F373599
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 265 | 223 | 169 | 86 |
Family's Representative Sequence
| Representative Sequence | 3300048929|Ga0496126_0248201|Ga0496126_0248201_783_1067 |
| Length | 94 |
| Sequence | MRMKSQKHLSHPGIIKRLKRAHGHLASVIAMIEEGRSCVDLAQQLHAVESAVTNAKRELIQDHMEHCLGDAKSGVNAASALAEFKTLAKYLSRT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2506520007 | Serratia plymuthica AS9 | Isolate | Rhizosphere |
| 2 | 2506520008 | Serratia plymuthica AS12 | Isolate | Unclassified |
| 3 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 4 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 5 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 6 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 7 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 8 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 9 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 10 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 11 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 12 | 2585427591 | Rahnella aquatilis OV744 | Isolate | Rhizosphere |
| 13 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 14 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 15 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 16 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 17 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 18 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 19 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 20 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 21 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 22 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 23 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 24 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 25 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 26 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 27 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 28 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 29 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 30 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 31 | 2861691609 | Methylorubrum thiocyanatum DSM 11490 | Isolate | Rhizosphere |
| 32 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 33 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 34 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 35 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 36 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 37 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 38 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 39 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 40 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 41 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 42 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 43 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 44 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 45 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 46 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 47 | 2889306138 | Methylobacterium sp. PvR107 | Isolate | Rhizosphere |
| 48 | 2902330777 | Methylobacterium sp. 2A | Isolate | Unclassified |
| 49 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 50 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 51 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 52 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 53 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 54 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 55 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 56 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 57 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 58 | 2929199973 | Roseomonas sp. R-73070 Hybrid assembly | Isolate | Unclassified |
| 59 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 60 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 61 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 62 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 63 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 64 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 65 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 66 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 67 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 68 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 69 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 70 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 71 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 72 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 73 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 74 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 75 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 76 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 77 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 78 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 79 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 80 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 81 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 82 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 83 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 84 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 85 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 86 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 87 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 88 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 89 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 90 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 91 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 92 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 93 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 94 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 95 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 96 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 97 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 98 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 99 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 100 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 102 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 103 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 107 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 108 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 109 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 110 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 111 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 114 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 115 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 116 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 117 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 118 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 119 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 120 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 121 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 122 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 123 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 124 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 140 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 141 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 142 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 164 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 165 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 166 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 167 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 168 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 169 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 170 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 171 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 172 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 173 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 174 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 175 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 176 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 177 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 178 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 179 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 180 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 181 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 182 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 183 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 190 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 191 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 192 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 193 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 194 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 195 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 196 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 197 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 198 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 199 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 200 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 201 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 202 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 203 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 204 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 205 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 206 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 207 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 208 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 209 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 210 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 211 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 212 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 213 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 214 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 215 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 216 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 217 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 218 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 219 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 221 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 222 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 223 | 8054563764 | Acuticoccus kalidii M5D2P5 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 63.77 |
| Metatranscriptomes | 0 |
| Isolates | 36.23 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.77 |
| Nodule | 29.43 |
| Rhizoplane | 3.02 |
| Rhizosphere | 54.34 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.43 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10000109 | 3300003203 | Bacteria | 36339 |
| 2 | JGI25406J46586_10014294 | 3300003203 | Bacteria | 3379 |
| 3 | JGI25406J46586_10043172 | 3300003203 | Bacteria | 1572 |
| 4 | JGI25165J46597_1000093 | 3300003214 | Bacteria | 164901 |
| 5 | rootH1_10002542 | 3300003323 | Bacteria | 3802 |
| 6 | JGI25404J52841_10072557 | 3300003659 | Bacteria | 719 |
| 7 | Ga0065715_10177548 | 3300005293 | Bacteria | 1445 |
| 8 | Ga0065707_10749256 | 3300005295 | Unclassified | 619 |
| 9 | Ga0070658_10262595 | 3300005327 | Bacteria | 1467 |
| 10 | Ga0070680_100009595 | 3300005336 | Bacteria | 7439 |
| 11 | Ga0070682_100004765 | 3300005337 | Bacteria | 7543 |
| 12 | Ga0070660_100479703 | 3300005339 | Bacteria | 1033 |
| 13 | Ga0070659_100089700 | 3300005366 | Bacteria | 2463 |
| 14 | Ga0070711_100450705 | 3300005439 | Bacteria | 1053 |
| 15 | Ga0070700_100829816 | 3300005441 | Bacteria | 747 |
| 16 | Ga0070681_10246541 | 3300005458 | Bacteria | 1699 |
| 17 | Ga0070706_101917862 | 3300005467 | Bacteria | 537 |
| 18 | Ga0070679_100003717 | 3300005530 | Bacteria | 13988 |
| 19 | Ga0068853_100010013 | 3300005539 | Bacteria | 7655 |
| 20 | Ga0068853_100012142 | 3300005539 | Bacteria | 7006 |
| 21 | Ga0070693_100011942 | 3300005547 | Bacteria | 4384 |
| 22 | Ga0070665_100004128 | 3300005548 | Bacteria | 15284 |
| 23 | Ga0070665_100788325 | 3300005548 | Bacteria | 963 |
| 24 | Ga0068857_100020193 | 3300005577 | Bacteria | 5857 |
| 25 | Ga0068854_101603612 | 3300005578 | Bacteria | 593 |
| 26 | Ga0068854_101687719 | 3300005578 | Bacteria | 579 |
| 27 | Ga0068861_100553151 | 3300005719 | Bacteria | 1049 |
| 28 | Ga0081455_10020560 | 3300005937 | Bacteria | 6211 |
| 29 | Ga0081455_10669061 | 3300005937 | Bacteria | 666 |
| 30 | Ga0081455_11008873 | 3300005937 | Bacteria | 515 |
| 31 | Ga0081540_1001948 | 3300005983 | Bacteria | 17272 |
| 32 | Ga0081540_1008587 | 3300005983 | Bacteria | 7118 |
| 33 | Ga0081539_10000954 | 3300005985 | Bacteria | 54181 |
| 34 | Ga0081539_10001010 | 3300005985 | Bacteria | 51943 |
| 35 | Ga0081539_10005447 | 3300005985 | Bacteria | 12989 |
| 36 | Ga0081539_10199523 | 3300005985 | Bacteria | 925 |
| 37 | Ga0075365_10046605 | 3300006038 | Bacteria | 2848 |
| 38 | Ga0075364_11089453 | 3300006051 | Bacteria | 542 |
| 39 | Ga0070712_100073555 | 3300006175 | Bacteria | 2452 |
| 40 | Ga0075433_10853389 | 3300006852 | Unclassified | 795 |
| 41 | Ga0079104_1040766 | 3300006946 | Bacteria | 1085 |
| 42 | Ga0105244_10000008 | 3300009036 | Bacteria | 302297 |
| 43 | Ga0105250_10003351 | 3300009092 | Bacteria | 7612 |
| 44 | Ga0105240_10043557 | 3300009093 | Bacteria | 5710 |
| 45 | Ga0105247_10000045 | 3300009101 | Bacteria | 153175 |
| 46 | Ga0105241_10054292 | 3300009174 | Bacteria | 3066 |
| 47 | Ga0105241_10229372 | 3300009174 | Bacteria | 1565 |
| 48 | Ga0105237_10015978 | 3300009545 | Bacteria | 7805 |
| 49 | Ga0105237_10044367 | 3300009545 | Bacteria | 4476 |
| 50 | Ga0105237_10635448 | 3300009545 | Bacteria | 1074 |
| 51 | Ga0105237_11832359 | 3300009545 | Bacteria | 614 |
| 52 | Ga0105237_12464139 | 3300009545 | Bacteria | 531 |
| 53 | Ga0105238_10009507 | 3300009551 | Bacteria | 9729 |
| 54 | Ga0105238_11001832 | 3300009551 | Bacteria | 856 |
| 55 | Ga0105239_10010956 | 3300010375 | Bacteria | 10127 |
| 56 | Ga0105239_10031239 | 3300010375 | Bacteria | 5859 |
| 57 | Ga0105239_10070177 | 3300010375 | Bacteria | 3849 |
| 58 | Ga0105239_10365426 | 3300010375 | Bacteria | 1630 |
| 59 | Ga0157373_10008938 | 3300013100 | Bacteria | 7410 |
| 60 | Ga0157370_10014696 | 3300013104 | Bacteria | 7996 |
| 61 | Ga0157370_11005191 | 3300013104 | Bacteria | 755 |
| 62 | Ga0157369_10095638 | 3300013105 | Bacteria | 3169 |
| 63 | Ga0157374_10032560 | 3300013296 | Bacteria | 4748 |
| 64 | Ga0163162_11509806 | 3300013306 | Bacteria | 765 |
| 65 | Ga0157372_10003339 | 3300013307 | Bacteria | 17323 |
| 66 | Ga0157376_10494745 | 3300014969 | Bacteria | 1201 |
| 67 | Ga0214542_1014550 | 3300021321 | Bacteria | 8715 |
| 68 | Ga0214543_1000012 | 3300021327 | Bacteria | 338982 |
| 69 | Ga0228710_1022166 | 3300022740 | Bacteria | 4944 |
| 70 | Ga0209233_1000053 | 3300025261 | Bacteria | 444909 |
| 71 | Ga0207696_1000001 | 3300025711 | Bacteria | 2579611 |
| 72 | Ga0207655_1000083 | 3300025728 | Bacteria | 213295 |
| 73 | Ga0207713_1000016 | 3300025735 | Bacteria | 421689 |
| 74 | Ga0207710_10000070 | 3300025900 | Bacteria | 151890 |
| 75 | Ga0207705_10126917 | 3300025909 | Bacteria | 1897 |
| 76 | Ga0207654_10028437 | 3300025911 | Bacteria | 3047 |
| 77 | Ga0207654_10183873 | 3300025911 | Bacteria | 1365 |
| 78 | Ga0207707_10185693 | 3300025912 | Bacteria | 1814 |
| 79 | Ga0207671_10000464 | 3300025914 | Bacteria | 55643 |
| 80 | Ga0207671_10023099 | 3300025914 | Bacteria | 4692 |
| 81 | Ga0207693_10896141 | 3300025915 | Bacteria | 681 |
| 82 | Ga0207663_10689980 | 3300025916 | Bacteria | 808 |
| 83 | Ga0207660_10672822 | 3300025917 | Bacteria | 844 |
| 84 | Ga0207652_10023401 | 3300025921 | Bacteria | 5117 |
| 85 | Ga0207694_10062210 | 3300025924 | Bacteria | 2906 |
| 86 | Ga0207694_10981604 | 3300025924 | Bacteria | 715 |
| 87 | Ga0207690_10173137 | 3300025932 | Bacteria | 1619 |
| 88 | Ga0207640_11741505 | 3300025981 | Bacteria | 563 |
| 89 | Ga0207639_10020276 | 3300026041 | Bacteria | 4756 |
| 90 | Ga0207702_10895280 | 3300026078 | Bacteria | 879 |
| 91 | Ga0207674_10026278 | 3300026116 | Bacteria | 6189 |
| 92 | Ga0207675_102444407 | 3300026118 | Bacteria | 534 |
| 93 | Ga0268266_10000743 | 3300028379 | Bacteria | 43674 |
| 94 | Ga0265338_10012603 | 3300028800 | Bacteria | 9629 |
| 95 | Ga0307513_10234000 | 3300031456 | Bacteria | 1648 |
| 96 | Ga0307408_100395907 | 3300031548 | Bacteria | 1185 |
| 97 | Ga0307413_10720226 | 3300031824 | Bacteria | 831 |
| 98 | Ga0307510_10054268 | 3300033180 | Bacteria | 4201 |
| 99 | Ga0315913_1006111 | 3300033430 | Bacteria | 14610 |
| 100 | Ga0373923_0115188 | 3300035111 | Bacteria | 1197 |
| 101 | Ga0373935_0070229 | 3300035692 | Bacteria | 2257 |
| 102 | Ga0373927_0537336 | 3300035695 | Bacteria | 773 |
| 103 | Ga0373937_0578296 | 3300036401 | Bacteria | 1067 |
| 104 | Ga0373937_1362045 | 3300036401 | Unclassified | 657 |
| 105 | Ga0373925_0177407 | 3300037068 | Bacteria | 1685 |
| 106 | Ga0373925_0371408 | 3300037068 | Bacteria | 1164 |
| 107 | Ga0395900_0071963 | 3300037418 | Bacteria | 3555 |
| 108 | Ga0395900_0241225 | 3300037418 | Bacteria | 1813 |
| 109 | Ga0395900_0750367 | 3300037418 | Bacteria | 906 |
| 110 | Ga0395898_1241340 | 3300037466 | Bacteria | 676 |
| 111 | Ga0395905_0027683 | 3300037471 | Bacteria | 5345 |
| 112 | Ga0395905_0046942 | 3300037471 | Bacteria | 4049 |
| 113 | Ga0395905_0619348 | 3300037471 | Bacteria | 984 |
| 114 | Ga0395905_0991836 | 3300037471 | Bacteria | 743 |
| 115 | Ga0395901_0035780 | 3300038443 | Bacteria | 5131 |
| 116 | Ga0395901_0112227 | 3300038443 | Bacteria | 2863 |
| 117 | Ga0395901_1447109 | 3300038443 | Bacteria | 644 |
| 118 | Ga0439448_0021107 | 3300042005 | Bacteria | 2019 |
| 119 | Ga0451577_2003825 | 3300042876 | Bacteria | 506 |
| 120 | Ga0466964_0792578 | 3300044706 | Bacteria | 535 |
| 121 | Ga0466968_0532180 | 3300044735 | Bacteria | 588 |
| 122 | Ga0466960_0990884 | 3300044901 | Bacteria | 516 |
| 123 | Ga0495662_0269948 | 3300046476 | Bacteria | 837 |
| 124 | Ga0495628_0851689 | 3300046516 | Bacteria | 635 |
| 125 | Ga0495630_0943229 | 3300046517 | Bacteria | 657 |
| 126 | Ga0495652_0513836 | 3300046529 | Unclassified | 829 |
| 127 | Ga0495640_0006232 | 3300046533 | Bacteria | 9441 |
| 128 | Ga0495674_0052327 | 3300047319 | Bacteria | 3594 |
| 129 | Ga0496102_0453726 | 3300048905 | Bacteria | 1203 |
| 130 | Ga0496102_0497348 | 3300048905 | Bacteria | 1141 |
| 131 | Ga0496104_0800835 | 3300048907 | Bacteria | 848 |
| 132 | Ga0496109_0648395 | 3300048912 | Bacteria | 993 |
| 133 | Ga0496110_0765635 | 3300048913 | Bacteria | 869 |
| 134 | Ga0496112_0064635 | 3300048915 | Bacteria | 3611 |
| 135 | Ga0496112_0843124 | 3300048915 | Bacteria | 840 |
| 136 | Ga0496115_0299516 | 3300048918 | Bacteria | 1318 |
| 137 | Ga0496116_0000001 | 3300048919 | Bacteria | 1501681 |
| 138 | Ga0496117_0000536 | 3300048920 | Bacteria | 62434 |
| 139 | Ga0496119_0063381 | 3300048922 | Bacteria | 2199 |
| 140 | Ga0496119_0115669 | 3300048922 | Bacteria | 1481 |
| 141 | Ga0496120_0002492 | 3300048923 | Bacteria | 18506 |
| 142 | Ga0496126_0245999 | 3300048929 | Bacteria | 1492 |
| 143 | Ga0496126_0248201 | 3300048929 | Bacteria | 1484 |
| 144 | Ga0501032_0829030 | 3300049569 | Bacteria | 584 |
| 145 | Ga0501033_0018227 | 3300049570 | Bacteria | 5304 |
| 146 | Ga0501034_0074293 | 3300049571 | Bacteria | 3408 |
| 147 | Ga0501037_0115515 | 3300049573 | Bacteria | 1932 |
| 148 | Ga0501043_0530859 | 3300049579 | Bacteria | 876 |
| 149 | Ga0501047_0508663 | 3300049581 | Bacteria | 1031 |
| 150 | Ga0501047_0654019 | 3300049581 | Bacteria | 870 |
| 151 | Ga0501068_0069997 | 3300049584 | Bacteria | 2140 |
| 152 | Ga0501070_0002621 | 3300049586 | Bacteria | 15711 |
| 153 | Ga0501070_0009046 | 3300049586 | Bacteria | 8425 |
| 154 | Ga0501070_0777688 | 3300049586 | Bacteria | 753 |
| 155 | Ga0501074_0009910 | 3300049590 | Bacteria | 6923 |
| 156 | Ga0501080_0000400 | 3300049742 | Bacteria | 33491 |
| 157 | Ga0501080_0200183 | 3300049742 | Bacteria | 1834 |
| 158 | Ga0501035_0011671 | 3300049822 | Bacteria | 8143 |
| 159 | Ga0501044_0006750 | 3300049823 | Bacteria | 12652 |
| 160 | nmdc:mga00v17_828822_c1 | 3300050491 | Bacteria | 588 |
| 161 | nmdc:mga0yw44_1077818_c1 | 3300050492 | Bacteria | 543 |
| 162 | nmdc:mga0a205_808307_c1 | 3300050515 | Unclassified | 785 |
| 163 | Ga0500616_0000120 | 3300053153 | Bacteria | 142980 |
| 164 | Ga0500622_0066197 | 3300053156 | Bacteria | 1835 |
| 165 | Ga0500627_0062548 | 3300053158 | Bacteria | 1639 |
| 166 | Ga0500627_0072940 | 3300053158 | Bacteria | 1522 |
| 167 | Ga0501084_1167909 | 3300054114 | Unclassified | 646 |
| 168 | Ga0501082_0975811 | 3300060353 | Bacteria | 741 |
| 169 | Ga0530510_1351220 | 3300061734 | Unclassified | 547 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053156 | Ga0500622_0066197 | Ga0500622_0066197_243_485 | 79 |
| 2 | iso_pu_bacteria | 2513237090 | 2513609273 | 81 |
| 3 | iso_pu_bacteria | 2693429783 | 2694631486 | 81 |
| 4 | iso_pu_bacteria | 2693429784 | 2694640473 | 81 |
| 5 | iso_pu_bacteria | 2847670302 | 2847671631 | 81 |
| 6 | iso_pu_bacteria | 2856314179 | 2856318638 | 81 |
| 7 | iso_pu_bacteria | 2857349434 | 2857356073 | 81 |
| 8 | iso_pu_bacteria | 2871495908 | 2871500067 | 81 |
| 9 | iso_pu_bacteria | 2876369609 | 2876374019 | 81 |
| 10 | iso_pu_bacteria | 2876377896 | 2876385095 | 81 |
| 11 | iso_pu_bacteria | 2876392853 | 2876393481 | 81 |
| 12 | iso_pu_bacteria | 2878035449 | 2878037975 | 81 |
| 13 | iso_pu_bacteria | 2878760144 | 2878764199 | 81 |
| 14 | iso_pu_bacteria | 2878767105 | 2878771257 | 81 |
| 15 | iso_pu_bacteria | 2881147464 | 2881153415 | 81 |
| 16 | iso_pu_bacteria | 2881161766 | 2881162591 | 81 |
| 17 | iso_pu_bacteria | 2885305155 | 2885311389 | 81 |
| 18 | iso_pu_bacteria | 2885326080 | 2885333031 | 81 |
| 19 | iso_pu_bacteria | 2885334103 | 2885334479 | 81 |
| 20 | iso_pu_bacteria | 2888350351 | 2888350424 | 81 |
| 21 | iso_pu_bacteria | 2889010040 | 2889012731 | 81 |
| 22 | iso_pu_bacteria | 2889016732 | 2889022364 | 81 |
| 23 | iso_pu_bacteria | 2903540706 | 2903544882 | 81 |
| 24 | iso_pu_bacteria | 2904659560 | 2904659988 | 81 |
| 25 | iso_pu_bacteria | 2906354277 | 2906354436 | 81 |
| 26 | iso_pu_bacteria | 2906414383 | 2906418676 | 81 |
| 27 | iso_pu_bacteria | 2922130491 | 2922136957 | 81 |
| 28 | iso_pu_bacteria | 2922185730 | 2922191835 | 81 |
| 29 | iso_pu_bacteria | 2937994558 | 2937998726 | 81 |
| 30 | iso_pu_bacteria | 2938014810 | 2938015739 | 81 |
| 31 | iso_pu_bacteria | 2958100919 | 2958103342 | 81 |
| 32 | iso_pu_bacteria | 2958165035 | 2958169202 | 81 |
| 33 | iso_pu_bacteria | 2958172287 | 2958173712 | 81 |
| 34 | iso_pu_bacteria | 2961114664 | 2961115312 | 81 |
| 35 | iso_pu_bacteria | 2961163497 | 2961167663 | 81 |
| 36 | iso_pu_bacteria | 2965018300 | 2965022483 | 81 |
| 37 | iso_pu_bacteria | 2965119406 | 2965126771 | 81 |
| 38 | iso_pu_bacteria | 2968110612 | 2968111044 | 81 |
| 39 | iso_pu_bacteria | 2968117919 | 2968118070 | 81 |
| 40 | iso_pu_bacteria | 2968171901 | 2968176067 | 81 |
| 41 | iso_pu_bacteria | 2970554993 | 2970559044 | 81 |
| 42 | iso_pu_bacteria | 2977942078 | 2977948557 | 81 |
| 43 | iso_pu_bacteria | 2977971508 | 2977976274 | 81 |
| 44 | iso_pu_bacteria | 2979710463 | 2979713440 | 81 |
| 45 | iso_pu_bacteria | 2979742915 | 2979752067 | 81 |
| 46 | iso_pu_bacteria | 2987636660 | 2987639886 | 81 |
| 47 | iso_pu_bacteria | 2987652177 | 2987653177 | 81 |
| 48 | iso_pu_bacteria | 2987659509 | 2987663671 | 81 |
| 49 | iso_pu_bacteria | 2996348954 | 2996356281 | 81 |
| 50 | iso_pu_bacteria | 3004188549 | 3004192730 | 81 |
| 51 | iso_pu_bacteria | 3004203850 | 3004207459 | 81 |
| 52 | iso_pu_bacteria | 8004640170 | 8004642639 | 81 |
| 53 | 3300005336 | Ga0070680_100009595 | Ga0070680_1000095952 | 82 |
| 54 | 3300005337 | Ga0070682_100004765 | Ga0070682_1000047652 | 82 |
| 55 | 3300005339 | Ga0070660_100479703 | Ga0070660_1004797032 | 82 |
| 56 | 3300005366 | Ga0070659_100089700 | Ga0070659_1000897002 | 82 |
| 57 | 3300005458 | Ga0070681_10246541 | Ga0070681_102465412 | 82 |
| 58 | 3300005530 | Ga0070679_100003717 | Ga0070679_1000037173 | 82 |
| 59 | 3300005539 | Ga0068853_100010013 | Ga0068853_1000100132 | 82 |
| 60 | 3300005547 | Ga0070693_100011942 | Ga0070693_1000119424 | 82 |
| 61 | 3300005577 | Ga0068857_100020193 | Ga0068857_1000201933 | 82 |
| 62 | 3300005578 | Ga0068854_101687719 | Ga0068854_1016877192 | 82 |
| 63 | 3300009174 | Ga0105241_10054292 | Ga0105241_100542922 | 82 |
| 64 | 3300009545 | Ga0105237_12464139 | Ga0105237_124641392 | 82 |
| 65 | 3300010375 | Ga0105239_10070177 | Ga0105239_100701772 | 82 |
| 66 | 3300013100 | Ga0157373_10008938 | Ga0157373_100089388 | 82 |
| 67 | 3300013104 | Ga0157370_10014696 | Ga0157370_100146964 | 82 |
| 68 | 3300013307 | Ga0157372_10003339 | Ga0157372_1000333918 | 82 |
| 69 | 3300025911 | Ga0207654_10028437 | Ga0207654_100284373 | 82 |
| 70 | 3300025912 | Ga0207707_10185693 | Ga0207707_101856932 | 82 |
| 71 | 3300025917 | Ga0207660_10672822 | Ga0207660_106728222 | 82 |
| 72 | 3300025921 | Ga0207652_10023401 | Ga0207652_100234014 | 82 |
| 73 | 3300025932 | Ga0207690_10173137 | Ga0207690_101731372 | 82 |
| 74 | 3300026041 | Ga0207639_10020276 | Ga0207639_100202762 | 82 |
| 75 | 3300026116 | Ga0207674_10026278 | Ga0207674_100262783 | 82 |
| 76 | 3300042005 | Ga0439448_0021107 | Ga0439448_0021107_123_371 | 82 |
| 77 | 3300049571 | Ga0501034_0074293 | Ga0501034_0074293_999_1247 | 82 |
| 78 | 3300049581 | Ga0501047_0508663 | Ga0501047_0508663_22_270 | 82 |
| 79 | 3300049742 | Ga0501080_0200183 | Ga0501080_0200183_677_925 | 82 |
| 80 | iso_pu_bacteria | 3002141150 | 3002145975 | 82 |
| 81 | iso_pu_bacteria | 8054563764 | 8054565778 | 82 |
| 82 | 3300028800 | Ga0265338_10012603 | Ga0265338_100126034 | 84 |
| 83 | 3300061734 | Ga0530510_1351220 | Ga0530510_1351220_158_418 | 84 |
| 84 | iso_pu_bacteria | 2889306138 | 2889309794 | 84 |
| 85 | iso_pu_bacteria | 643348564 | 643599976 | 84 |
| 86 | 3300003214 | JGI25165J46597_1000093 | JGI25165J46597_1000093152 | 85 |
| 87 | 3300003323 | rootH1_10002542 | rootH1_100025422 | 85 |
| 88 | 3300005539 | Ga0068853_100012142 | Ga0068853_1000121423 | 85 |
| 89 | 3300005578 | Ga0068854_101603612 | Ga0068854_1016036122 | 85 |
| 90 | 3300009093 | Ga0105240_10043557 | Ga0105240_100435573 | 85 |
| 91 | 3300009174 | Ga0105241_10229372 | Ga0105241_102293722 | 85 |
| 92 | 3300009545 | Ga0105237_10044367 | Ga0105237_100443672 | 85 |
| 93 | 3300009545 | Ga0105237_10635448 | Ga0105237_106354482 | 85 |
| 94 | 3300009551 | Ga0105238_10009507 | Ga0105238_100095074 | 85 |
| 95 | 3300010375 | Ga0105239_10031239 | Ga0105239_100312392 | 85 |
| 96 | 3300010375 | Ga0105239_10365426 | Ga0105239_103654262 | 85 |
| 97 | 3300013104 | Ga0157370_11005191 | Ga0157370_110051911 | 85 |
| 98 | 3300013105 | Ga0157369_10095638 | Ga0157369_100956382 | 85 |
| 99 | 3300025261 | Ga0209233_1000053 | Ga0209233_100005334 | 85 |
| 100 | 3300025911 | Ga0207654_10183873 | Ga0207654_101838732 | 85 |
| 101 | 3300025914 | Ga0207671_10023099 | Ga0207671_100230994 | 85 |
| 102 | 3300025924 | Ga0207694_10062210 | Ga0207694_100622102 | 85 |
| 103 | 3300025981 | Ga0207640_11741505 | Ga0207640_117415051 | 85 |
| 104 | 3300026078 | Ga0207702_10895280 | Ga0207702_108952802 | 85 |
| 105 | 3300037418 | Ga0395900_0071963 | Ga0395900_0071963_394_651 | 85 |
| 106 | 3300037418 | Ga0395900_0241225 | Ga0395900_0241225_570_827 | 85 |
| 107 | 3300037418 | Ga0395900_0750367 | Ga0395900_0750367_19_276 | 85 |
| 108 | 3300037466 | Ga0395898_1241340 | Ga0395898_1241340_299_556 | 85 |
| 109 | 3300037471 | Ga0395905_0027683 | Ga0395905_0027683_919_1176 | 85 |
| 110 | 3300037471 | Ga0395905_0046942 | Ga0395905_0046942_681_938 | 85 |
| 111 | 3300037471 | Ga0395905_0619348 | Ga0395905_0619348_10_267 | 85 |
| 112 | 3300037471 | Ga0395905_0991836 | Ga0395905_0991836_456_713 | 85 |
| 113 | 3300038443 | Ga0395901_0035780 | Ga0395901_0035780_2919_3176 | 85 |
| 114 | 3300038443 | Ga0395901_0112227 | Ga0395901_0112227_1687_1944 | 85 |
| 115 | 3300038443 | Ga0395901_1447109 | Ga0395901_1447109_366_623 | 85 |
| 116 | 3300044706 | Ga0466964_0792578 | Ga0466964_0792578_187_444 | 85 |
| 117 | 3300044735 | Ga0466968_0532180 | Ga0466968_0532180_145_402 | 85 |
| 118 | 3300044901 | Ga0466960_0990884 | Ga0466960_0990884_191_448 | 85 |
| 119 | 3300048905 | Ga0496102_0497348 | Ga0496102_0497348_208_465 | 85 |
| 120 | 3300048915 | Ga0496112_0064635 | Ga0496112_0064635_696_953 | 85 |
| 121 | 3300048918 | Ga0496115_0299516 | Ga0496115_0299516_787_1044 | 85 |
| 122 | 3300048922 | Ga0496119_0115669 | Ga0496119_0115669_1118_1375 | 85 |
| 123 | 3300048923 | Ga0496120_0002492 | Ga0496120_0002492_6666_6923 | 85 |
| 124 | 3300048929 | Ga0496126_0245999 | Ga0496126_0245999_1128_1385 | 85 |
| 125 | 3300049569 | Ga0501032_0829030 | Ga0501032_0829030_30_287 | 85 |
| 126 | 3300049570 | Ga0501033_0018227 | Ga0501033_0018227_4709_4966 | 85 |
| 127 | 3300049573 | Ga0501037_0115515 | Ga0501037_0115515_1217_1474 | 85 |
| 128 | 3300049579 | Ga0501043_0530859 | Ga0501043_0530859_116_373 | 85 |
| 129 | 3300049581 | Ga0501047_0654019 | Ga0501047_0654019_366_623 | 85 |
| 130 | 3300049584 | Ga0501068_0069997 | Ga0501068_0069997_1538_1795 | 85 |
| 131 | 3300049586 | Ga0501070_0002621 | Ga0501070_0002621_7494_7751 | 85 |
| 132 | 3300049590 | Ga0501074_0009910 | Ga0501074_0009910_430_687 | 85 |
| 133 | 3300049742 | Ga0501080_0000400 | Ga0501080_0000400_25762_26019 | 85 |
| 134 | 3300049822 | Ga0501035_0011671 | Ga0501035_0011671_7463_7720 | 85 |
| 135 | 3300049823 | Ga0501044_0006750 | Ga0501044_0006750_8491_8748 | 85 |
| 136 | iso_pu_bacteria | 2506520007 | 2506578428 | 85 |
| 137 | iso_pu_bacteria | 2506520008 | 2506583566 | 85 |
| 138 | iso_pu_bacteria | 2585427591 | 2585828597 | 85 |
| 139 | 3300003203 | JGI25406J46586_10014294 | JGI25406J46586_100142943 | 86 |
| 140 | 3300005467 | Ga0070706_101917862 | Ga0070706_1019178622 | 86 |
| 141 | 3300005548 | Ga0070665_100788325 | Ga0070665_1007883252 | 86 |
| 142 | 3300005719 | Ga0068861_100553151 | Ga0068861_1005531512 | 86 |
| 143 | 3300005937 | Ga0081455_11008873 | Ga0081455_110088731 | 86 |
| 144 | 3300005983 | Ga0081540_1008587 | Ga0081540_10085877 | 86 |
| 145 | 3300005985 | Ga0081539_10005447 | Ga0081539_1000544710 | 86 |
| 146 | 3300006038 | Ga0075365_10046605 | Ga0075365_100466052 | 86 |
| 147 | 3300006051 | Ga0075364_11089453 | Ga0075364_110894531 | 86 |
| 148 | 3300013306 | Ga0163162_11509806 | Ga0163162_115098061 | 86 |
| 149 | 3300026118 | Ga0207675_102444407 | Ga0207675_1024444072 | 86 |
| 150 | 3300049586 | Ga0501070_0009046 | Ga0501070_0009046_1550_1810 | 86 |
| 151 | 3300050491 | nmdc:mga00v17_828822_c1 | nmdc:mga00v17_828822_c1_33_293 | 86 |
| 152 | 3300050492 | nmdc:mga0yw44_1077818_c1 | nmdc:mga0yw44_1077818_c1_176_436 | 86 |
| 153 | 3300053158 | Ga0500627_0062548 | Ga0500627_0062548_916_1176 | 86 |
| 154 | 3300053158 | Ga0500627_0072940 | Ga0500627_0072940_797_1057 | 86 |
| 155 | iso_pu_bacteria | 2861691609 | 2861695322 | 86 |
| 156 | iso_pu_bacteria | 2902330777 | 2902331058 | 86 |
| 157 | 3300003659 | JGI25404J52841_10072557 | JGI25404J52841_100725572 | 87 |
| 158 | 3300005937 | Ga0081455_10669061 | Ga0081455_106690611 | 87 |
| 159 | 3300005983 | Ga0081540_1001948 | Ga0081540_10019482 | 87 |
| 160 | 3300013296 | Ga0157374_10032560 | Ga0157374_100325602 | 87 |
| 161 | 3300048913 | Ga0496110_0765635 | Ga0496110_0765635_189_455 | 87 |
| 162 | 3300054114 | Ga0501084_1167909 | Ga0501084_1167909_280_546 | 87 |
| 163 | 3300060353 | Ga0501082_0975811 | Ga0501082_0975811_387_653 | 87 |
| 164 | iso_pu_bacteria | 2508501122 | 2509110620 | 87 |
| 165 | iso_pu_bacteria | 2509276019 | 2509377439 | 87 |
| 166 | iso_pu_bacteria | 2513237089 | 2513606778 | 87 |
| 167 | iso_pu_bacteria | 2513237160 | 2514007012 | 87 |
| 168 | iso_pu_bacteria | 2516143018 | 2516206445 | 87 |
| 169 | iso_pu_bacteria | 2517487022 | 2517566679 | 87 |
| 170 | iso_pu_bacteria | 2558860100 | 2558864972 | 87 |
| 171 | iso_pu_bacteria | 2585427528 | 2585540093 | 87 |
| 172 | iso_pu_bacteria | 2585427593 | 2585838291 | 87 |
| 173 | iso_pu_bacteria | 2751185821 | 2753461221 | 87 |
| 174 | iso_pu_bacteria | 2802428858 | 2802720121 | 87 |
| 175 | iso_pu_bacteria | 2802428859 | 2802723807 | 87 |
| 176 | iso_pu_bacteria | 2802428861 | 2802739595 | 87 |
| 177 | iso_pu_bacteria | 2802428862 | 2802746019 | 87 |
| 178 | iso_pu_bacteria | 2802428863 | 2802753419 | 87 |
| 179 | iso_pu_bacteria | 2850079185 | 2850084691 | 87 |
| 180 | iso_pu_bacteria | 2915980308 | 2915984336 | 87 |
| 181 | iso_pu_bacteria | 2916061851 | 2916066655 | 87 |
| 182 | iso_pu_bacteria | 2921250672 | 2921254292 | 87 |
| 183 | iso_pu_bacteria | 2937029754 | 2937033970 | 87 |
| 184 | iso_pu_bacteria | 2937036028 | 2937037235 | 87 |
| 185 | iso_pu_bacteria | 2937078374 | 2937080505 | 87 |
| 186 | iso_pu_bacteria | 2957437181 | 2957442746 | 87 |
| 187 | iso_pu_bacteria | 2960591022 | 2960591721 | 87 |
| 188 | iso_pu_bacteria | 2960631154 | 2960637776 | 87 |
| 189 | iso_pu_bacteria | 2967728569 | 2967728652 | 87 |
| 190 | iso_pu_bacteria | 2970026789 | 2970033084 | 87 |
| 191 | iso_pu_bacteria | 2970122695 | 2970129064 | 87 |
| 192 | iso_pu_bacteria | 2977530762 | 2977536939 | 87 |
| 193 | iso_pu_bacteria | 2977544691 | 2977546592 | 87 |
| 194 | 3300005293 | Ga0065715_10177548 | Ga0065715_101775482 | 88 |
| 195 | 3300005295 | Ga0065707_10749256 | Ga0065707_107492562 | 88 |
| 196 | 3300005327 | Ga0070658_10262595 | Ga0070658_102625953 | 88 |
| 197 | 3300005548 | Ga0070665_100004128 | Ga0070665_10000412814 | 88 |
| 198 | 3300005985 | Ga0081539_10199523 | Ga0081539_101995233 | 88 |
| 199 | 3300006852 | Ga0075433_10853389 | Ga0075433_108533892 | 88 |
| 200 | 3300009545 | Ga0105237_10015978 | Ga0105237_100159788 | 88 |
| 201 | 3300009545 | Ga0105237_11832359 | Ga0105237_118323592 | 88 |
| 202 | 3300009551 | Ga0105238_11001832 | Ga0105238_110018322 | 88 |
| 203 | 3300010375 | Ga0105239_10010956 | Ga0105239_100109566 | 88 |
| 204 | 3300014969 | Ga0157376_10494745 | Ga0157376_104947451 | 88 |
| 205 | 3300025909 | Ga0207705_10126917 | Ga0207705_101269172 | 88 |
| 206 | 3300025914 | Ga0207671_10000464 | Ga0207671_1000046446 | 88 |
| 207 | 3300025924 | Ga0207694_10981604 | Ga0207694_109816042 | 88 |
| 208 | 3300028379 | Ga0268266_10000743 | Ga0268266_1000074340 | 88 |
| 209 | 3300031824 | Ga0307413_10720226 | Ga0307413_107202262 | 88 |
| 210 | 3300033180 | Ga0307510_10054268 | Ga0307510_100542683 | 88 |
| 211 | 3300035695 | Ga0373927_0537336 | Ga0373927_0537336_405_671 | 88 |
| 212 | 3300036401 | Ga0373937_0578296 | Ga0373937_0578296_10_276 | 88 |
| 213 | 3300036401 | Ga0373937_1362045 | Ga0373937_1362045_254_520 | 88 |
| 214 | 3300037068 | Ga0373925_0371408 | Ga0373925_0371408_136_402 | 88 |
| 215 | 3300046529 | Ga0495652_0513836 | Ga0495652_0513836_469_735 | 88 |
| 216 | 3300048905 | Ga0496102_0453726 | Ga0496102_0453726_88_354 | 88 |
| 217 | 3300048907 | Ga0496104_0800835 | Ga0496104_0800835_200_466 | 88 |
| 218 | 3300048912 | Ga0496109_0648395 | Ga0496109_0648395_216_482 | 88 |
| 219 | 3300048915 | Ga0496112_0843124 | Ga0496112_0843124_367_633 | 88 |
| 220 | 3300049586 | Ga0501070_0777688 | Ga0501070_0777688_117_383 | 88 |
| 221 | 3300050515 | nmdc:mga0a205_808307_c1 | nmdc:mga0a205_808307_c1_273_539 | 88 |
| 222 | iso_pu_bacteria | 2929199973 | 2929201801 | 88 |
| 223 | 3300009036 | Ga0105244_10000008 | Ga0105244_10000008255 | 89 |
| 224 | 3300009092 | Ga0105250_10003351 | Ga0105250_100033514 | 89 |
| 225 | 3300009101 | Ga0105247_10000045 | Ga0105247_1000004541 | 89 |
| 226 | 3300025711 | Ga0207696_1000001 | Ga0207696_10000011263 | 89 |
| 227 | 3300025728 | Ga0207655_1000083 | Ga0207655_100008334 | 89 |
| 228 | 3300025735 | Ga0207713_1000016 | Ga0207713_1000016227 | 89 |
| 229 | 3300025900 | Ga0207710_10000070 | Ga0207710_1000007041 | 89 |
| 230 | 3300048919 | Ga0496116_0000001 | Ga0496116_0000001_682649_682918 | 89 |
| 231 | 3300048920 | Ga0496117_0000536 | Ga0496117_0000536_8962_9231 | 89 |
| 232 | 3300048922 | Ga0496119_0063381 | Ga0496119_0063381_1254_1523 | 89 |
| 233 | iso_pu_bacteria | 2643221637 | 2644208212 | 89 |
| 234 | iso_pu_bacteria | 2643221718 | 2644651970 | 89 |
| 235 | 3300048929 | Ga0496126_0248201 | Ga0496126_0248201_783_1067 | 90 |
| 236 | 3300006946 | Ga0079104_1040766 | Ga0079104_10407662 | 91 |
| 237 | 3300021321 | Ga0214542_1014550 | Ga0214542_10145507 | 91 |
| 238 | 3300021327 | Ga0214543_1000012 | Ga0214543_100001220 | 91 |
| 239 | 3300022740 | Ga0228710_1022166 | Ga0228710_10221662 | 91 |
| 240 | 3300031456 | Ga0307513_10234000 | Ga0307513_102340002 | 91 |
| 241 | 3300033430 | Ga0315913_1006111 | Ga0315913_100611111 | 91 |
| 242 | iso_pu_bacteria | 2643221607 | 2644050386 | 91 |
| 243 | iso_pu_bacteria | 2643221636 | 2644205614 | 91 |
| 244 | iso_pu_bacteria | 2643221686 | 2644483304 | 91 |
| 245 | 3300003203 | JGI25406J46586_10000109 | JGI25406J46586_100001099 | 92 |
| 246 | 3300003203 | JGI25406J46586_10043172 | JGI25406J46586_100431723 | 92 |
| 247 | 3300005439 | Ga0070711_100450705 | Ga0070711_1004507051 | 92 |
| 248 | 3300005441 | Ga0070700_100829816 | Ga0070700_1008298162 | 92 |
| 249 | 3300005937 | Ga0081455_10020560 | Ga0081455_100205603 | 92 |
| 250 | 3300005985 | Ga0081539_10000954 | Ga0081539_1000095452 | 92 |
| 251 | 3300005985 | Ga0081539_10001010 | Ga0081539_1000101028 | 92 |
| 252 | 3300006175 | Ga0070712_100073555 | Ga0070712_1000735551 | 92 |
| 253 | 3300025915 | Ga0207693_10896141 | Ga0207693_108961412 | 92 |
| 254 | 3300025916 | Ga0207663_10689980 | Ga0207663_106899802 | 92 |
| 255 | 3300031548 | Ga0307408_100395907 | Ga0307408_1003959071 | 92 |
| 256 | 3300035111 | Ga0373923_0115188 | Ga0373923_0115188_208_486 | 92 |
| 257 | 3300035692 | Ga0373935_0070229 | Ga0373935_0070229_1320_1598 | 92 |
| 258 | 3300037068 | Ga0373925_0177407 | Ga0373925_0177407_1179_1457 | 92 |
| 259 | 3300042876 | Ga0451577_2003825 | Ga0451577_2003825_60_338 | 92 |
| 260 | 3300046476 | Ga0495662_0269948 | Ga0495662_0269948_437_715 | 92 |
| 261 | 3300046516 | Ga0495628_0851689 | Ga0495628_0851689_344_622 | 92 |
| 262 | 3300046517 | Ga0495630_0943229 | Ga0495630_0943229_204_482 | 92 |
| 263 | 3300046533 | Ga0495640_0006232 | Ga0495640_0006232_7919_8197 | 92 |
| 264 | 3300047319 | Ga0495674_0052327 | Ga0495674_0052327_2711_2989 | 92 |
| 265 | 3300053153 | Ga0500616_0000120 | Ga0500616_0000120_116986_117267 | 92 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7mq2-assembly1.cif.gz_C | c9a streptococcus pneumoniae cstr in the reduced state, space group p21 | 0.9542 | 9 | 65 |
| 7oq4-assembly1.cif.gz_A | cryo-em structure of the atv rnap inhibitory protein (rip) bound to the dna-binding channel of the host's rna polymerase | 0.9526 | 13 | 52 |
| 6ahx-assembly1.cif.gz_A-2 | copper-sensing operon regulator protein (csorgz) | 0.9346 | 11 | 66 |
| 6ahx-assembly1.cif.gz_A-2 | copper-sensing operon regulator protein (csorgz) | 0.8624 | 11 | 66 |
| 7mq2-assembly1.cif.gz_C | c9a streptococcus pneumoniae cstr in the reduced state, space group p21 | 0.8408 | 9 | 65 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P07814_749_805_1.10.287.10 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding | 0.9295 | 13 | 58 | 1.10.287.10 |
| 5ujjA01 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding | 0.9212 | 13 | 58 | 1.10.287.10 |
| 3aaiC00 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Metal-sensitive repressor, helix protomer | 0.8984 | 12 | 58 | 1.20.58.1000 |
| 1twgA01 | Few Secondary Structures;Irregular;DNA Excision Repair, Uvrb; Chain A;RNA polymerase II, clamp domain | 0.8732 | 9 | 55 | 4.10.860.120 |
| 3aaiB00 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Metal-sensitive repressor, helix protomer | 0.8662 | 12 | 70 | 1.20.58.1000 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A172YKQ6-F1-model_v4 | Metal resistance protein | 0.9733 | 1 | 92 |
GO:0003677
GO:0005737 GO:0045892 GO:0046872 |
| AF-A0A172YKQ6-F1-model_v4 | Metal resistance protein | 0.963 | 1 | 92 |
GO:0003677
GO:0005737 GO:0045892 GO:0046872 |
| AF-A0A2N9W352-F1-model_v4 | Metal resistance protein | 0.9474 | 1 | 92 |
GO:0003677
GO:0005737 GO:0045892 GO:0046872 |
| AF-A0A1W6Z991-F1-model_v4 | Metal resistance protein | 0.9323 | 1 | 92 |
GO:0003677
GO:0045892 GO:0046872 |
| AF-A0A2I8SVG5-F1-model_v4 | Metal resistance protein | 0.9313 | 2 | 92 |
GO:0003677
GO:0005737 GO:0045892 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar