F373599

General Info

Members Datasets Scaffolds Average Seq Length
265 223 169 86

Family's Representative Sequence

Representative Sequence 3300048929|Ga0496126_0248201|Ga0496126_0248201_783_1067
Length 94
Sequence MRMKSQKHLSHPGIIKRLKRAHGHLASVIAMIEEGRSCVDLAQQLHAVESAVTNAKRELIQDHMEHCLGDAKSGVNAASALAEFKTLAKYLSRT

Samples

Sample ID Description Type Environment
1 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
2 2506520008 Serratia plymuthica AS12 Isolate Unclassified
3 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
4 2509276019 Ensifer aridi TW10 Isolate Nodule
5 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
6 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
7 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
8 2516143018 Ensifer sp. BR816 Isolate Nodule
9 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
10 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
11 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
12 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
13 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
14 2643221607 Rhizobium sp. Root73 Isolate Unclassified
15 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
16 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
17 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
18 2643221718 Rhizobium sp. Root268 Isolate Unclassified
19 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
20 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
21 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
22 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
23 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
24 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
25 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
26 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
27 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
28 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
29 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
30 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
31 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
32 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
33 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
34 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
35 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
36 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
37 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
38 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
39 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
40 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
41 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
42 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
43 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
44 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
45 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
46 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
47 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
48 2902330777 Methylobacterium sp. 2A Isolate Unclassified
49 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
50 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
51 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
52 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
53 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
54 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
55 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
56 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
57 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
58 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
59 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
60 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
61 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
62 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
63 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
64 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
65 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
66 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
67 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
68 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
69 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
70 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
71 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
72 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
73 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
74 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
75 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
76 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
77 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
78 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
79 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
80 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
81 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
82 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
83 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
84 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
85 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
86 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
87 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
88 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
89 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
90 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
91 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
92 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
93 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
94 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
95 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
96 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
97 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
98 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
99 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
100 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
101 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
102 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
103 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
104 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
105 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
106 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
107 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
108 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
109 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
110 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
111 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
112 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
113 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
114 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
115 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
116 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
117 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
118 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
119 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
120 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
121 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
122 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
123 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
124 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
125 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
126 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
127 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
128 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
129 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
130 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
131 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
132 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
133 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
134 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
135 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
136 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
137 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
138 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
139 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
140 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
141 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
142 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
143 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
164 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
165 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
166 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
167 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
168 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
169 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
170 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
171 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
172 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
175 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
176 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
177 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
178 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
179 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
180 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
181 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
182 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
183 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
184 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
185 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
186 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
187 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
188 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
189 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
190 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
191 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
192 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
193 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
194 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
195 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
196 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
197 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
198 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
199 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
200 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
207 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
208 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
209 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
210 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
212 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
213 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
214 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
215 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
216 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
217 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
218 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
219 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
220 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
221 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
222 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
223 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 63.77
Metatranscriptomes 0
Isolates 36.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.77
Nodule 29.43
Rhizoplane 3.02
Rhizosphere 54.34
Stem 0
Stem Tuber 0
Unclassified 9.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000109 3300003203 Bacteria 36339
2 JGI25406J46586_10014294 3300003203 Bacteria 3379
3 JGI25406J46586_10043172 3300003203 Bacteria 1572
4 JGI25165J46597_1000093 3300003214 Bacteria 164901
5 rootH1_10002542 3300003323 Bacteria 3802
6 JGI25404J52841_10072557 3300003659 Bacteria 719
7 Ga0065715_10177548 3300005293 Bacteria 1445
8 Ga0065707_10749256 3300005295 Unclassified 619
9 Ga0070658_10262595 3300005327 Bacteria 1467
10 Ga0070680_100009595 3300005336 Bacteria 7439
11 Ga0070682_100004765 3300005337 Bacteria 7543
12 Ga0070660_100479703 3300005339 Bacteria 1033
13 Ga0070659_100089700 3300005366 Bacteria 2463
14 Ga0070711_100450705 3300005439 Bacteria 1053
15 Ga0070700_100829816 3300005441 Bacteria 747
16 Ga0070681_10246541 3300005458 Bacteria 1699
17 Ga0070706_101917862 3300005467 Bacteria 537
18 Ga0070679_100003717 3300005530 Bacteria 13988
19 Ga0068853_100010013 3300005539 Bacteria 7655
20 Ga0068853_100012142 3300005539 Bacteria 7006
21 Ga0070693_100011942 3300005547 Bacteria 4384
22 Ga0070665_100004128 3300005548 Bacteria 15284
23 Ga0070665_100788325 3300005548 Bacteria 963
24 Ga0068857_100020193 3300005577 Bacteria 5857
25 Ga0068854_101603612 3300005578 Bacteria 593
26 Ga0068854_101687719 3300005578 Bacteria 579
27 Ga0068861_100553151 3300005719 Bacteria 1049
28 Ga0081455_10020560 3300005937 Bacteria 6211
29 Ga0081455_10669061 3300005937 Bacteria 666
30 Ga0081455_11008873 3300005937 Bacteria 515
31 Ga0081540_1001948 3300005983 Bacteria 17272
32 Ga0081540_1008587 3300005983 Bacteria 7118
33 Ga0081539_10000954 3300005985 Bacteria 54181
34 Ga0081539_10001010 3300005985 Bacteria 51943
35 Ga0081539_10005447 3300005985 Bacteria 12989
36 Ga0081539_10199523 3300005985 Bacteria 925
37 Ga0075365_10046605 3300006038 Bacteria 2848
38 Ga0075364_11089453 3300006051 Bacteria 542
39 Ga0070712_100073555 3300006175 Bacteria 2452
40 Ga0075433_10853389 3300006852 Unclassified 795
41 Ga0079104_1040766 3300006946 Bacteria 1085
42 Ga0105244_10000008 3300009036 Bacteria 302297
43 Ga0105250_10003351 3300009092 Bacteria 7612
44 Ga0105240_10043557 3300009093 Bacteria 5710
45 Ga0105247_10000045 3300009101 Bacteria 153175
46 Ga0105241_10054292 3300009174 Bacteria 3066
47 Ga0105241_10229372 3300009174 Bacteria 1565
48 Ga0105237_10015978 3300009545 Bacteria 7805
49 Ga0105237_10044367 3300009545 Bacteria 4476
50 Ga0105237_10635448 3300009545 Bacteria 1074
51 Ga0105237_11832359 3300009545 Bacteria 614
52 Ga0105237_12464139 3300009545 Bacteria 531
53 Ga0105238_10009507 3300009551 Bacteria 9729
54 Ga0105238_11001832 3300009551 Bacteria 856
55 Ga0105239_10010956 3300010375 Bacteria 10127
56 Ga0105239_10031239 3300010375 Bacteria 5859
57 Ga0105239_10070177 3300010375 Bacteria 3849
58 Ga0105239_10365426 3300010375 Bacteria 1630
59 Ga0157373_10008938 3300013100 Bacteria 7410
60 Ga0157370_10014696 3300013104 Bacteria 7996
61 Ga0157370_11005191 3300013104 Bacteria 755
62 Ga0157369_10095638 3300013105 Bacteria 3169
63 Ga0157374_10032560 3300013296 Bacteria 4748
64 Ga0163162_11509806 3300013306 Bacteria 765
65 Ga0157372_10003339 3300013307 Bacteria 17323
66 Ga0157376_10494745 3300014969 Bacteria 1201
67 Ga0214542_1014550 3300021321 Bacteria 8715
68 Ga0214543_1000012 3300021327 Bacteria 338982
69 Ga0228710_1022166 3300022740 Bacteria 4944
70 Ga0209233_1000053 3300025261 Bacteria 444909
71 Ga0207696_1000001 3300025711 Bacteria 2579611
72 Ga0207655_1000083 3300025728 Bacteria 213295
73 Ga0207713_1000016 3300025735 Bacteria 421689
74 Ga0207710_10000070 3300025900 Bacteria 151890
75 Ga0207705_10126917 3300025909 Bacteria 1897
76 Ga0207654_10028437 3300025911 Bacteria 3047
77 Ga0207654_10183873 3300025911 Bacteria 1365
78 Ga0207707_10185693 3300025912 Bacteria 1814
79 Ga0207671_10000464 3300025914 Bacteria 55643
80 Ga0207671_10023099 3300025914 Bacteria 4692
81 Ga0207693_10896141 3300025915 Bacteria 681
82 Ga0207663_10689980 3300025916 Bacteria 808
83 Ga0207660_10672822 3300025917 Bacteria 844
84 Ga0207652_10023401 3300025921 Bacteria 5117
85 Ga0207694_10062210 3300025924 Bacteria 2906
86 Ga0207694_10981604 3300025924 Bacteria 715
87 Ga0207690_10173137 3300025932 Bacteria 1619
88 Ga0207640_11741505 3300025981 Bacteria 563
89 Ga0207639_10020276 3300026041 Bacteria 4756
90 Ga0207702_10895280 3300026078 Bacteria 879
91 Ga0207674_10026278 3300026116 Bacteria 6189
92 Ga0207675_102444407 3300026118 Bacteria 534
93 Ga0268266_10000743 3300028379 Bacteria 43674
94 Ga0265338_10012603 3300028800 Bacteria 9629
95 Ga0307513_10234000 3300031456 Bacteria 1648
96 Ga0307408_100395907 3300031548 Bacteria 1185
97 Ga0307413_10720226 3300031824 Bacteria 831
98 Ga0307510_10054268 3300033180 Bacteria 4201
99 Ga0315913_1006111 3300033430 Bacteria 14610
100 Ga0373923_0115188 3300035111 Bacteria 1197
101 Ga0373935_0070229 3300035692 Bacteria 2257
102 Ga0373927_0537336 3300035695 Bacteria 773
103 Ga0373937_0578296 3300036401 Bacteria 1067
104 Ga0373937_1362045 3300036401 Unclassified 657
105 Ga0373925_0177407 3300037068 Bacteria 1685
106 Ga0373925_0371408 3300037068 Bacteria 1164
107 Ga0395900_0071963 3300037418 Bacteria 3555
108 Ga0395900_0241225 3300037418 Bacteria 1813
109 Ga0395900_0750367 3300037418 Bacteria 906
110 Ga0395898_1241340 3300037466 Bacteria 676
111 Ga0395905_0027683 3300037471 Bacteria 5345
112 Ga0395905_0046942 3300037471 Bacteria 4049
113 Ga0395905_0619348 3300037471 Bacteria 984
114 Ga0395905_0991836 3300037471 Bacteria 743
115 Ga0395901_0035780 3300038443 Bacteria 5131
116 Ga0395901_0112227 3300038443 Bacteria 2863
117 Ga0395901_1447109 3300038443 Bacteria 644
118 Ga0439448_0021107 3300042005 Bacteria 2019
119 Ga0451577_2003825 3300042876 Bacteria 506
120 Ga0466964_0792578 3300044706 Bacteria 535
121 Ga0466968_0532180 3300044735 Bacteria 588
122 Ga0466960_0990884 3300044901 Bacteria 516
123 Ga0495662_0269948 3300046476 Bacteria 837
124 Ga0495628_0851689 3300046516 Bacteria 635
125 Ga0495630_0943229 3300046517 Bacteria 657
126 Ga0495652_0513836 3300046529 Unclassified 829
127 Ga0495640_0006232 3300046533 Bacteria 9441
128 Ga0495674_0052327 3300047319 Bacteria 3594
129 Ga0496102_0453726 3300048905 Bacteria 1203
130 Ga0496102_0497348 3300048905 Bacteria 1141
131 Ga0496104_0800835 3300048907 Bacteria 848
132 Ga0496109_0648395 3300048912 Bacteria 993
133 Ga0496110_0765635 3300048913 Bacteria 869
134 Ga0496112_0064635 3300048915 Bacteria 3611
135 Ga0496112_0843124 3300048915 Bacteria 840
136 Ga0496115_0299516 3300048918 Bacteria 1318
137 Ga0496116_0000001 3300048919 Bacteria 1501681
138 Ga0496117_0000536 3300048920 Bacteria 62434
139 Ga0496119_0063381 3300048922 Bacteria 2199
140 Ga0496119_0115669 3300048922 Bacteria 1481
141 Ga0496120_0002492 3300048923 Bacteria 18506
142 Ga0496126_0245999 3300048929 Bacteria 1492
143 Ga0496126_0248201 3300048929 Bacteria 1484
144 Ga0501032_0829030 3300049569 Bacteria 584
145 Ga0501033_0018227 3300049570 Bacteria 5304
146 Ga0501034_0074293 3300049571 Bacteria 3408
147 Ga0501037_0115515 3300049573 Bacteria 1932
148 Ga0501043_0530859 3300049579 Bacteria 876
149 Ga0501047_0508663 3300049581 Bacteria 1031
150 Ga0501047_0654019 3300049581 Bacteria 870
151 Ga0501068_0069997 3300049584 Bacteria 2140
152 Ga0501070_0002621 3300049586 Bacteria 15711
153 Ga0501070_0009046 3300049586 Bacteria 8425
154 Ga0501070_0777688 3300049586 Bacteria 753
155 Ga0501074_0009910 3300049590 Bacteria 6923
156 Ga0501080_0000400 3300049742 Bacteria 33491
157 Ga0501080_0200183 3300049742 Bacteria 1834
158 Ga0501035_0011671 3300049822 Bacteria 8143
159 Ga0501044_0006750 3300049823 Bacteria 12652
160 nmdc:mga00v17_828822_c1 3300050491 Bacteria 588
161 nmdc:mga0yw44_1077818_c1 3300050492 Bacteria 543
162 nmdc:mga0a205_808307_c1 3300050515 Unclassified 785
163 Ga0500616_0000120 3300053153 Bacteria 142980
164 Ga0500622_0066197 3300053156 Bacteria 1835
165 Ga0500627_0062548 3300053158 Bacteria 1639
166 Ga0500627_0072940 3300053158 Bacteria 1522
167 Ga0501084_1167909 3300054114 Unclassified 646
168 Ga0501082_0975811 3300060353 Bacteria 741
169 Ga0530510_1351220 3300061734 Unclassified 547

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053156 Ga0500622_0066197 Ga0500622_0066197_243_485 79
2 iso_pu_bacteria 2513237090 2513609273 81
3 iso_pu_bacteria 2693429783 2694631486 81
4 iso_pu_bacteria 2693429784 2694640473 81
5 iso_pu_bacteria 2847670302 2847671631 81
6 iso_pu_bacteria 2856314179 2856318638 81
7 iso_pu_bacteria 2857349434 2857356073 81
8 iso_pu_bacteria 2871495908 2871500067 81
9 iso_pu_bacteria 2876369609 2876374019 81
10 iso_pu_bacteria 2876377896 2876385095 81
11 iso_pu_bacteria 2876392853 2876393481 81
12 iso_pu_bacteria 2878035449 2878037975 81
13 iso_pu_bacteria 2878760144 2878764199 81
14 iso_pu_bacteria 2878767105 2878771257 81
15 iso_pu_bacteria 2881147464 2881153415 81
16 iso_pu_bacteria 2881161766 2881162591 81
17 iso_pu_bacteria 2885305155 2885311389 81
18 iso_pu_bacteria 2885326080 2885333031 81
19 iso_pu_bacteria 2885334103 2885334479 81
20 iso_pu_bacteria 2888350351 2888350424 81
21 iso_pu_bacteria 2889010040 2889012731 81
22 iso_pu_bacteria 2889016732 2889022364 81
23 iso_pu_bacteria 2903540706 2903544882 81
24 iso_pu_bacteria 2904659560 2904659988 81
25 iso_pu_bacteria 2906354277 2906354436 81
26 iso_pu_bacteria 2906414383 2906418676 81
27 iso_pu_bacteria 2922130491 2922136957 81
28 iso_pu_bacteria 2922185730 2922191835 81
29 iso_pu_bacteria 2937994558 2937998726 81
30 iso_pu_bacteria 2938014810 2938015739 81
31 iso_pu_bacteria 2958100919 2958103342 81
32 iso_pu_bacteria 2958165035 2958169202 81
33 iso_pu_bacteria 2958172287 2958173712 81
34 iso_pu_bacteria 2961114664 2961115312 81
35 iso_pu_bacteria 2961163497 2961167663 81
36 iso_pu_bacteria 2965018300 2965022483 81
37 iso_pu_bacteria 2965119406 2965126771 81
38 iso_pu_bacteria 2968110612 2968111044 81
39 iso_pu_bacteria 2968117919 2968118070 81
40 iso_pu_bacteria 2968171901 2968176067 81
41 iso_pu_bacteria 2970554993 2970559044 81
42 iso_pu_bacteria 2977942078 2977948557 81
43 iso_pu_bacteria 2977971508 2977976274 81
44 iso_pu_bacteria 2979710463 2979713440 81
45 iso_pu_bacteria 2979742915 2979752067 81
46 iso_pu_bacteria 2987636660 2987639886 81
47 iso_pu_bacteria 2987652177 2987653177 81
48 iso_pu_bacteria 2987659509 2987663671 81
49 iso_pu_bacteria 2996348954 2996356281 81
50 iso_pu_bacteria 3004188549 3004192730 81
51 iso_pu_bacteria 3004203850 3004207459 81
52 iso_pu_bacteria 8004640170 8004642639 81
53 3300005336 Ga0070680_100009595 Ga0070680_1000095952 82
54 3300005337 Ga0070682_100004765 Ga0070682_1000047652 82
55 3300005339 Ga0070660_100479703 Ga0070660_1004797032 82
56 3300005366 Ga0070659_100089700 Ga0070659_1000897002 82
57 3300005458 Ga0070681_10246541 Ga0070681_102465412 82
58 3300005530 Ga0070679_100003717 Ga0070679_1000037173 82
59 3300005539 Ga0068853_100010013 Ga0068853_1000100132 82
60 3300005547 Ga0070693_100011942 Ga0070693_1000119424 82
61 3300005577 Ga0068857_100020193 Ga0068857_1000201933 82
62 3300005578 Ga0068854_101687719 Ga0068854_1016877192 82
63 3300009174 Ga0105241_10054292 Ga0105241_100542922 82
64 3300009545 Ga0105237_12464139 Ga0105237_124641392 82
65 3300010375 Ga0105239_10070177 Ga0105239_100701772 82
66 3300013100 Ga0157373_10008938 Ga0157373_100089388 82
67 3300013104 Ga0157370_10014696 Ga0157370_100146964 82
68 3300013307 Ga0157372_10003339 Ga0157372_1000333918 82
69 3300025911 Ga0207654_10028437 Ga0207654_100284373 82
70 3300025912 Ga0207707_10185693 Ga0207707_101856932 82
71 3300025917 Ga0207660_10672822 Ga0207660_106728222 82
72 3300025921 Ga0207652_10023401 Ga0207652_100234014 82
73 3300025932 Ga0207690_10173137 Ga0207690_101731372 82
74 3300026041 Ga0207639_10020276 Ga0207639_100202762 82
75 3300026116 Ga0207674_10026278 Ga0207674_100262783 82
76 3300042005 Ga0439448_0021107 Ga0439448_0021107_123_371 82
77 3300049571 Ga0501034_0074293 Ga0501034_0074293_999_1247 82
78 3300049581 Ga0501047_0508663 Ga0501047_0508663_22_270 82
79 3300049742 Ga0501080_0200183 Ga0501080_0200183_677_925 82
80 iso_pu_bacteria 3002141150 3002145975 82
81 iso_pu_bacteria 8054563764 8054565778 82
82 3300028800 Ga0265338_10012603 Ga0265338_100126034 84
83 3300061734 Ga0530510_1351220 Ga0530510_1351220_158_418 84
84 iso_pu_bacteria 2889306138 2889309794 84
85 iso_pu_bacteria 643348564 643599976 84
86 3300003214 JGI25165J46597_1000093 JGI25165J46597_1000093152 85
87 3300003323 rootH1_10002542 rootH1_100025422 85
88 3300005539 Ga0068853_100012142 Ga0068853_1000121423 85
89 3300005578 Ga0068854_101603612 Ga0068854_1016036122 85
90 3300009093 Ga0105240_10043557 Ga0105240_100435573 85
91 3300009174 Ga0105241_10229372 Ga0105241_102293722 85
92 3300009545 Ga0105237_10044367 Ga0105237_100443672 85
93 3300009545 Ga0105237_10635448 Ga0105237_106354482 85
94 3300009551 Ga0105238_10009507 Ga0105238_100095074 85
95 3300010375 Ga0105239_10031239 Ga0105239_100312392 85
96 3300010375 Ga0105239_10365426 Ga0105239_103654262 85
97 3300013104 Ga0157370_11005191 Ga0157370_110051911 85
98 3300013105 Ga0157369_10095638 Ga0157369_100956382 85
99 3300025261 Ga0209233_1000053 Ga0209233_100005334 85
100 3300025911 Ga0207654_10183873 Ga0207654_101838732 85
101 3300025914 Ga0207671_10023099 Ga0207671_100230994 85
102 3300025924 Ga0207694_10062210 Ga0207694_100622102 85
103 3300025981 Ga0207640_11741505 Ga0207640_117415051 85
104 3300026078 Ga0207702_10895280 Ga0207702_108952802 85
105 3300037418 Ga0395900_0071963 Ga0395900_0071963_394_651 85
106 3300037418 Ga0395900_0241225 Ga0395900_0241225_570_827 85
107 3300037418 Ga0395900_0750367 Ga0395900_0750367_19_276 85
108 3300037466 Ga0395898_1241340 Ga0395898_1241340_299_556 85
109 3300037471 Ga0395905_0027683 Ga0395905_0027683_919_1176 85
110 3300037471 Ga0395905_0046942 Ga0395905_0046942_681_938 85
111 3300037471 Ga0395905_0619348 Ga0395905_0619348_10_267 85
112 3300037471 Ga0395905_0991836 Ga0395905_0991836_456_713 85
113 3300038443 Ga0395901_0035780 Ga0395901_0035780_2919_3176 85
114 3300038443 Ga0395901_0112227 Ga0395901_0112227_1687_1944 85
115 3300038443 Ga0395901_1447109 Ga0395901_1447109_366_623 85
116 3300044706 Ga0466964_0792578 Ga0466964_0792578_187_444 85
117 3300044735 Ga0466968_0532180 Ga0466968_0532180_145_402 85
118 3300044901 Ga0466960_0990884 Ga0466960_0990884_191_448 85
119 3300048905 Ga0496102_0497348 Ga0496102_0497348_208_465 85
120 3300048915 Ga0496112_0064635 Ga0496112_0064635_696_953 85
121 3300048918 Ga0496115_0299516 Ga0496115_0299516_787_1044 85
122 3300048922 Ga0496119_0115669 Ga0496119_0115669_1118_1375 85
123 3300048923 Ga0496120_0002492 Ga0496120_0002492_6666_6923 85
124 3300048929 Ga0496126_0245999 Ga0496126_0245999_1128_1385 85
125 3300049569 Ga0501032_0829030 Ga0501032_0829030_30_287 85
126 3300049570 Ga0501033_0018227 Ga0501033_0018227_4709_4966 85
127 3300049573 Ga0501037_0115515 Ga0501037_0115515_1217_1474 85
128 3300049579 Ga0501043_0530859 Ga0501043_0530859_116_373 85
129 3300049581 Ga0501047_0654019 Ga0501047_0654019_366_623 85
130 3300049584 Ga0501068_0069997 Ga0501068_0069997_1538_1795 85
131 3300049586 Ga0501070_0002621 Ga0501070_0002621_7494_7751 85
132 3300049590 Ga0501074_0009910 Ga0501074_0009910_430_687 85
133 3300049742 Ga0501080_0000400 Ga0501080_0000400_25762_26019 85
134 3300049822 Ga0501035_0011671 Ga0501035_0011671_7463_7720 85
135 3300049823 Ga0501044_0006750 Ga0501044_0006750_8491_8748 85
136 iso_pu_bacteria 2506520007 2506578428 85
137 iso_pu_bacteria 2506520008 2506583566 85
138 iso_pu_bacteria 2585427591 2585828597 85
139 3300003203 JGI25406J46586_10014294 JGI25406J46586_100142943 86
140 3300005467 Ga0070706_101917862 Ga0070706_1019178622 86
141 3300005548 Ga0070665_100788325 Ga0070665_1007883252 86
142 3300005719 Ga0068861_100553151 Ga0068861_1005531512 86
143 3300005937 Ga0081455_11008873 Ga0081455_110088731 86
144 3300005983 Ga0081540_1008587 Ga0081540_10085877 86
145 3300005985 Ga0081539_10005447 Ga0081539_1000544710 86
146 3300006038 Ga0075365_10046605 Ga0075365_100466052 86
147 3300006051 Ga0075364_11089453 Ga0075364_110894531 86
148 3300013306 Ga0163162_11509806 Ga0163162_115098061 86
149 3300026118 Ga0207675_102444407 Ga0207675_1024444072 86
150 3300049586 Ga0501070_0009046 Ga0501070_0009046_1550_1810 86
151 3300050491 nmdc:mga00v17_828822_c1 nmdc:mga00v17_828822_c1_33_293 86
152 3300050492 nmdc:mga0yw44_1077818_c1 nmdc:mga0yw44_1077818_c1_176_436 86
153 3300053158 Ga0500627_0062548 Ga0500627_0062548_916_1176 86
154 3300053158 Ga0500627_0072940 Ga0500627_0072940_797_1057 86
155 iso_pu_bacteria 2861691609 2861695322 86
156 iso_pu_bacteria 2902330777 2902331058 86
157 3300003659 JGI25404J52841_10072557 JGI25404J52841_100725572 87
158 3300005937 Ga0081455_10669061 Ga0081455_106690611 87
159 3300005983 Ga0081540_1001948 Ga0081540_10019482 87
160 3300013296 Ga0157374_10032560 Ga0157374_100325602 87
161 3300048913 Ga0496110_0765635 Ga0496110_0765635_189_455 87
162 3300054114 Ga0501084_1167909 Ga0501084_1167909_280_546 87
163 3300060353 Ga0501082_0975811 Ga0501082_0975811_387_653 87
164 iso_pu_bacteria 2508501122 2509110620 87
165 iso_pu_bacteria 2509276019 2509377439 87
166 iso_pu_bacteria 2513237089 2513606778 87
167 iso_pu_bacteria 2513237160 2514007012 87
168 iso_pu_bacteria 2516143018 2516206445 87
169 iso_pu_bacteria 2517487022 2517566679 87
170 iso_pu_bacteria 2558860100 2558864972 87
171 iso_pu_bacteria 2585427528 2585540093 87
172 iso_pu_bacteria 2585427593 2585838291 87
173 iso_pu_bacteria 2751185821 2753461221 87
174 iso_pu_bacteria 2802428858 2802720121 87
175 iso_pu_bacteria 2802428859 2802723807 87
176 iso_pu_bacteria 2802428861 2802739595 87
177 iso_pu_bacteria 2802428862 2802746019 87
178 iso_pu_bacteria 2802428863 2802753419 87
179 iso_pu_bacteria 2850079185 2850084691 87
180 iso_pu_bacteria 2915980308 2915984336 87
181 iso_pu_bacteria 2916061851 2916066655 87
182 iso_pu_bacteria 2921250672 2921254292 87
183 iso_pu_bacteria 2937029754 2937033970 87
184 iso_pu_bacteria 2937036028 2937037235 87
185 iso_pu_bacteria 2937078374 2937080505 87
186 iso_pu_bacteria 2957437181 2957442746 87
187 iso_pu_bacteria 2960591022 2960591721 87
188 iso_pu_bacteria 2960631154 2960637776 87
189 iso_pu_bacteria 2967728569 2967728652 87
190 iso_pu_bacteria 2970026789 2970033084 87
191 iso_pu_bacteria 2970122695 2970129064 87
192 iso_pu_bacteria 2977530762 2977536939 87
193 iso_pu_bacteria 2977544691 2977546592 87
194 3300005293 Ga0065715_10177548 Ga0065715_101775482 88
195 3300005295 Ga0065707_10749256 Ga0065707_107492562 88
196 3300005327 Ga0070658_10262595 Ga0070658_102625953 88
197 3300005548 Ga0070665_100004128 Ga0070665_10000412814 88
198 3300005985 Ga0081539_10199523 Ga0081539_101995233 88
199 3300006852 Ga0075433_10853389 Ga0075433_108533892 88
200 3300009545 Ga0105237_10015978 Ga0105237_100159788 88
201 3300009545 Ga0105237_11832359 Ga0105237_118323592 88
202 3300009551 Ga0105238_11001832 Ga0105238_110018322 88
203 3300010375 Ga0105239_10010956 Ga0105239_100109566 88
204 3300014969 Ga0157376_10494745 Ga0157376_104947451 88
205 3300025909 Ga0207705_10126917 Ga0207705_101269172 88
206 3300025914 Ga0207671_10000464 Ga0207671_1000046446 88
207 3300025924 Ga0207694_10981604 Ga0207694_109816042 88
208 3300028379 Ga0268266_10000743 Ga0268266_1000074340 88
209 3300031824 Ga0307413_10720226 Ga0307413_107202262 88
210 3300033180 Ga0307510_10054268 Ga0307510_100542683 88
211 3300035695 Ga0373927_0537336 Ga0373927_0537336_405_671 88
212 3300036401 Ga0373937_0578296 Ga0373937_0578296_10_276 88
213 3300036401 Ga0373937_1362045 Ga0373937_1362045_254_520 88
214 3300037068 Ga0373925_0371408 Ga0373925_0371408_136_402 88
215 3300046529 Ga0495652_0513836 Ga0495652_0513836_469_735 88
216 3300048905 Ga0496102_0453726 Ga0496102_0453726_88_354 88
217 3300048907 Ga0496104_0800835 Ga0496104_0800835_200_466 88
218 3300048912 Ga0496109_0648395 Ga0496109_0648395_216_482 88
219 3300048915 Ga0496112_0843124 Ga0496112_0843124_367_633 88
220 3300049586 Ga0501070_0777688 Ga0501070_0777688_117_383 88
221 3300050515 nmdc:mga0a205_808307_c1 nmdc:mga0a205_808307_c1_273_539 88
222 iso_pu_bacteria 2929199973 2929201801 88
223 3300009036 Ga0105244_10000008 Ga0105244_10000008255 89
224 3300009092 Ga0105250_10003351 Ga0105250_100033514 89
225 3300009101 Ga0105247_10000045 Ga0105247_1000004541 89
226 3300025711 Ga0207696_1000001 Ga0207696_10000011263 89
227 3300025728 Ga0207655_1000083 Ga0207655_100008334 89
228 3300025735 Ga0207713_1000016 Ga0207713_1000016227 89
229 3300025900 Ga0207710_10000070 Ga0207710_1000007041 89
230 3300048919 Ga0496116_0000001 Ga0496116_0000001_682649_682918 89
231 3300048920 Ga0496117_0000536 Ga0496117_0000536_8962_9231 89
232 3300048922 Ga0496119_0063381 Ga0496119_0063381_1254_1523 89
233 iso_pu_bacteria 2643221637 2644208212 89
234 iso_pu_bacteria 2643221718 2644651970 89
235 3300048929 Ga0496126_0248201 Ga0496126_0248201_783_1067 90
236 3300006946 Ga0079104_1040766 Ga0079104_10407662 91
237 3300021321 Ga0214542_1014550 Ga0214542_10145507 91
238 3300021327 Ga0214543_1000012 Ga0214543_100001220 91
239 3300022740 Ga0228710_1022166 Ga0228710_10221662 91
240 3300031456 Ga0307513_10234000 Ga0307513_102340002 91
241 3300033430 Ga0315913_1006111 Ga0315913_100611111 91
242 iso_pu_bacteria 2643221607 2644050386 91
243 iso_pu_bacteria 2643221636 2644205614 91
244 iso_pu_bacteria 2643221686 2644483304 91
245 3300003203 JGI25406J46586_10000109 JGI25406J46586_100001099 92
246 3300003203 JGI25406J46586_10043172 JGI25406J46586_100431723 92
247 3300005439 Ga0070711_100450705 Ga0070711_1004507051 92
248 3300005441 Ga0070700_100829816 Ga0070700_1008298162 92
249 3300005937 Ga0081455_10020560 Ga0081455_100205603 92
250 3300005985 Ga0081539_10000954 Ga0081539_1000095452 92
251 3300005985 Ga0081539_10001010 Ga0081539_1000101028 92
252 3300006175 Ga0070712_100073555 Ga0070712_1000735551 92
253 3300025915 Ga0207693_10896141 Ga0207693_108961412 92
254 3300025916 Ga0207663_10689980 Ga0207663_106899802 92
255 3300031548 Ga0307408_100395907 Ga0307408_1003959071 92
256 3300035111 Ga0373923_0115188 Ga0373923_0115188_208_486 92
257 3300035692 Ga0373935_0070229 Ga0373935_0070229_1320_1598 92
258 3300037068 Ga0373925_0177407 Ga0373925_0177407_1179_1457 92
259 3300042876 Ga0451577_2003825 Ga0451577_2003825_60_338 92
260 3300046476 Ga0495662_0269948 Ga0495662_0269948_437_715 92
261 3300046516 Ga0495628_0851689 Ga0495628_0851689_344_622 92
262 3300046517 Ga0495630_0943229 Ga0495630_0943229_204_482 92
263 3300046533 Ga0495640_0006232 Ga0495640_0006232_7919_8197 92
264 3300047319 Ga0495674_0052327 Ga0495674_0052327_2711_2989 92
265 3300053153 Ga0500616_0000120 Ga0500616_0000120_116986_117267 92

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02583

Trns_repr_metal

Metal-sensitive transcriptional repressor

10

91

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
7mq2-assembly1.cif.gz_C c9a streptococcus pneumoniae cstr in the reduced state, space group p21 0.9542 9 65
7oq4-assembly1.cif.gz_A cryo-em structure of the atv rnap inhibitory protein (rip) bound to the dna-binding channel of the host's rna polymerase 0.9526 13 52
6ahx-assembly1.cif.gz_A-2 copper-sensing operon regulator protein (csorgz) 0.9346 11 66
6ahx-assembly1.cif.gz_A-2 copper-sensing operon regulator protein (csorgz) 0.8624 11 66
7mq2-assembly1.cif.gz_C c9a streptococcus pneumoniae cstr in the reduced state, space group p21 0.8408 9 65
ID Description Score Start End Superfamily
af_P07814_749_805_1.10.287.10 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding 0.9295 13 58 1.10.287.10
5ujjA01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding 0.9212 13 58 1.10.287.10
3aaiC00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Metal-sensitive repressor, helix protomer 0.8984 12 58 1.20.58.1000
1twgA01 Few Secondary Structures;Irregular;DNA Excision Repair, Uvrb; Chain A;RNA polymerase II, clamp domain 0.8732 9 55 4.10.860.120
3aaiB00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Metal-sensitive repressor, helix protomer 0.8662 12 70 1.20.58.1000
ID Description Score Start End GO Terms
AF-A0A172YKQ6-F1-model_v4 Metal resistance protein 0.9733 1 92 GO:0003677
GO:0005737
GO:0045892
GO:0046872
AF-A0A172YKQ6-F1-model_v4 Metal resistance protein 0.963 1 92 GO:0003677
GO:0005737
GO:0045892
GO:0046872
AF-A0A2N9W352-F1-model_v4 Metal resistance protein 0.9474 1 92 GO:0003677
GO:0005737
GO:0045892
GO:0046872
AF-A0A1W6Z991-F1-model_v4 Metal resistance protein 0.9323 1 92 GO:0003677
GO:0045892
GO:0046872
AF-A0A2I8SVG5-F1-model_v4 Metal resistance protein 0.9313 2 92 GO:0003677
GO:0005737
GO:0045892
GO:0046872

Feature Viewer

pLDDT pTM Quality
80.07 0.6 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map