F373790

General Info

Members Datasets Scaffolds Average Seq Length
266 145 532 263

Family's Representative Sequence

Representative Sequence 3300005293|Ga0065715_10004520|Ga0065715_100045203
Length 288
Sequence MNSFAISDADRRLIPSSGLRGPVPLLIAIMTFVMVVVAAAGLALANTGAVIRAGVEHRYSIQIADGAAKAPAAIAAARAQPGVGRVNQVDPAELRRTLERWLGPASAEADLPLPAVIDVDLKPGADPAAVASAIRKAVPSARFVGHRTSLAPLLKALRGLTLLAMGLVLMIALAXXXXIVLAARGALDTHRGTIEVMHGIGATDEQVVRLFVRQIAVDALLGGMAGAAAAGLTIALIIGGAGTATMLAGAPPLGWNDAIWLLMLPLAIALLATQVARIALVRALRERL

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
104 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
105 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
106 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
107 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
108 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
109 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
110 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
111 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
112 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
113 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
114 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
115 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
116 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
117 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
118 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
119 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
120 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
121 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
122 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
123 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
124 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
125 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
126 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
127 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
128 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
129 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
130 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
131 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
132 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
133 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
134 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
135 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
136 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
137 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
138 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
139 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
140 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
141 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
142 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
143 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
144 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
145 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.62
Metatranscriptomes 0
Isolates 0.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.75
Nodule 0
Rhizoplane 3.01
Rhizosphere 95.86
Stem 0
Stem Tuber 0
Unclassified 1.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10004520 3300005293 Bacteria 3515
2 MBSR1b_contig_6947300 2162886012 Bacteria 1277
3 JGI24741J21665_1011965 3300001915 Bacteria 1504
4 JGI24740J21852_10000820 3300001979 Bacteria 13657
5 Ga0070658_10000256 3300005327 Bacteria 46854
6 Ga0070658_10216770 3300005327 Bacteria 1618
7 Ga0070676_10014438 3300005328 Bacteria 4340
8 Ga0070683_100002147 3300005329 Bacteria 15585
9 Ga0070690_100138715 3300005330 Bacteria 1649
10 Ga0070670_100001335 3300005331 Bacteria 19717
11 Ga0070670_100005097 3300005331 Bacteria 11057
12 Ga0070670_100012617 3300005331 Bacteria 7234
13 Ga0070670_100020181 3300005331 Bacteria 5725
14 Ga0070670_100038733 3300005331 Bacteria 4099
15 Ga0070670_100270661 3300005331 Bacteria 1482
16 Ga0070666_10119166 3300005335 Bacteria 1829
17 Ga0070680_100000105 3300005336 Bacteria 48515
18 Ga0068868_100034443 3300005338 Bacteria 3909
19 Ga0070660_100000064 3300005339 Bacteria 62554
20 Ga0070660_100064006 3300005339 Bacteria 2860
21 Ga0070660_100314759 3300005339 Bacteria 1285
22 Ga0070661_100013723 3300005344 Bacteria 5691
23 Ga0070661_100031564 3300005344 Bacteria 3832
24 Ga0070661_100066236 3300005344 Bacteria 2654
25 Ga0070661_100071027 3300005344 Bacteria 2561
26 Ga0070692_10017485 3300005345 Bacteria 3429
27 Ga0070668_100013179 3300005347 Bacteria 6164
28 Ga0070668_100149996 3300005347 Bacteria 1884
29 Ga0070668_100183768 3300005347 Bacteria 1709
30 Ga0070669_100017560 3300005353 Bacteria 5104
31 Ga0070675_100003250 3300005354 Bacteria 12310
32 Ga0070671_100011834 3300005355 Bacteria 7019
33 Ga0070671_100021220 3300005355 Bacteria 5304
34 Ga0070671_100103844 3300005355 Bacteria 2385
35 Ga0070674_100021255 3300005356 Bacteria 4162
36 Ga0070674_100041707 3300005356 Bacteria 3113
37 Ga0070673_100007664 3300005364 Bacteria 7140
38 Ga0070659_100031240 3300005366 Bacteria 4124
39 Ga0070659_100052843 3300005366 Bacteria 3196
40 Ga0070659_100103763 3300005366 Bacteria 2290
41 Ga0070714_100044099 3300005435 Bacteria 3775
42 Ga0070714_100119907 3300005435 Bacteria 2339
43 Ga0070713_100016291 3300005436 Bacteria 5587
44 Ga0070713_100050382 3300005436 Bacteria 3440
45 Ga0070663_100036551 3300005455 Bacteria 3412
46 Ga0070663_100038411 3300005455 Bacteria 3340
47 Ga0070678_100002909 3300005456 Bacteria 9486
48 Ga0070662_100010487 3300005457 Bacteria 6084
49 Ga0070662_100098645 3300005457 Bacteria 2207
50 Ga0070662_100155710 3300005457 Bacteria 1784
51 Ga0070681_10050209 3300005458 Bacteria 4163
52 Ga0070681_10156813 3300005458 Bacteria 2201
53 Ga0068867_100013826 3300005459 Bacteria 5713
54 Ga0068867_100046865 3300005459 Bacteria 3176
55 Ga0070679_100000125 3300005530 Bacteria 61348
56 Ga0068853_100168269 3300005539 Bacteria 1982
57 Ga0068853_100360465 3300005539 Bacteria 1354
58 Ga0070672_100005595 3300005543 Bacteria 8355
59 Ga0070695_100006471 3300005545 Bacteria 6925
60 Ga0070696_100063471 3300005546 Bacteria 2587
61 Ga0070696_100111422 3300005546 Bacteria 1971
62 Ga0070704_100127983 3300005549 Bacteria 1963
63 Ga0068855_100016190 3300005563 Bacteria 8966
64 Ga0070664_100000849 3300005564 Bacteria 23590
65 Ga0070664_100002063 3300005564 Bacteria 16046
66 Ga0070664_100069220 3300005564 Bacteria 3019
67 Ga0070664_100244948 3300005564 Bacteria 1610
68 Ga0068857_100520618 3300005577 Bacteria 1118
69 Ga0068854_100004966 3300005578 Bacteria 8385
70 Ga0068854_100021812 3300005578 Bacteria 4352
71 Ga0068854_100033020 3300005578 Bacteria 3605
72 Ga0068856_100001220 3300005614 Bacteria 26928
73 Ga0068856_100419231 3300005614 Bacteria 1359
74 Ga0068852_100123101 3300005616 Bacteria 2378
75 Ga0068859_100069278 3300005617 Bacteria 3562
76 Ga0068864_100026361 3300005618 Bacteria 4903
77 Ga0068864_100102264 3300005618 Bacteria 2543
78 Ga0068861_100053121 3300005719 Bacteria 3082
79 Ga0068863_100011392 3300005841 Bacteria 8604
80 Ga0068863_100021346 3300005841 Bacteria 6180
81 Ga0068863_100166154 3300005841 Bacteria 2116
82 Ga0068862_100097285 3300005844 Bacteria 2570
83 Ga0070717_10055953 3300006028 Bacteria 3257
84 Ga0075364_10186612 3300006051 Bacteria 1404
85 Ga0075431_100009478 3300006847 Bacteria 9776
86 Ga0075429_100183298 3300006880 Bacteria 1835
87 Ga0097620_100016663 3300006931 Bacteria 7378
88 Ga0097620_100069275 3300006931 Bacteria 3562
89 Ga0111539_10157647 3300009094 Bacteria 2656
90 Ga0105241_10342710 3300009174 Bacteria 1295
91 Ga0105248_10006386 3300009177 Bacteria 12938
92 Ga0105248_10031122 3300009177 Bacteria 5963
93 Ga0105237_10355580 3300009545 Bacteria 1469
94 Ga0105249_10390873 3300009553 Bacteria 1419
95 Ga0105249_10451293 3300009553 Bacteria 1325
96 Ga0157373_10112934 3300013100 Bacteria 1909
97 Ga0157370_10010104 3300013104 Bacteria 9968
98 Ga0157370_10119384 3300013104 Bacteria 2462
99 Ga0157369_10011511 3300013105 Bacteria 10049
100 Ga0157378_10471553 3300013297 Bacteria 1249
101 Ga0157372_10367673 3300013307 Bacteria 1676
102 Ga0157380_10140191 3300014326 Bacteria 2076
103 Ga0163161_10013343 3300017792 Bacteria 5715
104 Ga0207697_10000969 3300025315 Bacteria 16134
105 Ga0207682_10000494 3300025893 Bacteria 18198
106 Ga0207688_10149726 3300025901 Bacteria 1378
107 Ga0207647_10033341 3300025904 Bacteria 3298
108 Ga0207705_10000067 3300025909 Bacteria 136004
109 Ga0207707_10014856 3300025912 Bacteria 6780
110 Ga0207695_10094901 3300025913 Bacteria 2989
111 Ga0207660_10000379 3300025917 Bacteria 29073
112 Ga0207657_10019943 3300025919 Bacteria 6352
113 Ga0207657_10041930 3300025919 Bacteria 4042
114 Ga0207657_10065188 3300025919 Bacteria 3106
115 Ga0207657_10432511 3300025919 Unclassified 1034
116 Ga0207649_10011307 3300025920 Bacteria 4919
117 Ga0207649_10045369 3300025920 Bacteria 2694
118 Ga0207652_10000058 3300025921 Bacteria 113620
119 Ga0207681_10008796 3300025923 Bacteria 6168
120 Ga0207650_10017606 3300025925 Bacteria 5005
121 Ga0207650_10029028 3300025925 Bacteria 3972
122 Ga0207650_10132950 3300025925 Bacteria 1949
123 Ga0207650_10256459 3300025925 Bacteria 1417
124 Ga0207650_10353095 3300025925 Bacteria 1210
125 Ga0207659_10013644 3300025926 Bacteria 5212
126 Ga0207664_10165161 3300025929 Bacteria 1891
127 Ga0207644_10000138 3300025931 Bacteria 52145
128 Ga0207690_10044073 3300025932 Bacteria 2939
129 Ga0207706_10000276 3300025933 Bacteria 55889
130 Ga0207706_10085028 3300025933 Bacteria 2781
131 Ga0207706_10156825 3300025933 Bacteria 2001
132 Ga0207706_10267100 3300025933 Bacteria 1493
133 Ga0207669_10021869 3300025937 Bacteria 3386
134 Ga0207669_10324367 3300025937 Bacteria 1180
135 Ga0207665_10049051 3300025939 Bacteria 2836
136 Ga0207691_10035726 3300025940 Bacteria 4609
137 Ga0207711_10001163 3300025941 Bacteria 25054
138 Ga0207711_10129799 3300025941 Bacteria 2259
139 Ga0207661_10024457 3300025944 Bacteria 4579
140 Ga0207679_10025785 3300025945 Bacteria 4047
141 Ga0207679_10027981 3300025945 Bacteria 3906
142 Ga0207679_10095305 3300025945 Bacteria 2313
143 Ga0207679_10321985 3300025945 Bacteria 1339
144 Ga0207667_10000828 3300025949 Bacteria 39983
145 Ga0207668_10004430 3300025972 Bacteria 8246
146 Ga0207668_10057467 3300025972 Bacteria 2714
147 Ga0207640_10036970 3300025981 Bacteria 3069
148 Ga0207640_10071631 3300025981 Bacteria 2335
149 Ga0207640_10110868 3300025981 Bacteria 1945
150 Ga0207639_10182196 3300026041 Bacteria 1787
151 Ga0207639_10322347 3300026041 Bacteria 1372
152 Ga0207678_10002816 3300026067 Bacteria 15773
153 Ga0207678_10020251 3300026067 Bacteria 5838
154 Ga0207678_10021079 3300026067 Bacteria 5713
155 Ga0207678_10293173 3300026067 Bacteria 1397
156 Ga0207702_10001153 3300026078 Bacteria 27012
157 Ga0207702_10150179 3300026078 Bacteria 2118
158 Ga0207641_10051301 3300026088 Bacteria 3493
159 Ga0207641_10108242 3300026088 Bacteria 2460
160 Ga0207648_10036823 3300026089 Bacteria 4310
161 Ga0207648_10061680 3300026089 Bacteria 3269
162 Ga0207676_10010750 3300026095 Bacteria 6525
163 Ga0207674_10328482 3300026116 Bacteria 1479
164 Ga0207675_100008969 3300026118 Bacteria 9384
165 Ga0207683_10004703 3300026121 Bacteria 11769
166 Ga0207683_10065725 3300026121 Bacteria 3198
167 Ga0207698_10058216 3300026142 Bacteria 2994
168 Ga0207698_10483228 3300026142 Unclassified 1202
169 Ga0268265_10184199 3300028380 Bacteria 1797
170 Ga0268264_10306344 3300028381 Bacteria 1497
171 Ga0307408_100165545 3300031548 Bacteria 1760
172 Ga0307413_10012008 3300031824 Bacteria 4290
173 Ga0307413_10051060 3300031824 Bacteria 2489
174 Ga0307413_10124809 3300031824 Bacteria 1751
175 Ga0307410_10079353 3300031852 Bacteria 2299
176 Ga0307410_10353812 3300031852 Bacteria 1174
177 Ga0307407_10205504 3300031903 Bacteria 1322
178 Ga0307412_10066668 3300031911 Bacteria 2441
179 Ga0307412_10415261 3300031911 Unclassified 1099
180 Ga0307409_100008719 3300031995 Bacteria 6179
181 Ga0307409_100420963 3300031995 Bacteria 1281
182 Ga0307409_100455388 3300031995 Bacteria 1236
183 Ga0307416_100088120 3300032002 Bacteria 2653
184 Ga0307416_100266878 3300032002 Bacteria 1677
185 Ga0307414_10004982 3300032004 Bacteria 7263
186 Ga0307414_10018385 3300032004 Bacteria 4302
187 Ga0307414_10022979 3300032004 Bacteria 3945
188 Ga0307414_10114629 3300032004 Bacteria 2059
189 Ga0307414_10146749 3300032004 Bacteria 1855
190 Ga0307414_10176081 3300032004 Bacteria 1715
191 Ga0307414_10206675 3300032004 Bacteria 1601
192 Ga0307411_10011766 3300032005 Bacteria 4740
193 Ga0307411_10040491 3300032005 Bacteria 2956
194 Ga0307411_10059715 3300032005 Bacteria 2529
195 Ga0307411_10138757 3300032005 Bacteria 1789
196 Ga0307415_100080767 3300032126 Bacteria 2321
197 Ga0307415_100218739 3300032126 Bacteria 1525
198 Ga0373941_0113443 3300035115 Bacteria 958
199 Ga0395899_0008223 3300037312 Bacteria 8036
200 Ga0395899_0025675 3300037312 Bacteria 4447
201 Ga0395899_0043242 3300037312 Bacteria 3361
202 Ga0395899_0046217 3300037312 Bacteria 3243
203 Ga0395899_0080280 3300037312 Bacteria 2374
204 Ga0395899_0173849 3300037312 Bacteria 1515
205 Ga0395899_0181589 3300037312 Bacteria 1477
206 Ga0395900_0002103 3300037418 Bacteria 22302
207 Ga0395900_0003952 3300037418 Bacteria 15826
208 Ga0395900_0011120 3300037418 Bacteria 9198
209 Ga0395900_0016290 3300037418 Bacteria 7577
210 Ga0395900_0031577 3300037418 Bacteria 5444
211 Ga0395900_0060046 3300037418 Bacteria 3914
212 Ga0395900_0089276 3300037418 Bacteria 3168
213 Ga0395900_0653775 3300037418 Bacteria 987
214 Ga0395898_0101767 3300037466 Bacteria 2758
215 Ga0395905_0001572 3300037471 Bacteria 27278
216 Ga0395905_0010599 3300037471 Bacteria 8948
217 Ga0395905_0023354 3300037471 Bacteria 5845
218 Ga0395905_0039152 3300037471 Bacteria 4447
219 Ga0395905_0070942 3300037471 Bacteria 3265
220 Ga0395905_0273358 3300037471 Unclassified 1575
221 Ga0395905_0472755 3300037471 Bacteria 1152
222 Ga0395901_0006236 3300038443 Bacteria 12089
223 Ga0395901_0011353 3300038443 Bacteria 9026
224 Ga0395901_0015289 3300038443 Bacteria 7809
225 Ga0395901_0061072 3300038443 Bacteria 3922
226 Ga0395901_0081578 3300038443 Bacteria 3378
227 Ga0395901_0108603 3300038443 Bacteria 2912
228 Ga0395901_0128611 3300038443 Bacteria 2662
229 Ga0395901_0133127 3300038443 Bacteria 2612
230 Ga0395901_0272229 3300038443 Bacteria 1761
231 Ga0436365_0899740 3300039437 Bacteria 3358
232 Ga0439445_0004007 3300042004 Bacteria 3324
233 Ga0450905_000113 3300042142 Bacteria 8096
234 Ga0450889_000213 3300042144 Bacteria 6335
235 Ga0466967_0040653 3300045976 Bacteria 4005
236 Ga0495663_0000955 3300046525 Bacteria 9626
237 Ga0495663_0036686 3300046525 Bacteria 1476
238 Ga0495663_0045449 3300046525 Bacteria 1346
239 Ga0495663_0064946 3300046525 Bacteria 1153
240 Ga0495598_0013977 3300046537 Bacteria 2000
241 Ga0495598_0030011 3300046537 Bacteria 1520
242 Ga0495598_0102876 3300046537 Bacteria 947
243 Ga0495621_0008584 3300046539 Bacteria 3071
244 Ga0495621_0226919 3300046539 Bacteria 757
245 Ga0495633_0013578 3300046558 Bacteria 4286
246 Ga0495633_0019241 3300046558 Bacteria 3454
247 Ga0495659_0002834 3300046664 Bacteria 5569
248 Ga0495670_0006037 3300046691 Bacteria 5934
249 Ga0495670_0021371 3300046691 Bacteria 3191
250 Ga0495670_0043165 3300046691 Bacteria 2250
251 Ga0495677_0019890 3300047445 Bacteria 2434
252 Ga0496101_0043850 3300048904 Bacteria 3198
253 Ga0496106_0134454 3300048909 Bacteria 1941
254 Ga0496107_0063820 3300048910 Bacteria 2669
255 Ga0496108_0525966 3300048911 Bacteria 1032
256 Ga0496109_0002117 3300048912 Bacteria 16511
257 Ga0496112_0001994 3300048915 Bacteria 16154
258 Ga0496114_0007186 3300048917 Bacteria 8788
259 Ga0496115_0041532 3300048918 Bacteria 3661
260 Ga0501068_0090879 3300049584 Bacteria 1884
261 nmdc:mga00v17_233450_c1 3300050491 Bacteria 1192
262 nmdc:mga09592_184655_c1 3300050508 Bacteria 1804
263 nmdc:mga06r32_63335_c1 3300050510 Bacteria 3564
264 nmdc:mga08y16_155987_c1 3300050511 Bacteria 2372
265 Ga0466962_0115257 3300061719 Unclassified 1295
266 2896431834 2896429255 Bacteria 2557483
267 Ga0065715_10004520
268 MBSR1b_contig_6947300
269 JGI24741J21665_1011965
270 JGI24740J21852_10000820
271 Ga0070658_10000256
272 Ga0070658_10216770
273 Ga0070676_10014438
274 Ga0070683_100002147
275 Ga0070690_100138715
276 Ga0070670_100001335
277 Ga0070670_100005097
278 Ga0070670_100012617
279 Ga0070670_100020181
280 Ga0070670_100038733
281 Ga0070670_100270661
282 Ga0070666_10119166
283 Ga0070680_100000105
284 Ga0068868_100034443
285 Ga0070660_100000064
286 Ga0070660_100064006
287 Ga0070660_100314759
288 Ga0070661_100013723
289 Ga0070661_100031564
290 Ga0070661_100066236
291 Ga0070661_100071027
292 Ga0070692_10017485
293 Ga0070668_100013179
294 Ga0070668_100149996
295 Ga0070668_100183768
296 Ga0070669_100017560
297 Ga0070675_100003250
298 Ga0070671_100011834
299 Ga0070671_100021220
300 Ga0070671_100103844
301 Ga0070674_100021255
302 Ga0070674_100041707
303 Ga0070673_100007664
304 Ga0070659_100031240
305 Ga0070659_100052843
306 Ga0070659_100103763
307 Ga0070714_100044099
308 Ga0070714_100119907
309 Ga0070713_100016291
310 Ga0070713_100050382
311 Ga0070663_100036551
312 Ga0070663_100038411
313 Ga0070678_100002909
314 Ga0070662_100010487
315 Ga0070662_100098645
316 Ga0070662_100155710
317 Ga0070681_10050209
318 Ga0070681_10156813
319 Ga0068867_100013826
320 Ga0068867_100046865
321 Ga0070679_100000125
322 Ga0068853_100168269
323 Ga0068853_100360465
324 Ga0070672_100005595
325 Ga0070695_100006471
326 Ga0070696_100063471
327 Ga0070696_100111422
328 Ga0070704_100127983
329 Ga0068855_100016190
330 Ga0070664_100000849
331 Ga0070664_100002063
332 Ga0070664_100069220
333 Ga0070664_100244948
334 Ga0068857_100520618
335 Ga0068854_100004966
336 Ga0068854_100021812
337 Ga0068854_100033020
338 Ga0068856_100001220
339 Ga0068856_100419231
340 Ga0068852_100123101
341 Ga0068859_100069278
342 Ga0068864_100026361
343 Ga0068864_100102264
344 Ga0068861_100053121
345 Ga0068863_100011392
346 Ga0068863_100021346
347 Ga0068863_100166154
348 Ga0068862_100097285
349 Ga0070717_10055953
350 Ga0075364_10186612
351 Ga0075431_100009478
352 Ga0075429_100183298
353 Ga0097620_100016663
354 Ga0097620_100069275
355 Ga0111539_10157647
356 Ga0105241_10342710
357 Ga0105248_10006386
358 Ga0105248_10031122
359 Ga0105237_10355580
360 Ga0105249_10390873
361 Ga0105249_10451293
362 Ga0157373_10112934
363 Ga0157370_10010104
364 Ga0157370_10119384
365 Ga0157369_10011511
366 Ga0157378_10471553
367 Ga0157372_10367673
368 Ga0157380_10140191
369 Ga0163161_10013343
370 Ga0207697_10000969
371 Ga0207682_10000494
372 Ga0207688_10149726
373 Ga0207647_10033341
374 Ga0207705_10000067
375 Ga0207707_10014856
376 Ga0207695_10094901
377 Ga0207660_10000379
378 Ga0207657_10019943
379 Ga0207657_10041930
380 Ga0207657_10065188
381 Ga0207657_10432511
382 Ga0207649_10011307
383 Ga0207649_10045369
384 Ga0207652_10000058
385 Ga0207681_10008796
386 Ga0207650_10017606
387 Ga0207650_10029028
388 Ga0207650_10132950
389 Ga0207650_10256459
390 Ga0207650_10353095
391 Ga0207659_10013644
392 Ga0207664_10165161
393 Ga0207644_10000138
394 Ga0207690_10044073
395 Ga0207706_10000276
396 Ga0207706_10085028
397 Ga0207706_10156825
398 Ga0207706_10267100
399 Ga0207669_10021869
400 Ga0207669_10324367
401 Ga0207665_10049051
402 Ga0207691_10035726
403 Ga0207711_10001163
404 Ga0207711_10129799
405 Ga0207661_10024457
406 Ga0207679_10025785
407 Ga0207679_10027981
408 Ga0207679_10095305
409 Ga0207679_10321985
410 Ga0207667_10000828
411 Ga0207668_10004430
412 Ga0207668_10057467
413 Ga0207640_10036970
414 Ga0207640_10071631
415 Ga0207640_10110868
416 Ga0207639_10182196
417 Ga0207639_10322347
418 Ga0207678_10002816
419 Ga0207678_10020251
420 Ga0207678_10021079
421 Ga0207678_10293173
422 Ga0207702_10001153
423 Ga0207702_10150179
424 Ga0207641_10051301
425 Ga0207641_10108242
426 Ga0207648_10036823
427 Ga0207648_10061680
428 Ga0207676_10010750
429 Ga0207674_10328482
430 Ga0207675_100008969
431 Ga0207683_10004703
432 Ga0207683_10065725
433 Ga0207698_10058216
434 Ga0207698_10483228
435 Ga0268265_10184199
436 Ga0268264_10306344
437 Ga0307408_100165545
438 Ga0307413_10012008
439 Ga0307413_10051060
440 Ga0307413_10124809
441 Ga0307410_10079353
442 Ga0307410_10353812
443 Ga0307407_10205504
444 Ga0307412_10066668
445 Ga0307412_10415261
446 Ga0307409_100008719
447 Ga0307409_100420963
448 Ga0307409_100455388
449 Ga0307416_100088120
450 Ga0307416_100266878
451 Ga0307414_10004982
452 Ga0307414_10018385
453 Ga0307414_10022979
454 Ga0307414_10114629
455 Ga0307414_10146749
456 Ga0307414_10176081
457 Ga0307414_10206675
458 Ga0307411_10011766
459 Ga0307411_10040491
460 Ga0307411_10059715
461 Ga0307411_10138757
462 Ga0307415_100080767
463 Ga0307415_100218739
464 Ga0373941_0113443
465 Ga0395899_0008223
466 Ga0395899_0025675
467 Ga0395899_0043242
468 Ga0395899_0046217
469 Ga0395899_0080280
470 Ga0395899_0173849
471 Ga0395899_0181589
472 Ga0395900_0002103
473 Ga0395900_0003952
474 Ga0395900_0011120
475 Ga0395900_0016290
476 Ga0395900_0031577
477 Ga0395900_0060046
478 Ga0395900_0089276
479 Ga0395900_0653775
480 Ga0395898_0101767
481 Ga0395905_0001572
482 Ga0395905_0010599
483 Ga0395905_0023354
484 Ga0395905_0039152
485 Ga0395905_0070942
486 Ga0395905_0273358
487 Ga0395905_0472755
488 Ga0395901_0006236
489 Ga0395901_0011353
490 Ga0395901_0015289
491 Ga0395901_0061072
492 Ga0395901_0081578
493 Ga0395901_0108603
494 Ga0395901_0128611
495 Ga0395901_0133127
496 Ga0395901_0272229
497 Ga0436365_0899740
498 Ga0439445_0004007
499 Ga0450905_000113
500 Ga0450889_000213
501 Ga0466967_0040653
502 Ga0495663_0000955
503 Ga0495663_0036686
504 Ga0495663_0045449
505 Ga0495663_0064946
506 Ga0495598_0013977
507 Ga0495598_0030011
508 Ga0495598_0102876
509 Ga0495621_0008584
510 Ga0495621_0226919
511 Ga0495633_0013578
512 Ga0495633_0019241
513 Ga0495659_0002834
514 Ga0495670_0006037
515 Ga0495670_0021371
516 Ga0495670_0043165
517 Ga0495677_0019890
518 Ga0496101_0043850
519 Ga0496106_0134454
520 Ga0496107_0063820
521 Ga0496108_0525966
522 Ga0496109_0002117
523 Ga0496112_0001994
524 Ga0496114_0007186
525 Ga0496115_0041532
526 Ga0501068_0090879
527 nmdc:mga00v17_233450_c1
528 nmdc:mga09592_184655_c1
529 nmdc:mga06r32_63335_c1
530 nmdc:mga08y16_155987_c1
531 Ga0466962_0115257
532 2896431834

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map