F373531
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 265 | 188 | 223 | 398 |
Family's Representative Sequence
| Representative Sequence | 3300046463|Ga0495653_0077519|Ga0495653_0077519_445_1779 |
| Length | 437 |
| Sequence | VLKIGLTGGIASGKSLAAARLRELGAVLVDADALAREVVEPGTPGLAKVVEAFSAAILTSDGRLDRPRLGALVFGNPERLGVLNGIIHPLVRERAAAMVASAPAGAVVVQDIPLLVETGQGQNFHLVVVVDAADDVRVRRMAEHRHMSADEAHARMAAQASRADRLAAADVVLDNSGTPQALQDAVDALWDRRLAPFALNLQERRIAPRTGGPVLAPADPSWPAQAGRLIARLRAAVAQDVLAVDHIGSTAVPGLDAKDVIDLQLSVRDLDAADRIAPLLAAAGFPRWPGIIADNPKPSHPDPADWGKRLHANADPGRPVNVHIRAAGSPGWRYALCFRDWLRADAGARADYVAEKRRVAGLHDVDKSTAGYAADKEGWFTDYAWPRMEAWVQRTGWQPPSNGADDDAGGATRPDAGTVTGAIPPEGVGIGPGTAQS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2537561592 | Arthrobacter crystallopoietes BAB-32 | Isolate | Rhizosphere |
| 2 | 2643221692 | Nocardia sp. Root136 | Isolate | Unclassified |
| 3 | 2690315906 | Arthrobacter sp. OY3WO11 | Isolate | Unclassified |
| 4 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 5 | 2775506735 | Arthrobacter sp. S95 1704 | Isolate | Unclassified |
| 6 | 2808606357 | Arthrobacter sp. SLBN-122 | Isolate | Unclassified |
| 7 | 2808606360 | Arthrobacter sp. SLBN-112 | Isolate | Unclassified |
| 8 | 2808606366 | Arthrobacter sp. SLBN-83 | Isolate | Unclassified |
| 9 | 2808606370 | Arthrobacter sp. SLBN-100 | Isolate | Unclassified |
| 10 | 2808606371 | Arthrobacter sp. SLBN-53 | Isolate | Unclassified |
| 11 | 2811994871 | Arthrobacter sp. SLBN-179 | Isolate | Unclassified |
| 12 | 2844849076 | Arthrobacter cupressi DSM 24664 | Isolate | Rhizosphere |
| 13 | 2857740372 | Paenarthrobacter sp. R-74611 | Isolate | Unclassified |
| 14 | 2904765812 | Rhodococcus fascians 1590 | Isolate | Rhizosphere |
| 15 | 2904770941 | Rhodococcus fascians 1339 | Isolate | Rhizosphere |
| 16 | 2904776348 | Paenarthrobacter sp. 1092 | Isolate | Rhizosphere |
| 17 | 2908811453 | Rhodococcus sp. 1R11 | Isolate | Unclassified |
| 18 | 2910809715 | Paenarthrobacter sp. CM16 | Isolate | Unclassified |
| 19 | 2919034639 | Paenarthrobacter nitroguajacolicus 247 | Isolate | Rhizosphere |
| 20 | 2919059106 | Arthrobacter sp. 1088 | Isolate | Rhizosphere |
| 21 | 2919391150 | Arthrobacter ipis 2973 | Isolate | Unclassified |
| 22 | 2919420072 | Rhodococcus fascians 3241 | Isolate | Rhizosphere |
| 23 | 2919432681 | Rhodococcus sp. 3258 | Isolate | Rhizosphere |
| 24 | 2919538618 | Paenarthrobacter nitroguajacolicus 3945 | Isolate | Unclassified |
| 25 | 2919713450 | Nocardia kruczakiae 4272 | Isolate | Rhizosphere |
| 26 | 2932426870 | Paenarthrobacter sp. 4246 | Isolate | Rhizosphere |
| 27 | 2933418574 | Jeotgalibacillus campisalis 4120 | Isolate | Rhizosphere |
| 28 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 29 | 2939598168 | Arthrobacter sp. 754 | Isolate | Rhizosphere |
| 30 | 2939647034 | Arthrobacter sp. 2762 | Isolate | Rhizosphere |
| 31 | 2939674588 | Arthrobacter bambusae 3552 | Isolate | Rhizosphere |
| 32 | 2945916053 | Arthrobacter ulcerisalmonis W1I2 | Isolate | Rhizosphere |
| 33 | 2945920336 | Pseudarthrobacter siccitolerans W1I3 | Isolate | Rhizosphere |
| 34 | 2945941187 | Arthrobacter pascens W1I14 | Isolate | Rhizosphere |
| 35 | 2945956166 | Arthrobacter globiformus W2I3 | Isolate | Rhizosphere |
| 36 | 2946037020 | Arthrobacter sp. W4I7 | Isolate | Rhizosphere |
| 37 | 2946059875 | Arthrobacter sp. SLBN-112 | Isolate | Rhizosphere |
| 38 | 2953998280 | Pseudarthrobacter sp. W1I19 | Isolate | Rhizosphere |
| 39 | 2974302888 | Pseudarthrobacter sp. SORGH_AS 212 | Isolate | Unclassified |
| 40 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 41 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 42 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 45 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 56 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 57 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 58 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 67 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 68 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 70 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 89 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 90 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 91 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 92 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 93 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 94 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 95 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 96 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 97 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 98 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 99 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 100 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 101 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 102 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 103 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 104 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 105 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 106 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 107 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 108 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 109 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 110 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 111 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 112 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 113 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 114 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 115 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 116 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 117 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 118 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 119 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 120 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 121 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 122 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 123 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 124 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 125 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 126 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 127 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 128 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 129 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 130 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 131 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 132 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 155 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 156 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 157 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 158 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 159 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 160 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 161 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 162 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 163 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 164 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 165 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 166 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 167 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 168 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 169 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 170 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 171 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 172 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 173 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 174 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 175 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 176 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 177 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 178 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 179 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 181 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 182 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 183 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 184 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 185 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 186 | 8004021418 | Arthrobacter sp. SDTb3-6 | Isolate | Rhizosphere |
| 187 | 8004025490 | Arthrobacter wenxiniae AETb3-4 | Isolate | Rhizosphere |
| 188 | 8054107350 | Arthrobacter rhizosphaerae CCNWLXL 1-35 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 84.15 |
| Metatranscriptomes | 0 |
| Isolates | 15.85 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.28 |
| Nodule | 0 |
| Rhizoplane | 8.68 |
| Rhizosphere | 78.11 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.92 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25152J39213_1000124 | 3300002773 | Bacteria | 52334 |
| 2 | Ga0065714_10108910 | 3300005288 | Bacteria | 1481 |
| 3 | Ga0070677_10013904 | 3300005333 | Bacteria | 2825 |
| 4 | Ga0070682_100020648 | 3300005337 | Bacteria | 3879 |
| 5 | Ga0068868_100131593 | 3300005338 | Bacteria | 2047 |
| 6 | Ga0068868_100176108 | 3300005338 | Bacteria | 1773 |
| 7 | Ga0070668_100116087 | 3300005347 | Bacteria | 2134 |
| 8 | Ga0070669_100047426 | 3300005353 | Bacteria | 3134 |
| 9 | Ga0070673_100169326 | 3300005364 | Bacteria | 1863 |
| 10 | Ga0070659_100273449 | 3300005366 | Bacteria | 1404 |
| 11 | Ga0070678_100003890 | 3300005456 | Bacteria | 8390 |
| 12 | Ga0070678_100349419 | 3300005456 | Bacteria | 1271 |
| 13 | Ga0070685_10091171 | 3300005466 | Bacteria | 1844 |
| 14 | Ga0070672_100099748 | 3300005543 | Bacteria | 2354 |
| 15 | Ga0070665_100092793 | 3300005548 | Bacteria | 3024 |
| 16 | Ga0070665_100223140 | 3300005548 | Bacteria | 1885 |
| 17 | Ga0068857_100183737 | 3300005577 | Bacteria | 1903 |
| 18 | Ga0068854_100065484 | 3300005578 | Bacteria | 2642 |
| 19 | Ga0068854_100100577 | 3300005578 | Bacteria | 2167 |
| 20 | Ga0075365_10096223 | 3300006038 | Bacteria | 2023 |
| 21 | Ga0075363_100023603 | 3300006048 | Bacteria | 3120 |
| 22 | Ga0075369_10094611 | 3300006186 | Bacteria | 1336 |
| 23 | Ga0105244_10016573 | 3300009036 | Bacteria | 4194 |
| 24 | Ga0105244_10029689 | 3300009036 | Bacteria | 2918 |
| 25 | Ga0105245_10134061 | 3300009098 | Bacteria | 2326 |
| 26 | Ga0105243_10026508 | 3300009148 | Bacteria | 4436 |
| 27 | Ga0105239_10319078 | 3300010375 | Bacteria | 1752 |
| 28 | Ga0105246_10027609 | 3300011119 | Bacteria | 3722 |
| 29 | Ga0105246_10035070 | 3300011119 | Bacteria | 3350 |
| 30 | Ga0105246_10038010 | 3300011119 | Bacteria | 3233 |
| 31 | Ga0105246_10040091 | 3300011119 | Bacteria | 3159 |
| 32 | Ga0163162_10050972 | 3300013306 | Bacteria | 4152 |
| 33 | Ga0157375_10256363 | 3300013308 | Bacteria | 1910 |
| 34 | Ga0157377_10169277 | 3300014745 | Bacteria | 1365 |
| 35 | Ga0213873_10000058 | 3300021358 | Bacteria | 24370 |
| 36 | Ga0213875_10005805 | 3300021388 | Bacteria | 6568 |
| 37 | Ga0209148_1001288 | 3300025254 | Bacteria | 13617 |
| 38 | Ga0209129_1000067 | 3300025258 | Bacteria | 219974 |
| 39 | Ga0209025_1000971 | 3300025294 | Bacteria | 42988 |
| 40 | Ga0207697_10020090 | 3300025315 | Bacteria | 2736 |
| 41 | Ga0207697_10035796 | 3300025315 | Bacteria | 2033 |
| 42 | Ga0207655_1005022 | 3300025728 | Bacteria | 9155 |
| 43 | Ga0207655_1023262 | 3300025728 | Bacteria | 3079 |
| 44 | Ga0207655_1047111 | 3300025728 | Bacteria | 1782 |
| 45 | Ga0207705_10092607 | 3300025909 | Bacteria | 2215 |
| 46 | Ga0207681_10051375 | 3300025923 | Bacteria | 2793 |
| 47 | Ga0207664_10052555 | 3300025929 | Bacteria | 3223 |
| 48 | Ga0207691_10000138 | 3300025940 | Bacteria | 66608 |
| 49 | Ga0207689_10059387 | 3300025942 | Bacteria | 3145 |
| 50 | Ga0207667_10322469 | 3300025949 | Bacteria | 1578 |
| 51 | Ga0207668_10013500 | 3300025972 | Bacteria | 5032 |
| 52 | Ga0207640_10123169 | 3300025981 | Bacteria | 1862 |
| 53 | Ga0207677_10086081 | 3300026023 | Bacteria | 2270 |
| 54 | Ga0207677_10089776 | 3300026023 | Bacteria | 2231 |
| 55 | Ga0207678_10120499 | 3300026067 | Bacteria | 2239 |
| 56 | Ga0207676_10076887 | 3300026095 | Bacteria | 2699 |
| 57 | Ga0207674_10328864 | 3300026116 | Bacteria | 1478 |
| 58 | Ga0207683_10012765 | 3300026121 | Bacteria | 7170 |
| 59 | Ga0207683_10377217 | 3300026121 | Bacteria | 1303 |
| 60 | Ga0207698_10143372 | 3300026142 | Bacteria | 2062 |
| 61 | Ga0268266_10056651 | 3300028379 | Bacteria | 3372 |
| 62 | Ga0307513_10238452 | 3300031456 | Bacteria | 1626 |
| 63 | Ga0307408_100026408 | 3300031548 | Bacteria | 3989 |
| 64 | Ga0307408_100027617 | 3300031548 | Bacteria | 3913 |
| 65 | Ga0307408_100107753 | 3300031548 | Bacteria | 2134 |
| 66 | Ga0307405_10002265 | 3300031731 | Bacteria | 8418 |
| 67 | Ga0307405_10015791 | 3300031731 | Bacteria | 4099 |
| 68 | Ga0307405_10031555 | 3300031731 | Bacteria | 3121 |
| 69 | Ga0307405_10128367 | 3300031731 | Bacteria | 1747 |
| 70 | Ga0307405_10132513 | 3300031731 | Bacteria | 1724 |
| 71 | Ga0307413_10054741 | 3300031824 | Bacteria | 2423 |
| 72 | Ga0307413_10075455 | 3300031824 | Bacteria | 2140 |
| 73 | Ga0307413_10190051 | 3300031824 | Bacteria | 1473 |
| 74 | Ga0307410_10003297 | 3300031852 | Bacteria | 8065 |
| 75 | Ga0307410_10063220 | 3300031852 | Bacteria | 2538 |
| 76 | Ga0307410_10159261 | 3300031852 | Bacteria | 1689 |
| 77 | Ga0307406_10011160 | 3300031901 | Bacteria | 5091 |
| 78 | Ga0307407_10092619 | 3300031903 | Bacteria | 1856 |
| 79 | Ga0307407_10099337 | 3300031903 | Bacteria | 1803 |
| 80 | Ga0307407_10118116 | 3300031903 | Bacteria | 1676 |
| 81 | Ga0307412_10015778 | 3300031911 | Bacteria | 4484 |
| 82 | Ga0307412_10020990 | 3300031911 | Bacteria | 3983 |
| 83 | Ga0307412_10057369 | 3300031911 | Bacteria | 2599 |
| 84 | Ga0307412_10115444 | 3300031911 | Bacteria | 1924 |
| 85 | Ga0307409_100078490 | 3300031995 | Bacteria | 2656 |
| 86 | Ga0307409_100300286 | 3300031995 | Bacteria | 1493 |
| 87 | Ga0307416_100014337 | 3300032002 | Bacteria | 5427 |
| 88 | Ga0307416_100032310 | 3300032002 | Bacteria | 3952 |
| 89 | Ga0307416_100048957 | 3300032002 | Bacteria | 3357 |
| 90 | Ga0307416_100052533 | 3300032002 | Bacteria | 3263 |
| 91 | Ga0307416_100056291 | 3300032002 | Bacteria | 3173 |
| 92 | Ga0307416_100085081 | 3300032002 | Bacteria | 2690 |
| 93 | Ga0307416_100217252 | 3300032002 | Bacteria | 1830 |
| 94 | Ga0307414_10042419 | 3300032004 | Bacteria | 3091 |
| 95 | Ga0307414_10158165 | 3300032004 | Bacteria | 1796 |
| 96 | Ga0307415_100022788 | 3300032126 | Bacteria | 3873 |
| 97 | Ga0395899_0051616 | 3300037312 | Bacteria | 3051 |
| 98 | Ga0395900_0008951 | 3300037418 | Bacteria | 10266 |
| 99 | Ga0395900_0030495 | 3300037418 | Bacteria | 5537 |
| 100 | Ga0395900_0362707 | 3300037418 | Bacteria | 1420 |
| 101 | Ga0395898_0030878 | 3300037466 | Bacteria | 5359 |
| 102 | Ga0395898_0100931 | 3300037466 | Bacteria | 2771 |
| 103 | Ga0436364_1406928 | 3300037853 | Bacteria | 16191 |
| 104 | Ga0436362_0111996 | 3300039453 | Bacteria | 17950 |
| 105 | Ga0439436_0022389 | 3300041404 | Bacteria | 1872 |
| 106 | Ga0439436_0025504 | 3300041404 | Bacteria | 1736 |
| 107 | Ga0439438_001589 | 3300041405 | Bacteria | 9978 |
| 108 | Ga0439466_0035023 | 3300041411 | Bacteria | 1699 |
| 109 | Ga0439433_0000591 | 3300041999 | Bacteria | 6897 |
| 110 | Ga0439442_000024 | 3300042002 | Bacteria | 40056 |
| 111 | Ga0439442_000939 | 3300042002 | Bacteria | 5916 |
| 112 | Ga0439442_001575 | 3300042002 | Bacteria | 4477 |
| 113 | Ga0439442_014479 | 3300042002 | Bacteria | 1623 |
| 114 | Ga0439442_016171 | 3300042002 | Bacteria | 1538 |
| 115 | Ga0439432_000885 | 3300042006 | Bacteria | 11237 |
| 116 | Ga0439432_019582 | 3300042006 | Bacteria | 2254 |
| 117 | Ga0439449_0004598 | 3300042007 | Bacteria | 5333 |
| 118 | Ga0439449_0005221 | 3300042007 | Bacteria | 4982 |
| 119 | Ga0439449_0060009 | 3300042007 | Bacteria | 1403 |
| 120 | Ga0439452_003080 | 3300042010 | Bacteria | 5915 |
| 121 | Ga0439457_008439 | 3300042014 | Bacteria | 2430 |
| 122 | Ga0439462_0000270 | 3300042015 | Bacteria | 9462 |
| 123 | Ga0450920_002017 | 3300042122 | Bacteria | 3430 |
| 124 | Ga0450920_002244 | 3300042122 | Bacteria | 3273 |
| 125 | Ga0450920_009617 | 3300042122 | Bacteria | 1781 |
| 126 | Ga0439446_0003097 | 3300042156 | Bacteria | 4085 |
| 127 | Ga0450908_001486 | 3300042184 | Bacteria | 4549 |
| 128 | Ga0439434_0002026 | 3300042435 | Bacteria | 5854 |
| 129 | Ga0450918_004225 | 3300042531 | Bacteria | 2630 |
| 130 | Ga0466969_0077046 | 3300044656 | Bacteria | 1596 |
| 131 | Ga0466972_0046552 | 3300044658 | Bacteria | 2099 |
| 132 | Ga0466972_0059064 | 3300044658 | Bacteria | 1841 |
| 133 | Ga0466965_0030923 | 3300044683 | Bacteria | 2609 |
| 134 | Ga0466965_0040312 | 3300044683 | Bacteria | 2299 |
| 135 | Ga0466966_0023298 | 3300044684 | Bacteria | 4055 |
| 136 | Ga0466966_0054127 | 3300044684 | Bacteria | 2544 |
| 137 | Ga0466961_0006757 | 3300044693 | Bacteria | 7300 |
| 138 | Ga0466963_0006631 | 3300044694 | Bacteria | 6870 |
| 139 | Ga0466970_0003187 | 3300044765 | Bacteria | 7975 |
| 140 | Ga0466970_0010987 | 3300044765 | Bacteria | 4606 |
| 141 | Ga0466957_0002538 | 3300044842 | Bacteria | 9824 |
| 142 | Ga0466957_0035004 | 3300044842 | Bacteria | 3013 |
| 143 | Ga0466960_0000123 | 3300044901 | Bacteria | 25757 |
| 144 | Ga0466959_0002920 | 3300045049 | Bacteria | 11025 |
| 145 | Ga0466959_0010735 | 3300045049 | Bacteria | 6561 |
| 146 | Ga0466958_0000011 | 3300045836 | Bacteria | 57675 |
| 147 | Ga0466967_0000825 | 3300045976 | Bacteria | 16309 |
| 148 | Ga0466967_0147117 | 3300045976 | Bacteria | 2198 |
| 149 | Ga0495629_0114121 | 3300046459 | Bacteria | 1883 |
| 150 | Ga0495653_0077519 | 3300046463 | Bacteria | 2467 |
| 151 | Ga0495580_0001442 | 3300046472 | Bacteria | 20833 |
| 152 | Ga0495639_0069278 | 3300046475 | Bacteria | 1627 |
| 153 | Ga0495662_0028632 | 3300046476 | Bacteria | 2689 |
| 154 | Ga0495643_0074513 | 3300046522 | Bacteria | 1777 |
| 155 | Ga0495642_0051371 | 3300046528 | Bacteria | 1696 |
| 156 | Ga0495665_0001329 | 3300046531 | Bacteria | 13191 |
| 157 | Ga0495586_0003057 | 3300046535 | Bacteria | 9021 |
| 158 | Ga0495586_0004092 | 3300046535 | Bacteria | 7814 |
| 159 | Ga0495586_0060466 | 3300046535 | Bacteria | 2060 |
| 160 | Ga0495587_0000295 | 3300046536 | Bacteria | 35493 |
| 161 | Ga0495645_0004137 | 3300046543 | Bacteria | 9910 |
| 162 | Ga0495622_0017955 | 3300046557 | Bacteria | 3295 |
| 163 | Ga0495667_0004212 | 3300046559 | Bacteria | 9693 |
| 164 | Ga0495656_0021444 | 3300046615 | Bacteria | 2515 |
| 165 | Ga0495588_0003405 | 3300046674 | Bacteria | 6910 |
| 166 | Ga0495588_0005125 | 3300046674 | Bacteria | 5819 |
| 167 | Ga0495588_0009309 | 3300046674 | Bacteria | 4536 |
| 168 | Ga0495657_0042411 | 3300046675 | Bacteria | 3107 |
| 169 | Ga0495670_0016447 | 3300046691 | Bacteria | 3635 |
| 170 | Ga0495581_0004383 | 3300047315 | Bacteria | 8155 |
| 171 | Ga0495581_0009593 | 3300047315 | Bacteria | 5598 |
| 172 | Ga0495636_0006018 | 3300047318 | Bacteria | 4760 |
| 173 | Ga0495675_0003818 | 3300047444 | Bacteria | 9125 |
| 174 | Ga0495686_0012887 | 3300047472 | Bacteria | 5829 |
| 175 | Ga0495593_0054875 | 3300047673 | Bacteria | 2099 |
| 176 | Ga0496101_0035796 | 3300048904 | Bacteria | 3512 |
| 177 | Ga0496101_0138784 | 3300048904 | Bacteria | 1851 |
| 178 | Ga0496102_0085127 | 3300048905 | Bacteria | 2918 |
| 179 | Ga0496102_0099067 | 3300048905 | Bacteria | 2705 |
| 180 | Ga0496102_0207070 | 3300048905 | Bacteria | 1849 |
| 181 | Ga0496103_0049616 | 3300048906 | Bacteria | 2595 |
| 182 | Ga0496103_0152018 | 3300048906 | Bacteria | 1483 |
| 183 | Ga0496104_0178855 | 3300048907 | Bacteria | 2031 |
| 184 | Ga0496106_0073295 | 3300048909 | Bacteria | 2619 |
| 185 | Ga0496106_0141266 | 3300048909 | Bacteria | 1894 |
| 186 | Ga0496107_0131253 | 3300048910 | Bacteria | 1849 |
| 187 | Ga0496108_0095187 | 3300048911 | Bacteria | 2535 |
| 188 | Ga0496109_0092574 | 3300048912 | Bacteria | 2796 |
| 189 | Ga0496109_0112016 | 3300048912 | Bacteria | 2537 |
| 190 | Ga0496110_0036282 | 3300048913 | Bacteria | 4280 |
| 191 | Ga0496111_0148478 | 3300048914 | Bacteria | 1738 |
| 192 | Ga0496112_0005227 | 3300048915 | Bacteria | 11174 |
| 193 | Ga0496112_0007714 | 3300048915 | Bacteria | 9574 |
| 194 | Ga0496112_0035672 | 3300048915 | Bacteria | 4847 |
| 195 | Ga0496113_0013413 | 3300048916 | Bacteria | 5552 |
| 196 | Ga0496113_0064215 | 3300048916 | Bacteria | 2775 |
| 197 | Ga0496114_0113642 | 3300048917 | Bacteria | 2321 |
| 198 | Ga0496114_0262239 | 3300048917 | Bacteria | 1521 |
| 199 | Ga0496121_0135340 | 3300048924 | Bacteria | 1837 |
| 200 | Ga0496125_0035890 | 3300048928 | Bacteria | 4339 |
| 201 | Ga0501032_0017527 | 3300049569 | Bacteria | 5027 |
| 202 | Ga0501034_0000016 | 3300049571 | Bacteria | 289751 |
| 203 | Ga0501037_0010170 | 3300049573 | Bacteria | 6902 |
| 204 | Ga0501037_0058703 | 3300049573 | Bacteria | 2807 |
| 205 | Ga0501038_0096337 | 3300049574 | Bacteria | 2470 |
| 206 | Ga0501039_0021729 | 3300049575 | Bacteria | 4923 |
| 207 | Ga0501039_0057801 | 3300049575 | Bacteria | 3003 |
| 208 | Ga0501043_0125747 | 3300049579 | Bacteria | 2010 |
| 209 | Ga0501046_0068327 | 3300049580 | Bacteria | 2766 |
| 210 | Ga0501047_0033801 | 3300049581 | Bacteria | 4936 |
| 211 | Ga0501069_0066154 | 3300049585 | Bacteria | 2021 |
| 212 | Ga0501035_0281761 | 3300049822 | Bacteria | 1405 |
| 213 | Ga0501044_0023512 | 3300049823 | Bacteria | 6556 |
| 214 | Ga0501044_0227009 | 3300049823 | Bacteria | 1816 |
| 215 | nmdc:mga03n38_6894_c1 | 3300050490 | Bacteria | 3987 |
| 216 | nmdc:mga0yw44_70653_c1 | 3300050492 | Bacteria | 2165 |
| 217 | nmdc:mga0yw44_76842_c1 | 3300050492 | Bacteria | 2085 |
| 218 | Ga0500556_0003096 | 3300053104 | Bacteria | 4970 |
| 219 | Ga0500652_037180 | 3300053131 | Bacteria | 1941 |
| 220 | Ga0500645_000030 | 3300053730 | Bacteria | 121213 |
| 221 | Ga0500645_028622 | 3300053730 | Bacteria | 1685 |
| 222 | Ga0466962_0007800 | 3300061719 | Bacteria | 5131 |
| 223 | Ga0466962_0008267 | 3300061719 | Bacteria | 4987 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048906 | Ga0496103_0152018 | Ga0496103_0152018_503_1459 | 302 |
| 2 | 3300048916 | Ga0496113_0013413 | Ga0496113_0013413_16_999 | 311 |
| 3 | 3300049580 | Ga0501046_0068327 | Ga0501046_0068327_1422_2471 | 322 |
| 4 | 3300005338 | Ga0068868_100131593 | Ga0068868_1001315932 | 343 |
| 5 | 3300049579 | Ga0501043_0125747 | Ga0501043_0125747_361_1575 | 347 |
| 6 | 3300044683 | Ga0466965_0030923 | Ga0466965_0030923_1194_2321 | 348 |
| 7 | 3300044901 | Ga0466960_0000123 | Ga0466960_0000123_16306_17433 | 348 |
| 8 | 3300005466 | Ga0070685_10091171 | Ga0070685_100911711 | 352 |
| 9 | 3300005548 | Ga0070665_100092793 | Ga0070665_1000927934 | 352 |
| 10 | 3300005577 | Ga0068857_100183737 | Ga0068857_1001837372 | 352 |
| 11 | 3300005578 | Ga0068854_100065484 | Ga0068854_1000654842 | 352 |
| 12 | 3300025909 | Ga0207705_10092607 | Ga0207705_100926073 | 352 |
| 13 | 3300025942 | Ga0207689_10059387 | Ga0207689_100593872 | 352 |
| 14 | 3300026023 | Ga0207677_10089776 | Ga0207677_100897762 | 352 |
| 15 | 3300026067 | Ga0207678_10120499 | Ga0207678_101204992 | 352 |
| 16 | 3300026095 | Ga0207676_10076887 | Ga0207676_100768873 | 352 |
| 17 | 3300026116 | Ga0207674_10328864 | Ga0207674_103288642 | 352 |
| 18 | 3300026142 | Ga0207698_10143372 | Ga0207698_101433721 | 352 |
| 19 | 3300028379 | Ga0268266_10056651 | Ga0268266_100566514 | 352 |
| 20 | 3300044684 | Ga0466966_0023298 | Ga0466966_0023298_644_1780 | 353 |
| 21 | 3300044694 | Ga0466963_0006631 | Ga0466963_0006631_2969_4105 | 353 |
| 22 | 3300044842 | Ga0466957_0002538 | Ga0466957_0002538_2123_3259 | 353 |
| 23 | 3300045049 | Ga0466959_0002920 | Ga0466959_0002920_1207_2343 | 353 |
| 24 | 3300045836 | Ga0466958_0000011 | Ga0466958_0000011_2847_3983 | 353 |
| 25 | 3300045976 | Ga0466967_0147117 | Ga0466967_0147117_569_1705 | 353 |
| 26 | 3300061719 | Ga0466962_0007800 | Ga0466962_0007800_2186_3322 | 353 |
| 27 | 3300049823 | Ga0501044_0023512 | Ga0501044_0023512_4453_5604 | 354 |
| 28 | 3300048905 | Ga0496102_0207070 | Ga0496102_0207070_682_1839 | 356 |
| 29 | 3300031548 | Ga0307408_100027617 | Ga0307408_1000276172 | 357 |
| 30 | 3300031911 | Ga0307412_10020990 | Ga0307412_100209904 | 357 |
| 31 | 3300032002 | Ga0307416_100056291 | Ga0307416_1000562913 | 357 |
| 32 | 3300049575 | Ga0501039_0057801 | Ga0501039_0057801_1614_2828 | 358 |
| 33 | 3300049573 | Ga0501037_0010170 | Ga0501037_0010170_5126_6340 | 359 |
| 34 | 3300049574 | Ga0501038_0096337 | Ga0501038_0096337_472_1686 | 359 |
| 35 | 3300049575 | Ga0501039_0021729 | Ga0501039_0021729_176_1390 | 359 |
| 36 | 3300031731 | Ga0307405_10132513 | Ga0307405_101325131 | 360 |
| 37 | 3300031852 | Ga0307410_10159261 | Ga0307410_101592612 | 360 |
| 38 | 3300042122 | Ga0450920_009617 | Ga0450920_009617_70_1197 | 360 |
| 39 | 3300049573 | Ga0501037_0058703 | Ga0501037_0058703_1364_2578 | 360 |
| 40 | 3300031824 | Ga0307413_10054741 | Ga0307413_100547412 | 361 |
| 41 | 3300031852 | Ga0307410_10003297 | Ga0307410_100032974 | 361 |
| 42 | 3300031911 | Ga0307412_10057369 | Ga0307412_100573692 | 361 |
| 43 | 3300032002 | Ga0307416_100048957 | Ga0307416_1000489574 | 361 |
| 44 | 3300032002 | Ga0307416_100052533 | Ga0307416_1000525332 | 361 |
| 45 | 3300032002 | Ga0307416_100217252 | Ga0307416_1002172522 | 361 |
| 46 | 3300031731 | Ga0307405_10031555 | Ga0307405_100315552 | 363 |
| 47 | 3300025949 | Ga0207667_10322469 | Ga0207667_103224692 | 370 |
| 48 | 3300044656 | Ga0466969_0077046 | Ga0466969_0077046_97_1257 | 370 |
| 49 | 3300044658 | Ga0466972_0046552 | Ga0466972_0046552_254_1414 | 370 |
| 50 | 3300044658 | Ga0466972_0059064 | Ga0466972_0059064_231_1403 | 370 |
| 51 | 3300044684 | Ga0466966_0054127 | Ga0466966_0054127_696_1856 | 370 |
| 52 | 3300044693 | Ga0466961_0006757 | Ga0466961_0006757_962_2122 | 370 |
| 53 | 3300044765 | Ga0466970_0003187 | Ga0466970_0003187_5311_6471 | 370 |
| 54 | 3300044842 | Ga0466957_0035004 | Ga0466957_0035004_1045_2205 | 370 |
| 55 | 3300045049 | Ga0466959_0010735 | Ga0466959_0010735_4385_5545 | 370 |
| 56 | 3300061719 | Ga0466962_0008267 | Ga0466962_0008267_3065_4225 | 370 |
| 57 | iso_pu_bacteria | 2919713450 | 2919718863 | 370 |
| 58 | 3300005347 | Ga0070668_100116087 | Ga0070668_1001160872 | 371 |
| 59 | 3300006038 | Ga0075365_10096223 | Ga0075365_100962232 | 371 |
| 60 | 3300025972 | Ga0207668_10013500 | Ga0207668_100135002 | 371 |
| 61 | 3300031731 | Ga0307405_10002265 | Ga0307405_100022654 | 371 |
| 62 | 3300031901 | Ga0307406_10011160 | Ga0307406_100111602 | 371 |
| 63 | 3300032002 | Ga0307416_100014337 | Ga0307416_1000143371 | 371 |
| 64 | 3300032126 | Ga0307415_100022788 | Ga0307415_1000227882 | 371 |
| 65 | 3300050492 | nmdc:mga0yw44_76842_c1 | nmdc:mga0yw44_76842_c1_640_1818 | 371 |
| 66 | 3300005288 | Ga0065714_10108910 | Ga0065714_101089101 | 372 |
| 67 | 3300005333 | Ga0070677_10013904 | Ga0070677_100139042 | 372 |
| 68 | 3300005353 | Ga0070669_100047426 | Ga0070669_1000474262 | 372 |
| 69 | 3300005364 | Ga0070673_100169326 | Ga0070673_1001693261 | 372 |
| 70 | 3300005456 | Ga0070678_100003890 | Ga0070678_1000038903 | 372 |
| 71 | 3300005456 | Ga0070678_100349419 | Ga0070678_1003494191 | 372 |
| 72 | 3300005543 | Ga0070672_100099748 | Ga0070672_1000997483 | 372 |
| 73 | 3300005548 | Ga0070665_100223140 | Ga0070665_1002231401 | 372 |
| 74 | 3300009036 | Ga0105244_10029689 | Ga0105244_100296892 | 372 |
| 75 | 3300013306 | Ga0163162_10050972 | Ga0163162_100509722 | 372 |
| 76 | 3300025315 | Ga0207697_10035796 | Ga0207697_100357961 | 372 |
| 77 | 3300025728 | Ga0207655_1047111 | Ga0207655_10471112 | 372 |
| 78 | 3300025923 | Ga0207681_10051375 | Ga0207681_100513752 | 372 |
| 79 | 3300025940 | Ga0207691_10000138 | Ga0207691_1000013836 | 372 |
| 80 | 3300026121 | Ga0207683_10012765 | Ga0207683_100127654 | 372 |
| 81 | 3300026121 | Ga0207683_10377217 | Ga0207683_103772171 | 372 |
| 82 | 3300031852 | Ga0307410_10063220 | Ga0307410_100632202 | 372 |
| 83 | 3300031903 | Ga0307407_10099337 | Ga0307407_100993372 | 372 |
| 84 | 3300046475 | Ga0495639_0069278 | Ga0495639_0069278_239_1480 | 372 |
| 85 | 3300046522 | Ga0495643_0074513 | Ga0495643_0074513_279_1520 | 372 |
| 86 | 3300046557 | Ga0495622_0017955 | Ga0495622_0017955_1119_2360 | 372 |
| 87 | 3300046674 | Ga0495588_0003405 | Ga0495588_0003405_2755_3996 | 372 |
| 88 | 3300048904 | Ga0496101_0035796 | Ga0496101_0035796_415_1671 | 372 |
| 89 | 3300048905 | Ga0496102_0085127 | Ga0496102_0085127_1510_2757 | 372 |
| 90 | 3300048906 | Ga0496103_0049616 | Ga0496103_0049616_886_2133 | 372 |
| 91 | 3300048907 | Ga0496104_0178855 | Ga0496104_0178855_88_1344 | 372 |
| 92 | 3300048910 | Ga0496107_0131253 | Ga0496107_0131253_94_1350 | 372 |
| 93 | 3300048912 | Ga0496109_0112016 | Ga0496109_0112016_941_2197 | 372 |
| 94 | 3300048914 | Ga0496111_0148478 | Ga0496111_0148478_142_1398 | 372 |
| 95 | 3300048915 | Ga0496112_0035672 | Ga0496112_0035672_2302_3558 | 372 |
| 96 | 3300048916 | Ga0496113_0064215 | Ga0496113_0064215_987_2243 | 372 |
| 97 | 3300048917 | Ga0496114_0113642 | Ga0496114_0113642_725_1981 | 372 |
| 98 | 3300048928 | Ga0496125_0035890 | Ga0496125_0035890_1028_2284 | 372 |
| 99 | iso_pu_bacteria | 2643221692 | 2644518217 | 372 |
| 100 | 3300006186 | Ga0075369_10094611 | Ga0075369_100946111 | 373 |
| 101 | 3300032004 | Ga0307414_10042419 | Ga0307414_100424192 | 373 |
| 102 | 3300042002 | Ga0439442_016171 | Ga0439442_016171_214_1443 | 373 |
| 103 | 3300050492 | nmdc:mga0yw44_70653_c1 | nmdc:mga0yw44_70653_c1_87_1268 | 373 |
| 104 | 3300053730 | Ga0500645_028622 | Ga0500645_028622_26_1207 | 373 |
| 105 | 3300005337 | Ga0070682_100020648 | Ga0070682_1000206482 | 374 |
| 106 | 3300005338 | Ga0068868_100176108 | Ga0068868_1001761082 | 374 |
| 107 | 3300005366 | Ga0070659_100273449 | Ga0070659_1002734491 | 374 |
| 108 | 3300005578 | Ga0068854_100100577 | Ga0068854_1001005772 | 374 |
| 109 | 3300006048 | Ga0075363_100023603 | Ga0075363_1000236033 | 374 |
| 110 | 3300009098 | Ga0105245_10134061 | Ga0105245_101340612 | 374 |
| 111 | 3300010375 | Ga0105239_10319078 | Ga0105239_103190782 | 374 |
| 112 | 3300013308 | Ga0157375_10256363 | Ga0157375_102563631 | 374 |
| 113 | 3300014745 | Ga0157377_10169277 | Ga0157377_101692772 | 374 |
| 114 | 3300025929 | Ga0207664_10052555 | Ga0207664_100525552 | 374 |
| 115 | 3300025981 | Ga0207640_10123169 | Ga0207640_101231692 | 374 |
| 116 | 3300026023 | Ga0207677_10086081 | Ga0207677_100860812 | 374 |
| 117 | 3300048911 | Ga0496108_0095187 | Ga0496108_0095187_657_1829 | 374 |
| 118 | 3300048912 | Ga0496109_0092574 | Ga0496109_0092574_901_2073 | 374 |
| 119 | 3300048915 | Ga0496112_0007714 | Ga0496112_0007714_8034_9206 | 374 |
| 120 | 3300049585 | Ga0501069_0066154 | Ga0501069_0066154_243_1541 | 374 |
| 121 | 3300050490 | nmdc:mga03n38_6894_c1 | nmdc:mga03n38_6894_c1_1673_2845 | 374 |
| 122 | iso_pu_bacteria | 8004021418 | 8004022796 | 374 |
| 123 | iso_pu_bacteria | 2939582691 | 2939588084 | 375 |
| 124 | iso_pu_bacteria | 8004025490 | 8004029474 | 375 |
| 125 | 3300053104 | Ga0500556_0003096 | Ga0500556_0003096_3420_4598 | 376 |
| 126 | 3300053730 | Ga0500645_000030 | Ga0500645_000030_109598_110794 | 376 |
| 127 | iso_pu_bacteria | 2738541274 | 2738708181 | 376 |
| 128 | iso_pu_bacteria | 2904765812 | 2904769246 | 376 |
| 129 | iso_pu_bacteria | 2904770941 | 2904776306 | 376 |
| 130 | iso_pu_bacteria | 2908811453 | 2908814392 | 376 |
| 131 | iso_pu_bacteria | 2919420072 | 2919422833 | 376 |
| 132 | iso_pu_bacteria | 2919432681 | 2919434914 | 376 |
| 133 | 3300021358 | Ga0213873_10000058 | Ga0213873_1000005815 | 377 |
| 134 | 3300031456 | Ga0307513_10238452 | Ga0307513_102384521 | 377 |
| 135 | 3300031548 | Ga0307408_100107753 | Ga0307408_1001077532 | 377 |
| 136 | 3300037853 | Ga0436364_1406928 | Ga0436364_1406928_6628_7809 | 377 |
| 137 | 3300039453 | Ga0436362_0111996 | Ga0436362_0111996_14525_15706 | 377 |
| 138 | 3300044765 | Ga0466970_0010987 | Ga0466970_0010987_3039_4220 | 377 |
| 139 | 3300045976 | Ga0466967_0000825 | Ga0466967_0000825_788_1969 | 377 |
| 140 | 3300047472 | Ga0495686_0012887 | Ga0495686_0012887_4172_5383 | 377 |
| 141 | 3300049581 | Ga0501047_0033801 | Ga0501047_0033801_3729_4916 | 377 |
| 142 | 3300049822 | Ga0501035_0281761 | Ga0501035_0281761_62_1249 | 377 |
| 143 | 3300049823 | Ga0501044_0227009 | Ga0501044_0227009_277_1464 | 377 |
| 144 | 3300037418 | Ga0395900_0362707 | Ga0395900_0362707_56_1270 | 380 |
| 145 | 3300048924 | Ga0496121_0135340 | Ga0496121_0135340_270_1481 | 380 |
| 146 | 3300053131 | Ga0500652_037180 | Ga0500652_037180_671_1891 | 380 |
| 147 | 3300021388 | Ga0213875_10005805 | Ga0213875_100058056 | 381 |
| 148 | 3300048909 | Ga0496106_0141266 | Ga0496106_0141266_565_1800 | 381 |
| 149 | iso_pu_bacteria | 2537561592 | 2537897820 | 382 |
| 150 | iso_pu_bacteria | 2690315906 | 2691513797 | 382 |
| 151 | iso_pu_bacteria | 2808606370 | 2808891119 | 382 |
| 152 | iso_pu_bacteria | 2919391150 | 2919395571 | 382 |
| 153 | iso_pu_bacteria | 2939598168 | 2939601365 | 382 |
| 154 | iso_pu_bacteria | 2945920336 | 2945920605 | 382 |
| 155 | iso_pu_bacteria | 2945941187 | 2945943164 | 382 |
| 156 | iso_pu_bacteria | 2945956166 | 2945959047 | 382 |
| 157 | iso_pu_bacteria | 2946037020 | 2946039084 | 382 |
| 158 | iso_pu_bacteria | 2953998280 | 2954000473 | 382 |
| 159 | 3300031731 | Ga0307405_10128367 | Ga0307405_101283672 | 383 |
| 160 | 3300031824 | Ga0307413_10190051 | Ga0307413_101900511 | 383 |
| 161 | 3300032002 | Ga0307416_100085081 | Ga0307416_1000850812 | 383 |
| 162 | iso_pu_bacteria | 2775506735 | 2775658052 | 383 |
| 163 | iso_pu_bacteria | 2808606357 | 2808831068 | 383 |
| 164 | iso_pu_bacteria | 2808606360 | 2808852330 | 383 |
| 165 | iso_pu_bacteria | 2808606366 | 2808879384 | 383 |
| 166 | iso_pu_bacteria | 2808606371 | 2808896378 | 383 |
| 167 | iso_pu_bacteria | 2811994871 | 2812321240 | 383 |
| 168 | iso_pu_bacteria | 2844849076 | 2844852667 | 383 |
| 169 | iso_pu_bacteria | 2857740372 | 2857742180 | 383 |
| 170 | iso_pu_bacteria | 2904776348 | 2904777648 | 383 |
| 171 | iso_pu_bacteria | 2910809715 | 2910811595 | 383 |
| 172 | iso_pu_bacteria | 2919034639 | 2919035019 | 383 |
| 173 | iso_pu_bacteria | 2919059106 | 2919059842 | 383 |
| 174 | iso_pu_bacteria | 2919538618 | 2919540476 | 383 |
| 175 | iso_pu_bacteria | 2932426870 | 2932428332 | 383 |
| 176 | iso_pu_bacteria | 2933418574 | 2933422439 | 383 |
| 177 | iso_pu_bacteria | 2939647034 | 2939648736 | 383 |
| 178 | iso_pu_bacteria | 2939674588 | 2939675210 | 383 |
| 179 | iso_pu_bacteria | 2945916053 | 2945918993 | 383 |
| 180 | iso_pu_bacteria | 2946059875 | 2946062850 | 383 |
| 181 | iso_pu_bacteria | 2974302888 | 2974306988 | 383 |
| 182 | iso_pu_bacteria | 8054107350 | 8054111997 | 383 |
| 183 | 3300044683 | Ga0466965_0040312 | Ga0466965_0040312_264_1466 | 385 |
| 184 | 3300011119 | Ga0105246_10040091 | Ga0105246_100400912 | 386 |
| 185 | 3300025315 | Ga0207697_10020090 | Ga0207697_100200902 | 386 |
| 186 | 3300025728 | Ga0207655_1023262 | Ga0207655_10232622 | 386 |
| 187 | 3300031548 | Ga0307408_100026408 | Ga0307408_1000264083 | 386 |
| 188 | 3300031731 | Ga0307405_10015791 | Ga0307405_100157912 | 386 |
| 189 | 3300031824 | Ga0307413_10075455 | Ga0307413_100754552 | 386 |
| 190 | 3300031903 | Ga0307407_10092619 | Ga0307407_100926192 | 386 |
| 191 | 3300031911 | Ga0307412_10015778 | Ga0307412_100157783 | 386 |
| 192 | 3300031911 | Ga0307412_10115444 | Ga0307412_101154441 | 386 |
| 193 | 3300031995 | Ga0307409_100300286 | Ga0307409_1003002861 | 386 |
| 194 | 3300032004 | Ga0307414_10158165 | Ga0307414_101581652 | 386 |
| 195 | 3300041404 | Ga0439436_0022389 | Ga0439436_0022389_476_1711 | 386 |
| 196 | 3300041405 | Ga0439438_001589 | Ga0439438_001589_3828_5057 | 386 |
| 197 | 3300041999 | Ga0439433_0000591 | Ga0439433_0000591_1254_2483 | 386 |
| 198 | 3300042002 | Ga0439442_000024 | Ga0439442_000024_31100_32335 | 386 |
| 199 | 3300042002 | Ga0439442_000939 | Ga0439442_000939_2002_3237 | 386 |
| 200 | 3300042002 | Ga0439442_014479 | Ga0439442_014479_166_1395 | 386 |
| 201 | 3300042006 | Ga0439432_000885 | Ga0439432_000885_7185_8414 | 386 |
| 202 | 3300042006 | Ga0439432_019582 | Ga0439432_019582_836_2071 | 386 |
| 203 | 3300042007 | Ga0439449_0060009 | Ga0439449_0060009_139_1374 | 386 |
| 204 | 3300042010 | Ga0439452_003080 | Ga0439452_003080_4521_5750 | 386 |
| 205 | 3300042014 | Ga0439457_008439 | Ga0439457_008439_185_1414 | 386 |
| 206 | 3300042015 | Ga0439462_0000270 | Ga0439462_0000270_4682_5911 | 386 |
| 207 | 3300042122 | Ga0450920_002017 | Ga0450920_002017_2076_3311 | 386 |
| 208 | 3300042122 | Ga0450920_002244 | Ga0450920_002244_1526_2761 | 386 |
| 209 | 3300042156 | Ga0439446_0003097 | Ga0439446_0003097_1687_2916 | 386 |
| 210 | 3300042184 | Ga0450908_001486 | Ga0450908_001486_386_1615 | 386 |
| 211 | 3300042435 | Ga0439434_0002026 | Ga0439434_0002026_3241_4476 | 386 |
| 212 | 3300042531 | Ga0450918_004225 | Ga0450918_004225_383_1618 | 386 |
| 213 | 3300002773 | JGI25152J39213_1000124 | JGI25152J39213_100012428 | 387 |
| 214 | 3300009036 | Ga0105244_10016573 | Ga0105244_100165733 | 387 |
| 215 | 3300009148 | Ga0105243_10026508 | Ga0105243_100265082 | 387 |
| 216 | 3300011119 | Ga0105246_10027609 | Ga0105246_100276092 | 387 |
| 217 | 3300011119 | Ga0105246_10035070 | Ga0105246_100350702 | 387 |
| 218 | 3300011119 | Ga0105246_10038010 | Ga0105246_100380103 | 387 |
| 219 | 3300025254 | Ga0209148_1001288 | Ga0209148_10012882 | 387 |
| 220 | 3300025258 | Ga0209129_1000067 | Ga0209129_100006757 | 387 |
| 221 | 3300025294 | Ga0209025_1000971 | Ga0209025_100097117 | 387 |
| 222 | 3300025728 | Ga0207655_1005022 | Ga0207655_10050224 | 387 |
| 223 | 3300031903 | Ga0307407_10118116 | Ga0307407_101181161 | 387 |
| 224 | 3300031995 | Ga0307409_100078490 | Ga0307409_1000784902 | 387 |
| 225 | 3300032002 | Ga0307416_100032310 | Ga0307416_1000323103 | 387 |
| 226 | 3300037312 | Ga0395899_0051616 | Ga0395899_0051616_1193_2434 | 387 |
| 227 | 3300037418 | Ga0395900_0008951 | Ga0395900_0008951_565_1806 | 387 |
| 228 | 3300037418 | Ga0395900_0030495 | Ga0395900_0030495_3642_4883 | 387 |
| 229 | 3300037466 | Ga0395898_0030878 | Ga0395898_0030878_1414_2628 | 387 |
| 230 | 3300037466 | Ga0395898_0100931 | Ga0395898_0100931_601_1842 | 387 |
| 231 | 3300041404 | Ga0439436_0025504 | Ga0439436_0025504_123_1400 | 387 |
| 232 | 3300041411 | Ga0439466_0035023 | Ga0439466_0035023_378_1655 | 387 |
| 233 | 3300042002 | Ga0439442_001575 | Ga0439442_001575_163_1395 | 387 |
| 234 | 3300042007 | Ga0439449_0004598 | Ga0439449_0004598_56_1333 | 387 |
| 235 | 3300042007 | Ga0439449_0005221 | Ga0439449_0005221_2201_3439 | 387 |
| 236 | 3300046459 | Ga0495629_0114121 | Ga0495629_0114121_206_1471 | 387 |
| 237 | 3300046463 | Ga0495653_0077519 | Ga0495653_0077519_445_1779 | 387 |
| 238 | 3300046472 | Ga0495580_0001442 | Ga0495580_0001442_15697_16917 | 387 |
| 239 | 3300046476 | Ga0495662_0028632 | Ga0495662_0028632_347_1681 | 387 |
| 240 | 3300046528 | Ga0495642_0051371 | Ga0495642_0051371_361_1668 | 387 |
| 241 | 3300046531 | Ga0495665_0001329 | Ga0495665_0001329_4017_5351 | 387 |
| 242 | 3300046535 | Ga0495586_0003057 | Ga0495586_0003057_4518_5852 | 387 |
| 243 | 3300046535 | Ga0495586_0004092 | Ga0495586_0004092_6452_7717 | 387 |
| 244 | 3300046535 | Ga0495586_0060466 | Ga0495586_0060466_385_1770 | 387 |
| 245 | 3300046536 | Ga0495587_0000295 | Ga0495587_0000295_13639_14973 | 387 |
| 246 | 3300046543 | Ga0495645_0004137 | Ga0495645_0004137_5608_6942 | 387 |
| 247 | 3300046559 | Ga0495667_0004212 | Ga0495667_0004212_2972_4306 | 387 |
| 248 | 3300046615 | Ga0495656_0021444 | Ga0495656_0021444_1158_2459 | 387 |
| 249 | 3300046674 | Ga0495588_0005125 | Ga0495588_0005125_3600_4919 | 387 |
| 250 | 3300046674 | Ga0495588_0009309 | Ga0495588_0009309_2935_4200 | 387 |
| 251 | 3300046675 | Ga0495657_0042411 | Ga0495657_0042411_1712_3046 | 387 |
| 252 | 3300046691 | Ga0495670_0016447 | Ga0495670_0016447_1386_2687 | 387 |
| 253 | 3300047315 | Ga0495581_0004383 | Ga0495581_0004383_74_1408 | 387 |
| 254 | 3300047315 | Ga0495581_0009593 | Ga0495581_0009593_3361_4626 | 387 |
| 255 | 3300047318 | Ga0495636_0006018 | Ga0495636_0006018_2577_3878 | 387 |
| 256 | 3300047444 | Ga0495675_0003818 | Ga0495675_0003818_2404_3738 | 387 |
| 257 | 3300047673 | Ga0495593_0054875 | Ga0495593_0054875_413_1666 | 387 |
| 258 | 3300048904 | Ga0496101_0138784 | Ga0496101_0138784_82_1410 | 387 |
| 259 | 3300048905 | Ga0496102_0099067 | Ga0496102_0099067_684_1904 | 387 |
| 260 | 3300048909 | Ga0496106_0073295 | Ga0496106_0073295_42_1334 | 387 |
| 261 | 3300048913 | Ga0496110_0036282 | Ga0496110_0036282_92_1399 | 387 |
| 262 | 3300048915 | Ga0496112_0005227 | Ga0496112_0005227_8141_9361 | 387 |
| 263 | 3300048917 | Ga0496114_0262239 | Ga0496114_0262239_194_1483 | 387 |
| 264 | 3300049569 | Ga0501032_0017527 | Ga0501032_0017527_1222_2433 | 387 |
| 265 | 3300049571 | Ga0501034_0000016 | Ga0501034_0000016_30241_31452 | 387 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8u97-assembly1.cif.gz_A | crystal structure of dephospho-coa kinase from klebsiella aerogenes (amp-pnp bound) | 0.9148 | 1 | 202 |
| 8u97-assembly1.cif.gz_A | crystal structure of dephospho-coa kinase from klebsiella aerogenes (amp-pnp bound) | 0.9063 | 1 | 202 |
| 6n39-assembly1.cif.gz_A | crystal structure of an dephospho-coa kinase coae from mycobacterium paratuberculosis | 0.8941 | 2 | 383 |
| 6n39-assembly1.cif.gz_A | crystal structure of an dephospho-coa kinase coae from mycobacterium paratuberculosis | 0.8809 | 2 | 383 |
| 1vhl-assembly2.cif.gz_B | crystal structure of dephospho-coa kinase with adenosine-5'-diphosphate | 0.8559 | 2 | 208 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WPA3_1_200_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.896 | 1 | 200 | 3.40.50.300 |
| af_P9WPA3_208_401_3.30.460.10 | Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 | 0.893 | 209 | 376 | 3.30.460.10 |
| af_P9WPA3_1_200_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8919 | 1 | 200 | 3.40.50.300 |
| af_Q4D748_1_97_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8759 | 111 | 191 | 3.40.50.300 |
| af_Q5AK15_1_205_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8642 | 1 | 192 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1I5I0U7-F1-model_v4 | Dephospho-CoA kinase (EC 2.7.1.24) (Dephosphocoenzyme A kinase) | 0.9601 | 1 | 200 |
GO:0004140
GO:0005524 GO:0005737 GO:0015937 |
| AF-Q9S2K7-F1-model_v4 | Dephospho-CoA kinase (EC 2.7.1.24) (Dephosphocoenzyme A kinase) | 0.9563 | 1 | 198 |
GO:0004140
GO:0005524 GO:0005737 GO:0015937 |
| AF-A0A646KDM4-F1-model_v4 | Dephospho-CoA kinase (EC 2.7.1.24) (Dephosphocoenzyme A kinase) | 0.9515 | 1 | 199 |
GO:0004140
GO:0005524 GO:0005737 GO:0015937 |
| AF-A0A1I5I0U7-F1-model_v4 | Dephospho-CoA kinase (EC 2.7.1.24) (Dephosphocoenzyme A kinase) | 0.9463 | 1 | 200 |
GO:0004140
GO:0005524 GO:0005737 GO:0015937 |
| AF-A0A7K3BR13-F1-model_v4 | deleted | 0.9439 | 1 | 202 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar