F373968

General Info

Members Datasets Scaffolds Average Seq Length
266 152 266 230

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10206050|Ga0081455_102060502
Length 255
Sequence MRLRLIRNATLHLRLAGWRLLVDPMLDPAGARPPVEDTADPRRNPVVELPEPAEVVVKDLHAVIVTHLHRDHLDDTAIELLSPDLPLFAQPEDEERLRGHGFTDVRPVEGGVDWNGVRIVRTAGRHGTGRIGELMAPVSGFVLVAEGEPVLYIAGDTIWCEEVAAAVDAHRPDVIVVNAGAARFLEGDPIVMTADDVVAVARHAPGARVIVVHLEAINHCPMTRADLHQRLHDEHLADRVTVPEDGAEVPLGPPS

Samples

Sample ID Description Type Environment
1 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
50 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
51 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
75 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
78 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
79 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
80 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
81 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
82 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
83 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
84 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
85 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
86 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
87 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
88 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
89 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
90 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
91 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
92 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
93 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
94 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
95 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
96 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
97 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
98 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
99 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
100 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
101 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
102 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
103 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
104 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
105 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
106 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
107 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
108 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
109 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
110 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
111 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
112 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
113 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
114 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
115 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
116 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
117 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
118 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
128 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
129 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
130 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
131 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
132 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
133 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
134 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
135 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
136 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
137 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
138 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
139 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
140 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
141 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
144 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
145 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
146 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
147 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
148 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
149 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
150 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
151 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
152 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.5
Metatranscriptomes 1.5
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.75
Nodule 0
Rhizoplane 1.88
Rhizosphere 96.24
Stem 0
Stem Tuber 0
Unclassified 1.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARCol0yngRDRAFT_1000964 3300000652 Bacteria 2543
2 Ga0070658_10014170 3300005327 Bacteria 6399
3 Ga0070658_10019155 3300005327 Bacteria 5483
4 Ga0070683_100004751 3300005329 Bacteria 11242
5 Ga0070683_100013904 3300005329 Bacteria 7032
6 Ga0070683_100508858 3300005329 Unclassified 1151
7 Ga0070683_100882577 3300005329 Bacteria 858
8 Ga0070682_100072903 3300005337 Bacteria 2202
9 Ga0070660_100000505 3300005339 Bacteria 26077
10 Ga0070660_100138735 3300005339 Bacteria 1949
11 Ga0070660_100554648 3300005339 Bacteria 959
12 Ga0070661_100128020 3300005344 Bacteria 1906
13 Ga0070661_100488891 3300005344 Bacteria 984
14 Ga0070674_100038270 3300005356 Bacteria 3231
15 Ga0070659_100003363 3300005366 Bacteria 11382
16 Ga0070659_100309156 3300005366 Bacteria 1319
17 Ga0070663_100050195 3300005455 Bacteria 2966
18 Ga0070681_10000545 3300005458 Bacteria 31026
19 Ga0070681_10001391 3300005458 Bacteria 21212
20 Ga0070681_10023930 3300005458 Bacteria 6149
21 Ga0070681_10113006 3300005458 Bacteria 2656
22 Ga0070679_100015953 3300005530 Bacteria 7232
23 Ga0070679_100060500 3300005530 Bacteria 3774
24 Ga0070679_100613945 3300005530 Bacteria 1031
25 Ga0070684_100068980 3300005535 Bacteria 3108
26 Ga0068853_100062790 3300005539 Bacteria 3216
27 Ga0068853_100168447 3300005539 Bacteria 1981
28 Ga0068853_100243263 3300005539 Bacteria 1650
29 Ga0070696_100186077 3300005546 Bacteria 1543
30 Ga0070665_100036583 3300005548 Bacteria 4937
31 Ga0070704_100068534 3300005549 Bacteria 2567
32 Ga0068855_100005909 3300005563 Bacteria 14926
33 Ga0068855_100047204 3300005563 Bacteria 5088
34 Ga0068855_100141693 3300005563 Bacteria 2740
35 Ga0068855_100224040 3300005563 Bacteria 2108
36 Ga0070664_100064581 3300005564 Bacteria 3122
37 Ga0068857_100014399 3300005577 Bacteria 6896
38 Ga0068857_100097296 3300005577 Bacteria 2638
39 Ga0068854_100134884 3300005578 Bacteria 1889
40 Ga0068856_100077086 3300005614 Bacteria 3303
41 Ga0070702_100407218 3300005615 Unclassified 975
42 Ga0068852_100159554 3300005616 Bacteria 2104
43 Ga0068852_100255662 3300005616 Bacteria 1680
44 Ga0068861_100256491 3300005719 Bacteria 1495
45 Ga0068851_10328665 3300005834 Unclassified 885
46 Ga0068860_100217673 3300005843 Bacteria 1854
47 Ga0081455_10013943 3300005937 Bacteria 7901
48 Ga0081455_10206050 3300005937 Bacteria 1469
49 Ga0081455_10218304 3300005937 Bacteria 1415
50 Ga0081538_10002556 3300005981 Bacteria 17689
51 Ga0081538_10010273 3300005981 Bacteria 7689
52 Ga0075365_10134499 3300006038 Bacteria 1713
53 Ga0075428_100073064 3300006844 Bacteria 3745
54 Ga0075430_100056314 3300006846 Bacteria 3306
55 Ga0075430_100126461 3300006846 Bacteria 2131
56 Ga0075430_100238526 3300006846 Bacteria 1507
57 Ga0075431_100131244 3300006847 Bacteria 2584
58 Ga0075429_100001104 3300006880 Bacteria 21756
59 Ga0068865_100241806 3300006881 Bacteria 1421
60 Ga0105240_10572441 3300009093 Bacteria 1247
61 Ga0111539_10097241 3300009094 Bacteria 3458
62 Ga0114129_10020036 3300009147 Bacteria 9519
63 Ga0105243_10355212 3300009148 Bacteria 1347
64 Ga0105242_10369336 3300009176 Bacteria 1330
65 Ga0105237_10171367 3300009545 Bacteria 2170
66 Ga0105238_10736580 3300009551 Bacteria 999
67 Ga0105249_10779965 3300009553 Unclassified 1019
68 Ga0105239_10122654 3300010375 Bacteria 2887
69 Ga0105239_10440660 3300010375 Bacteria 1477
70 Ga0157373_10090023 3300013100 Bacteria 2161
71 Ga0157370_10160430 3300013104 Bacteria 2092
72 Ga0157370_10226018 3300013104 Bacteria 1732
73 Ga0157370_10244059 3300013104 Bacteria 1662
74 Ga0157369_10007157 3300013105 Bacteria 12858
75 Ga0157369_10025833 3300013105 Bacteria 6515
76 Ga0157369_10164473 3300013105 Bacteria 2341
77 Ga0157369_10268395 3300013105 Bacteria 1779
78 Ga0157369_11013623 3300013105 Bacteria 850
79 Ga0157374_10273824 3300013296 Bacteria 1665
80 Ga0157374_10955438 3300013296 Bacteria 876
81 Ga0157372_10018309 3300013307 Bacteria 7529
82 Ga0157372_10240243 3300013307 Bacteria 2102
83 Ga0157372_10493193 3300013307 Bacteria 1428
84 Ga0157372_10567398 3300013307 Bacteria 1323
85 Ga0157380_10295538 3300014326 Unclassified 1489
86 Ga0157377_10059426 3300014745 Bacteria 2179
87 Ga0157377_10061447 3300014745 Bacteria 2147
88 Ga0197907_10207652 3300020069 Bacteria 1972
89 Ga0206356_11078349 3300020070 Bacteria 806
90 Ga0206354_10808359 3300020081 Bacteria 1371
91 Ga0206353_12059332 3300020082 Bacteria 1044
92 Ga0207647_10289198 3300025904 Bacteria 934
93 Ga0207705_10138592 3300025909 Bacteria 1815
94 Ga0207705_10145028 3300025909 Bacteria 1775
95 Ga0207707_10008769 3300025912 Bacteria 8776
96 Ga0207707_10010550 3300025912 Bacteria 8021
97 Ga0207707_10018451 3300025912 Bacteria 6083
98 Ga0207707_10194448 3300025912 Bacteria 1769
99 Ga0207707_10242477 3300025912 Bacteria 1567
100 Ga0207671_10093312 3300025914 Bacteria 2271
101 Ga0207671_10733799 3300025914 Unclassified 785
102 Ga0207660_10221619 3300025917 Bacteria 1485
103 Ga0207660_10453202 3300025917 Bacteria 1037
104 Ga0207657_10006496 3300025919 Bacteria 12116
105 Ga0207657_10006895 3300025919 Bacteria 11718
106 Ga0207657_10075317 3300025919 Bacteria 2848
107 Ga0207657_10109167 3300025919 Bacteria 2287
108 Ga0207649_10034174 3300025920 Bacteria 3044
109 Ga0207649_10061120 3300025920 Bacteria 2370
110 Ga0207649_10146904 3300025920 Bacteria 1619
111 Ga0207652_10010027 3300025921 Bacteria 7630
112 Ga0207652_10019321 3300025921 Bacteria 5603
113 Ga0207652_10271917 3300025921 Bacteria 1528
114 Ga0207652_10643106 3300025921 Bacteria 949
115 Ga0207694_10094706 3300025924 Bacteria 2360
116 Ga0207690_10013186 3300025932 Bacteria 4961
117 Ga0207690_10027193 3300025932 Bacteria 3613
118 Ga0207661_10000468 3300025944 Bacteria 26119
119 Ga0207661_10067680 3300025944 Bacteria 2905
120 Ga0207661_10310937 3300025944 Bacteria 1414
121 Ga0207661_10879344 3300025944 Bacteria 825
122 Ga0207679_10581738 3300025945 Bacteria 1007
123 Ga0207667_10064701 3300025949 Bacteria 3817
124 Ga0207667_10681834 3300025949 Bacteria 1031
125 Ga0207639_10113986 3300026041 Bacteria 2208
126 Ga0207639_10364580 3300026041 Unclassified 1294
127 Ga0207639_10810956 3300026041 Bacteria 872
128 Ga0207678_10079623 3300026067 Bacteria 2805
129 Ga0207702_10116564 3300026078 Bacteria 2384
130 Ga0207702_10304936 3300026078 Bacteria 1512
131 Ga0207702_10395870 3300026078 Bacteria 1331
132 Ga0207674_10010915 3300026116 Bacteria 10228
133 Ga0207674_10062551 3300026116 Bacteria 3760
134 Ga0207675_100309189 3300026118 Bacteria 1541
135 Ga0207698_10183866 3300026142 Bacteria 1855
136 Ga0207428_10040835 3300027907 Bacteria 3758
137 Ga0207428_10234620 3300027907 Bacteria 1372
138 Ga0268266_10070472 3300028379 Bacteria 3029
139 Ga0268264_10421138 3300028381 Bacteria 1288
140 Ga0307405_10025646 3300031731 Bacteria 3388
141 Ga0307413_10058484 3300031824 Bacteria 2363
142 Ga0307410_10229812 3300031852 Unclassified 1432
143 Ga0307406_10153172 3300031901 Bacteria 1647
144 Ga0307406_10218928 3300031901 Bacteria 1414
145 Ga0307406_10526315 3300031901 Bacteria 963
146 Ga0307407_10067452 3300031903 Bacteria 2115
147 Ga0307407_10310351 3300031903 Unclassified 1103
148 Ga0307407_10327061 3300031903 Bacteria 1078
149 Ga0307412_10383489 3300031911 Bacteria 1139
150 Ga0307415_100292877 3300032126 Bacteria 1344
151 Ga0373945_0011536 3300035116 Bacteria 2924
152 Ga0373945_0099950 3300035116 Unclassified 1134
153 Ga0373943_0011741 3300035170 Bacteria 3943
154 Ga0373946_0056079 3300035171 Bacteria 1663
155 Ga0373947_0003721 3300035725 Bacteria 9009
156 Ga0373925_0025078 3300037068 Bacteria 4354
157 Ga0395899_0040560 3300037312 Bacteria 3481
158 Ga0395898_0007918 3300037466 Bacteria 11273
159 Ga0395898_0510883 3300037466 Bacteria 1143
160 Ga0395905_0086964 3300037471 Bacteria 2930
161 Ga0436364_1230248 3300037853 Bacteria 2308
162 Ga0395901_0036512 3300038443 Bacteria 5080
163 Ga0395901_1078175 3300038443 Bacteria 775
164 Ga0436363_0145634 3300039450 Bacteria 2683
165 Ga0436363_0906806 3300039450 Bacteria 817
166 Ga0450920_059857 3300042122 Bacteria 768
167 Ga0450923_021518 3300042125 Bacteria 1258
168 Ga0450902_010702 3300042137 Bacteria 1453
169 Ga0466965_0113806 3300044683 Bacteria 1392
170 Ga0466961_0060860 3300044693 Bacteria 2400
171 Ga0466963_0096035 3300044694 Bacteria 2024
172 Ga0466963_0153168 3300044694 Bacteria 1601
173 Ga0466963_0210264 3300044694 Bacteria 1361
174 Ga0466964_0005708 3300044706 Bacteria 4632
175 Ga0466971_0000387 3300044719 Bacteria 16986
176 Ga0466971_0003231 3300044719 Bacteria 6957
177 Ga0466971_0215158 3300044719 Unclassified 910
178 Ga0466968_0011699 3300044735 Bacteria 3423
179 Ga0466957_0005219 3300044842 Bacteria 7270
180 Ga0466957_0240750 3300044842 Bacteria 1200
181 Ga0466960_0159666 3300044901 Bacteria 1210
182 Ga0466959_0030093 3300045049 Bacteria 4021
183 Ga0466958_0000662 3300045836 Bacteria 14905
184 Ga0466958_0088360 3300045836 Bacteria 1915
185 Ga0466958_0214890 3300045836 Bacteria 1226
186 Ga0466967_0000496 3300045976 Bacteria 19228
187 Ga0466967_0008192 3300045976 Bacteria 7633
188 Ga0466967_0040556 3300045976 Bacteria 4009
189 Ga0466967_0041431 3300045976 Bacteria 3970
190 Ga0466967_0066024 3300045976 Bacteria 3223
191 Ga0466967_0232553 3300045976 Bacteria 1755
192 Ga0466967_0361695 3300045976 Bacteria 1406
193 Ga0466967_0757780 3300045976 Bacteria 963
194 Ga0495630_0077114 3300046517 Bacteria 2512
195 Ga0495665_0143568 3300046531 Bacteria 1247
196 Ga0495658_0200034 3300046683 Bacteria 1245
197 Ga0495614_0127136 3300048089 Bacteria 1126
198 Ga0496101_0059724 3300048904 Unclassified 2765
199 Ga0496109_0000789 3300048912 Bacteria 26350
200 Ga0496110_0001213 3300048913 Bacteria 18360
201 Ga0496111_0062947 3300048914 Bacteria 2690
202 Ga0496114_0247241 3300048917 Bacteria 1569
203 Ga0501031_0307539 3300049568 Bacteria 1027
204 Ga0501031_0445163 3300049568 Bacteria 837
205 Ga0501034_0001138 3300049571 Bacteria 37013
206 Ga0501036_0121221 3300049572 Bacteria 2208
207 Ga0501038_0445958 3300049574 Bacteria 996
208 Ga0501039_0126301 3300049575 Bacteria 2006
209 Ga0501039_0193066 3300049575 Bacteria 1601
210 Ga0501040_0021558 3300049576 Bacteria 4305
211 Ga0501040_0175101 3300049576 Bacteria 1520
212 Ga0501042_0020345 3300049578 Bacteria 4619
213 Ga0501042_0105087 3300049578 Bacteria 2032
214 Ga0501042_0253824 3300049578 Bacteria 1269
215 Ga0501043_0479027 3300049579 Bacteria 932
216 Ga0501048_0128358 3300049582 Bacteria 1793
217 Ga0501048_0155564 3300049582 Bacteria 1617
218 Ga0501048_0379742 3300049582 Bacteria 1009
219 Ga0501067_0026697 3300049583 Bacteria 3197
220 Ga0501067_0047337 3300049583 Bacteria 2385
221 Ga0501068_0469666 3300049584 Bacteria 815
222 Ga0501069_0012761 3300049585 Bacteria 4473
223 Ga0501070_0072439 3300049586 Bacteria 2852
224 Ga0501070_0225633 3300049586 Bacteria 1536
225 Ga0501070_0351882 3300049586 Bacteria 1195
226 Ga0501071_0175085 3300049587 Bacteria 1607
227 Ga0501071_0176601 3300049587 Bacteria 1600
228 Ga0501072_0004969 3300049588 Bacteria 10113
229 Ga0501072_0043224 3300049588 Bacteria 3541
230 Ga0501072_0048227 3300049588 Bacteria 3354
231 Ga0501073_0025696 3300049589 Bacteria 4220
232 Ga0501073_0039598 3300049589 Bacteria 3338
233 Ga0501074_0017763 3300049590 Bacteria 5167
234 Ga0501074_0227494 3300049590 Bacteria 1328
235 Ga0501074_0306299 3300049590 Bacteria 1128
236 Ga0501075_0031244 3300049591 Bacteria 3952
237 Ga0501075_0075029 3300049591 Bacteria 2557
238 Ga0501076_0016278 3300049592 Bacteria 5636
239 Ga0501076_0424579 3300049592 Bacteria 1094
240 Ga0501079_0010035 3300049741 Bacteria 7190
241 Ga0501079_0022752 3300049741 Bacteria 4810
242 Ga0501079_0117107 3300049741 Bacteria 2071
243 Ga0501080_0019911 3300049742 Bacteria 6213
244 Ga0501080_0246969 3300049742 Bacteria 1627
245 Ga0501080_0318018 3300049742 Bacteria 1410
246 Ga0501081_0637968 3300049743 Bacteria 798
247 Ga0501083_0000582 3300049744 Bacteria 23454
248 Ga0501035_0461810 3300049822 Bacteria 1049
249 Ga0501044_0358390 3300049823 Bacteria 1377
250 Ga0501045_0057564 3300049824 Bacteria 2844
251 nmdc:mga0yw44_358759_c1 3300050492 Bacteria 982
252 nmdc:mga05p37_9015_c1 3300050507 Bacteria 11798
253 nmdc:mga09592_1144_c1 3300050508 Bacteria 21143
254 nmdc:mga0qj67_183172_c1 3300050509 Bacteria 1701
255 nmdc:mga0qj67_20860_c1 3300050509 Bacteria 5020
256 nmdc:mga08y16_157531_c1 3300050511 Bacteria 2360
257 Ga0501084_0022107 3300054114 Bacteria 5305
258 Ga0501084_0052685 3300054114 Bacteria 3404
259 Ga0501084_0427731 3300054114 Unclassified 1119
260 Ga0501082_0036900 3300060353 Bacteria 4211
261 Ga0501082_0046570 3300060353 Bacteria 3738
262 Ga0501082_0286829 3300060353 Bacteria 1433
263 Ga0466962_0003658 3300061719 Bacteria 7332
264 Ga0466962_0005515 3300061719 Bacteria 6075
265 Ga0530510_0017573 3300061734 Bacteria 5069
266 Ga0530510_0061060 3300061734 Bacteria 2729

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044719 Ga0466971_0215158 Ga0466971_0215158_252_869 189
2 3300035171 Ga0373946_0056079 Ga0373946_0056079_17_604 192
3 3300048904 Ga0496101_0059724 Ga0496101_0059724_2105_2725 203
4 3300049823 Ga0501044_0358390 Ga0501044_0358390_11_637 205
5 3300049582 Ga0501048_0379742 Ga0501048_0379742_13_699 213
6 3300035116 Ga0373945_0011536 Ga0373945_0011536_972_1631 216
7 3300035170 Ga0373943_0011741 Ga0373943_0011741_3162_3821 216
8 3300035725 Ga0373947_0003721 Ga0373947_0003721_4604_5263 216
9 3300037068 Ga0373925_0025078 Ga0373925_0025078_1828_2487 216
10 3300046517 Ga0495630_0077114 Ga0495630_0077114_1466_2125 216
11 3300046531 Ga0495665_0143568 Ga0495665_0143568_28_687 216
12 3300046683 Ga0495658_0200034 Ga0495658_0200034_367_1026 216
13 3300048089 Ga0495614_0127136 Ga0495614_0127136_322_981 216
14 3300005327 Ga0070658_10014170 Ga0070658_100141701 217
15 3300005329 Ga0070683_100013904 Ga0070683_1000139046 217
16 3300005337 Ga0070682_100072903 Ga0070682_1000729033 217
17 3300005339 Ga0070660_100000505 Ga0070660_10000050510 217
18 3300005339 Ga0070660_100138735 Ga0070660_1001387352 217
19 3300005339 Ga0070660_100554648 Ga0070660_1005546482 217
20 3300005344 Ga0070661_100128020 Ga0070661_1001280202 217
21 3300005344 Ga0070661_100488891 Ga0070661_1004888911 217
22 3300005366 Ga0070659_100003363 Ga0070659_1000033637 217
23 3300005455 Ga0070663_100050195 Ga0070663_1000501953 217
24 3300005458 Ga0070681_10000545 Ga0070681_1000054522 217
25 3300005458 Ga0070681_10001391 Ga0070681_1000139122 217
26 3300005458 Ga0070681_10113006 Ga0070681_101130062 217
27 3300005530 Ga0070679_100060500 Ga0070679_1000605005 217
28 3300005530 Ga0070679_100613945 Ga0070679_1006139451 217
29 3300005539 Ga0068853_100062790 Ga0068853_1000627901 217
30 3300005539 Ga0068853_100168447 Ga0068853_1001684472 217
31 3300005546 Ga0070696_100186077 Ga0070696_1001860772 217
32 3300005548 Ga0070665_100036583 Ga0070665_1000365834 217
33 3300005563 Ga0068855_100005909 Ga0068855_10000590913 217
34 3300005563 Ga0068855_100047204 Ga0068855_1000472045 217
35 3300005563 Ga0068855_100141693 Ga0068855_1001416932 217
36 3300005563 Ga0068855_100224040 Ga0068855_1002240404 217
37 3300005577 Ga0068857_100014399 Ga0068857_1000143994 217
38 3300005577 Ga0068857_100097296 Ga0068857_1000972962 217
39 3300005578 Ga0068854_100134884 Ga0068854_1001348842 217
40 3300005616 Ga0068852_100159554 Ga0068852_1001595542 217
41 3300005616 Ga0068852_100255662 Ga0068852_1002556622 217
42 3300009093 Ga0105240_10572441 Ga0105240_105724412 217
43 3300009545 Ga0105237_10171367 Ga0105237_101713673 217
44 3300009551 Ga0105238_10736580 Ga0105238_107365802 217
45 3300010375 Ga0105239_10122654 Ga0105239_101226542 217
46 3300013100 Ga0157373_10090023 Ga0157373_100900232 217
47 3300013104 Ga0157370_10160430 Ga0157370_101604302 217
48 3300013104 Ga0157370_10226018 Ga0157370_102260182 217
49 3300013104 Ga0157370_10244059 Ga0157370_102440592 217
50 3300013105 Ga0157369_10025833 Ga0157369_100258339 217
51 3300013105 Ga0157369_10164473 Ga0157369_101644732 217
52 3300013105 Ga0157369_10268395 Ga0157369_102683952 217
53 3300013105 Ga0157369_11013623 Ga0157369_110136232 217
54 3300013296 Ga0157374_10273824 Ga0157374_102738242 217
55 3300013296 Ga0157374_10955438 Ga0157374_109554382 217
56 3300013307 Ga0157372_10240243 Ga0157372_102402433 217
57 3300013307 Ga0157372_10493193 Ga0157372_104931932 217
58 3300020069 Ga0197907_10207652 Ga0197907_102076522 217
59 3300020070 Ga0206356_11078349 Ga0206356_110783492 217
60 3300020081 Ga0206354_10808359 Ga0206354_108083592 217
61 3300020082 Ga0206353_12059332 Ga0206353_120593322 217
62 3300025904 Ga0207647_10289198 Ga0207647_102891982 217
63 3300025909 Ga0207705_10138592 Ga0207705_101385923 217
64 3300025912 Ga0207707_10008769 Ga0207707_1000876911 217
65 3300025912 Ga0207707_10010550 Ga0207707_100105505 217
66 3300025912 Ga0207707_10194448 Ga0207707_101944482 217
67 3300025912 Ga0207707_10242477 Ga0207707_102424773 217
68 3300025914 Ga0207671_10093312 Ga0207671_100933122 217
69 3300025914 Ga0207671_10733799 Ga0207671_107337991 217
70 3300025917 Ga0207660_10453202 Ga0207660_104532022 217
71 3300025919 Ga0207657_10006496 Ga0207657_100064967 217
72 3300025919 Ga0207657_10006895 Ga0207657_1000689511 217
73 3300025919 Ga0207657_10075317 Ga0207657_100753172 217
74 3300025920 Ga0207649_10061120 Ga0207649_100611202 217
75 3300025921 Ga0207652_10010027 Ga0207652_100100273 217
76 3300025921 Ga0207652_10019321 Ga0207652_100193212 217
77 3300025921 Ga0207652_10271917 Ga0207652_102719172 217
78 3300025921 Ga0207652_10643106 Ga0207652_106431062 217
79 3300025924 Ga0207694_10094706 Ga0207694_100947062 217
80 3300025932 Ga0207690_10013186 Ga0207690_100131864 217
81 3300025932 Ga0207690_10027193 Ga0207690_100271935 217
82 3300025944 Ga0207661_10310937 Ga0207661_103109372 217
83 3300025949 Ga0207667_10064701 Ga0207667_100647012 217
84 3300025949 Ga0207667_10681834 Ga0207667_106818342 217
85 3300026041 Ga0207639_10113986 Ga0207639_101139862 217
86 3300026041 Ga0207639_10810956 Ga0207639_108109562 217
87 3300026067 Ga0207678_10079623 Ga0207678_100796232 217
88 3300026078 Ga0207702_10304936 Ga0207702_103049362 217
89 3300026078 Ga0207702_10395870 Ga0207702_103958702 217
90 3300026116 Ga0207674_10010915 Ga0207674_1001091514 217
91 3300026116 Ga0207674_10062551 Ga0207674_100625513 217
92 3300026142 Ga0207698_10183866 Ga0207698_101838663 217
93 3300028379 Ga0268266_10070472 Ga0268266_100704723 217
94 3300037312 Ga0395899_0040560 Ga0395899_0040560_359_1021 217
95 3300037466 Ga0395898_0007918 Ga0395898_0007918_992_1654 217
96 3300037471 Ga0395905_0086964 Ga0395905_0086964_2242_2904 217
97 3300038443 Ga0395901_0036512 Ga0395901_0036512_1718_2380 217
98 3300038443 Ga0395901_1078175 Ga0395901_1078175_28_690 217
99 3300044683 Ga0466965_0113806 Ga0466965_0113806_128_790 217
100 3300044693 Ga0466961_0060860 Ga0466961_0060860_507_1169 217
101 3300044706 Ga0466964_0005708 Ga0466964_0005708_207_869 217
102 3300044719 Ga0466971_0000387 Ga0466971_0000387_8188_8850 217
103 3300044719 Ga0466971_0003231 Ga0466971_0003231_4088_4750 217
104 3300044735 Ga0466968_0011699 Ga0466968_0011699_105_767 217
105 3300044842 Ga0466957_0005219 Ga0466957_0005219_5712_6374 217
106 3300044901 Ga0466960_0159666 Ga0466960_0159666_302_964 217
107 3300045049 Ga0466959_0030093 Ga0466959_0030093_733_1395 217
108 3300045836 Ga0466958_0000662 Ga0466958_0000662_8963_9625 217
109 3300045836 Ga0466958_0088360 Ga0466958_0088360_579_1241 217
110 3300045976 Ga0466967_0000496 Ga0466967_0000496_17180_17842 217
111 3300045976 Ga0466967_0040556 Ga0466967_0040556_2858_3520 217
112 3300045976 Ga0466967_0041431 Ga0466967_0041431_363_1025 217
113 3300045976 Ga0466967_0232553 Ga0466967_0232553_806_1468 217
114 3300049583 Ga0501067_0026697 Ga0501067_0026697_791_1453 217
115 3300049585 Ga0501069_0012761 Ga0501069_0012761_464_1126 217
116 3300061719 Ga0466962_0003658 Ga0466962_0003658_5153_5815 217
117 3300061719 Ga0466962_0005515 Ga0466962_0005515_889_1551 217
118 3300061734 Ga0530510_0061060 Ga0530510_0061060_606_1268 217
119 3300037853 Ga0436364_1230248 Ga0436364_1230248_1093_1764 220
120 3300039450 Ga0436363_0145634 Ga0436363_0145634_496_1167 220
121 3300039450 Ga0436363_0906806 Ga0436363_0906806_74_745 220
122 3300044694 Ga0466963_0096035 Ga0466963_0096035_539_1210 220
123 3300045836 Ga0466958_0214890 Ga0466958_0214890_331_1002 220
124 3300045976 Ga0466967_0066024 Ga0466967_0066024_865_1536 220
125 3300049584 Ga0501068_0469666 Ga0501068_0469666_22_693 220
126 3300025920 Ga0207649_10146904 Ga0207649_101469042 221
127 3300045976 Ga0466967_0008192 Ga0466967_0008192_3308_4069 221
128 3300025917 Ga0207660_10221619 Ga0207660_102216192 222
129 3300044694 Ga0466963_0153168 Ga0466963_0153168_447_1127 222
130 3300005615 Ga0070702_100407218 Ga0070702_1004072182 223
131 3300005327 Ga0070658_10019155 Ga0070658_100191558 224
132 3300005535 Ga0070684_100068980 Ga0070684_1000689802 224
133 3300025909 Ga0207705_10145028 Ga0207705_101450282 224
134 3300037466 Ga0395898_0510883 Ga0395898_0510883_20_706 224
135 3300044842 Ga0466957_0240750 Ga0466957_0240750_451_1143 224
136 3300045976 Ga0466967_0361695 Ga0466967_0361695_672_1364 224
137 3300045976 Ga0466967_0757780 Ga0466967_0757780_110_799 224
138 3300049571 Ga0501034_0001138 Ga0501034_0001138_21343_22062 224
139 3300049574 Ga0501038_0445958 Ga0501038_0445958_21_707 224
140 3300049583 Ga0501067_0047337 Ga0501067_0047337_527_1246 224
141 3300049586 Ga0501070_0072439 Ga0501070_0072439_294_980 224
142 3300049586 Ga0501070_0351882 Ga0501070_0351882_23_742 224
143 3300049588 Ga0501072_0004969 Ga0501072_0004969_9157_9843 224
144 3300049589 Ga0501073_0025696 Ga0501073_0025696_3043_3762 224
145 3300049589 Ga0501073_0039598 Ga0501073_0039598_1770_2456 224
146 3300049590 Ga0501074_0017763 Ga0501074_0017763_1631_2350 224
147 3300049590 Ga0501074_0306299 Ga0501074_0306299_327_1013 224
148 3300049741 Ga0501079_0022752 Ga0501079_0022752_1965_2651 224
149 3300049742 Ga0501080_0019911 Ga0501080_0019911_1440_2159 224
150 3300049742 Ga0501080_0246969 Ga0501080_0246969_33_719 224
151 3300049744 Ga0501083_0000582 Ga0501083_0000582_666_1352 224
152 3300060353 Ga0501082_0286829 Ga0501082_0286829_617_1303 224
153 3300005981 Ga0081538_10010273 Ga0081538_100102736 227
154 3300035116 Ga0373945_0099950 Ga0373945_0099950_414_1106 227
155 3300044694 Ga0466963_0210264 Ga0466963_0210264_564_1256 227
156 3300049578 Ga0501042_0020345 Ga0501042_0020345_1296_2048 228
157 3300049579 Ga0501043_0479027 Ga0501043_0479027_60_812 228
158 3300049582 Ga0501048_0155564 Ga0501048_0155564_843_1595 228
159 3300049588 Ga0501072_0048227 Ga0501072_0048227_1240_1992 228
160 3300049591 Ga0501075_0075029 Ga0501075_0075029_683_1435 228
161 3300049742 Ga0501080_0318018 Ga0501080_0318018_387_1139 228
162 3300049822 Ga0501035_0461810 Ga0501035_0461810_157_909 228
163 3300061734 Ga0530510_0017573 Ga0530510_0017573_1471_2223 228
164 3300049575 Ga0501039_0193066 Ga0501039_0193066_229_984 229
165 3300049591 Ga0501075_0031244 Ga0501075_0031244_152_865 229
166 3300054114 Ga0501084_0052685 Ga0501084_0052685_267_1022 229
167 3300031901 Ga0307406_10218928 Ga0307406_102189282 230
168 3300005719 Ga0068861_100256491 Ga0068861_1002564913 231
169 3300005843 Ga0068860_100217673 Ga0068860_1002176732 231
170 3300009553 Ga0105249_10779965 Ga0105249_107799652 231
171 3300026118 Ga0207675_100309189 Ga0207675_1003091893 231
172 3300028381 Ga0268264_10421138 Ga0268264_104211382 231
173 3300031903 Ga0307407_10310351 Ga0307407_103103512 231
174 3300031903 Ga0307407_10327061 Ga0307407_103270612 231
175 3300032126 Ga0307415_100292877 Ga0307415_1002928771 231
176 3300049568 Ga0501031_0307539 Ga0501031_0307539_145_897 236
177 3300049741 Ga0501079_0117107 Ga0501079_0117107_439_1191 236
178 3300060353 Ga0501082_0046570 Ga0501082_0046570_1787_2539 236
179 3300000652 ARCol0yngRDRAFT_1000964 ARCol0yngRDRAFT_10009642 237
180 3300005329 Ga0070683_100004751 Ga0070683_1000047513 237
181 3300005329 Ga0070683_100508858 Ga0070683_1005088582 237
182 3300005329 Ga0070683_100882577 Ga0070683_1008825771 237
183 3300005356 Ga0070674_100038270 Ga0070674_1000382702 237
184 3300005366 Ga0070659_100309156 Ga0070659_1003091562 237
185 3300005458 Ga0070681_10023930 Ga0070681_100239305 237
186 3300005530 Ga0070679_100015953 Ga0070679_1000159534 237
187 3300005539 Ga0068853_100243263 Ga0068853_1002432632 237
188 3300005549 Ga0070704_100068534 Ga0070704_1000685342 237
189 3300005564 Ga0070664_100064581 Ga0070664_1000645812 237
190 3300005614 Ga0068856_100077086 Ga0068856_1000770863 237
191 3300005834 Ga0068851_10328665 Ga0068851_103286651 237
192 3300005937 Ga0081455_10013943 Ga0081455_100139434 237
193 3300005937 Ga0081455_10206050 Ga0081455_102060502 237
194 3300005937 Ga0081455_10218304 Ga0081455_102183042 237
195 3300005981 Ga0081538_10002556 Ga0081538_1000255618 237
196 3300006038 Ga0075365_10134499 Ga0075365_101344992 237
197 3300006844 Ga0075428_100073064 Ga0075428_1000730644 237
198 3300006846 Ga0075430_100056314 Ga0075430_1000563143 237
199 3300006846 Ga0075430_100126461 Ga0075430_1001264612 237
200 3300006846 Ga0075430_100238526 Ga0075430_1002385262 237
201 3300006847 Ga0075431_100131244 Ga0075431_1001312442 237
202 3300006880 Ga0075429_100001104 Ga0075429_1000011043 237
203 3300006881 Ga0068865_100241806 Ga0068865_1002418062 237
204 3300009094 Ga0111539_10097241 Ga0111539_100972413 237
205 3300009147 Ga0114129_10020036 Ga0114129_1002003610 237
206 3300009148 Ga0105243_10355212 Ga0105243_103552122 237
207 3300009176 Ga0105242_10369336 Ga0105242_103693361 237
208 3300010375 Ga0105239_10440660 Ga0105239_104406602 237
209 3300013105 Ga0157369_10007157 Ga0157369_100071572 237
210 3300013307 Ga0157372_10018309 Ga0157372_100183093 237
211 3300013307 Ga0157372_10567398 Ga0157372_105673982 237
212 3300014326 Ga0157380_10295538 Ga0157380_102955381 237
213 3300014745 Ga0157377_10059426 Ga0157377_100594262 237
214 3300014745 Ga0157377_10061447 Ga0157377_100614472 237
215 3300025912 Ga0207707_10018451 Ga0207707_100184512 237
216 3300025919 Ga0207657_10109167 Ga0207657_101091672 237
217 3300025920 Ga0207649_10034174 Ga0207649_100341743 237
218 3300025944 Ga0207661_10000468 Ga0207661_1000046812 237
219 3300025944 Ga0207661_10067680 Ga0207661_100676802 237
220 3300025944 Ga0207661_10879344 Ga0207661_108793441 237
221 3300025945 Ga0207679_10581738 Ga0207679_105817382 237
222 3300026041 Ga0207639_10364580 Ga0207639_103645802 237
223 3300026078 Ga0207702_10116564 Ga0207702_101165642 237
224 3300027907 Ga0207428_10040835 Ga0207428_100408353 237
225 3300027907 Ga0207428_10234620 Ga0207428_102346202 237
226 3300031731 Ga0307405_10025646 Ga0307405_100256463 237
227 3300031824 Ga0307413_10058484 Ga0307413_100584842 237
228 3300031852 Ga0307410_10229812 Ga0307410_102298122 237
229 3300031901 Ga0307406_10153172 Ga0307406_101531722 237
230 3300031901 Ga0307406_10526315 Ga0307406_105263152 237
231 3300031903 Ga0307407_10067452 Ga0307407_100674522 237
232 3300031911 Ga0307412_10383489 Ga0307412_103834892 237
233 3300042122 Ga0450920_059857 Ga0450920_059857_27_740 237
234 3300042125 Ga0450923_021518 Ga0450923_021518_161_874 237
235 3300042137 Ga0450902_010702 Ga0450902_010702_178_891 237
236 3300048912 Ga0496109_0000789 Ga0496109_0000789_20843_21556 237
237 3300048913 Ga0496110_0001213 Ga0496110_0001213_2731_3444 237
238 3300048914 Ga0496111_0062947 Ga0496111_0062947_1660_2373 237
239 3300048917 Ga0496114_0247241 Ga0496114_0247241_25_738 237
240 3300049568 Ga0501031_0445163 Ga0501031_0445163_66_821 237
241 3300049572 Ga0501036_0121221 Ga0501036_0121221_1161_1916 237
242 3300049575 Ga0501039_0126301 Ga0501039_0126301_1266_1979 237
243 3300049576 Ga0501040_0021558 Ga0501040_0021558_931_1686 237
244 3300049576 Ga0501040_0175101 Ga0501040_0175101_215_973 237
245 3300049578 Ga0501042_0105087 Ga0501042_0105087_1245_2000 237
246 3300049578 Ga0501042_0253824 Ga0501042_0253824_54_812 237
247 3300049582 Ga0501048_0128358 Ga0501048_0128358_724_1479 237
248 3300049586 Ga0501070_0225633 Ga0501070_0225633_650_1405 237
249 3300049587 Ga0501071_0175085 Ga0501071_0175085_445_1203 237
250 3300049587 Ga0501071_0176601 Ga0501071_0176601_534_1247 237
251 3300049588 Ga0501072_0043224 Ga0501072_0043224_2231_2989 237
252 3300049590 Ga0501074_0227494 Ga0501074_0227494_359_1114 237
253 3300049592 Ga0501076_0016278 Ga0501076_0016278_1748_2503 237
254 3300049592 Ga0501076_0424579 Ga0501076_0424579_13_771 237
255 3300049741 Ga0501079_0010035 Ga0501079_0010035_5084_5797 237
256 3300049743 Ga0501081_0637968 Ga0501081_0637968_16_732 237
257 3300049824 Ga0501045_0057564 Ga0501045_0057564_544_1299 237
258 3300050492 nmdc:mga0yw44_358759_c1 nmdc:mga0yw44_358759_c1_14_727 237
259 3300050507 nmdc:mga05p37_9015_c1 nmdc:mga05p37_9015_c1_1905_2621 237
260 3300050508 nmdc:mga09592_1144_c1 nmdc:mga09592_1144_c1_2023_2739 237
261 3300050509 nmdc:mga0qj67_183172_c1 nmdc:mga0qj67_183172_c1_487_1203 237
262 3300050509 nmdc:mga0qj67_20860_c1 nmdc:mga0qj67_20860_c1_2728_3444 237
263 3300050511 nmdc:mga08y16_157531_c1 nmdc:mga08y16_157531_c1_1230_1943 237
264 3300054114 Ga0501084_0022107 Ga0501084_0022107_1234_1989 237
265 3300054114 Ga0501084_0427731 Ga0501084_0427731_117_875 237
266 3300060353 Ga0501082_0036900 Ga0501082_0036900_360_1115 237

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12706

Lactamase_B_2

Beta-lactamase superfamily domain

18

214

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rpc-assembly2.cif.gz_C the crystal structure of a possible metal-dependent hydrolase from veillonella parvula dsm 2008 0.9613 1 237
3rpc-assembly2.cif.gz_C the crystal structure of a possible metal-dependent hydrolase from veillonella parvula dsm 2008 0.9574 1 237
6brm-assembly4.cif.gz_G the crystal structure of isothiocyanate hydrolase from delia radicum gut bacteria 0.9375 1 237
6brm-assembly4.cif.gz_G the crystal structure of isothiocyanate hydrolase from delia radicum gut bacteria 0.9337 1 237
6brm-assembly3.cif.gz_F the crystal structure of isothiocyanate hydrolase from delia radicum gut bacteria 0.9112 1 237
ID Description Score Start End Superfamily
3rpcD00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.931 1 237 3.60.15.10
3rpcD00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9272 1 237 3.60.15.10
6brmH00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8944 1 236 3.60.15.10
6brmH00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8873 1 236 3.60.15.10
af_Q58563_1_217_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8061 3 237 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A535ED99-F1-model_v4 MBL fold metallo-hydrolase 0.9966 158 237
AF-A0A7V9WLU5-F1-model_v4 MBL fold metallo-hydrolase 0.9863 1 195 GO:0016787
AF-A0A7V9KCC4-F1-model_v4 MBL fold metallo-hydrolase 0.9838 1 237 GO:0016787
AF-A0A843RTH3-F1-model_v4 Twin-arginine translocation signal domain-containing protein 0.9833 3 141
AF-A0A6M1UD84-F1-model_v4 MBL fold metallo-hydrolase 0.9808 1 237 GO:0016787

Feature Viewer

pLDDT pTM Quality
95.78 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map