_0085493
529 Ga0500641_0000660
530 Ga0500636_0032159
531 2585283815
532 8054564737

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02567

PhzC-PhzF

Phenazine biosynthesis-like protein

60

349

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1qy9-assembly2.cif.gz_C crystal structure of e. coli se-met protein ydde 0.9144 1 300
1qy9-assembly2.cif.gz_C crystal structure of e. coli se-met protein ydde 0.9055 1 300
1qya-assembly1.cif.gz_A crystal structure of e. coli protein ydde 0.8954 1 300
1xub-assembly1.cif.gz_A-2 structure and function of the phenazine biosynthetic protein phzf from pseudomonas fluorescens 0.8926 1 300
3edn-assembly1.cif.gz_B crystal structure of the bacillus anthracis phenazine biosynthesis protein, phzf family 0.8924 1 300
ID Description Score Start End Superfamily
af_Q8NIL3_2_111_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9311 5 110 3.10.310.10
1u1vA01 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9307 4 123 3.10.310.10
1s7jA01 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.885 1 120 3.10.310.10
af_I1JFB7_3_158_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.8758 5 115 3.10.310.10
af_Q8NIL3_2_111_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.8742 5 110 3.10.310.10
ID Description Score Start End GO Terms
AF-A0A3N5N9T7-F1-model_v4 PhzF family phenazine biosynthesis protein 0.9883 5 88 GO:0005737
GO:0009058
GO:0016853
AF-A0A2V6YUI9-F1-model_v4 PhzF family phenazine biosynthesis protein 0.9876 5 76 GO:0005737
GO:0009058
GO:0016853
AF-A0A2G8MLG9-F1-model_v4 deleted 0.9844 5 88
AF-A0A1C2HRZ9-F1-model_v4 Phenazine biosynthesis protein PhzF 0.9822 5 78 GO:0005737
GO:0009058
GO:0016853
AF-A0A7W1GBZ7-F1-model_v4 PhzF family phenazine biosynthesis protein 0.98 5 89 GO:0005737
GO:0009058
GO:0016853

Map