F373531

General Info

Members Datasets Scaffolds Average Seq Length
265 188 223 398

Family's Representative Sequence

Representative Sequence 3300046463|Ga0495653_0077519|Ga0495653_0077519_445_1779
Length 437
Sequence VLKIGLTGGIASGKSLAAARLRELGAVLVDADALAREVVEPGTPGLAKVVEAFSAAILTSDGRLDRPRLGALVFGNPERLGVLNGIIHPLVRERAAAMVASAPAGAVVVQDIPLLVETGQGQNFHLVVVVDAADDVRVRRMAEHRHMSADEAHARMAAQASRADRLAAADVVLDNSGTPQALQDAVDALWDRRLAPFALNLQERRIAPRTGGPVLAPADPSWPAQAGRLIARLRAAVAQDVLAVDHIGSTAVPGLDAKDVIDLQLSVRDLDAADRIAPLLAAAGFPRWPGIIADNPKPSHPDPADWGKRLHANADPGRPVNVHIRAAGSPGWRYALCFRDWLRADAGARADYVAEKRRVAGLHDVDKSTAGYAADKEGWFTDYAWPRMEAWVQRTGWQPPSNGADDDAGGATRPDAGTVTGAIPPEGVGIGPGTAQS

Samples

Sample ID Description Type Environment
1 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
2 2643221692 Nocardia sp. Root136 Isolate Unclassified
3 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
4 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
5 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
6 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
7 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
8 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
9 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
10 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
11 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
12 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
13 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
14 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
15 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
16 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
17 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
18 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
19 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
20 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
21 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
22 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
23 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
24 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
25 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
26 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
27 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
28 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
29 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
30 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
31 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
32 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
33 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
34 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
35 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
36 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
37 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
38 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
39 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
40 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
41 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
42 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
43 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
44 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
45 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
46 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
47 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
48 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
57 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
58 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
67 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
68 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
70 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
71 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
89 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
90 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
91 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
92 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
93 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
94 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
95 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
96 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
97 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
98 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
99 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
100 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
101 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
102 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
103 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
104 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
105 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
106 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
107 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
108 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
109 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
110 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
111 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
112 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
113 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
114 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
115 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
116 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
117 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
118 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
119 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
120 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
121 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
122 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
123 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
124 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
125 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
126 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
127 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
128 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
129 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
130 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
131 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
132 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
133 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
134 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
135 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
136 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
137 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
138 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
139 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
140 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
141 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
142 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
143 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
144 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
145 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
146 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
147 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
148 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
149 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
150 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
151 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
152 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
153 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
154 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
155 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
156 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
157 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
158 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
159 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
160 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
161 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
162 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
163 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
164 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
165 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
166 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
167 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
168 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
169 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
178 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
180 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
181 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
182 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
183 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
184 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
185 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
186 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
187 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
188 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.15
Metatranscriptomes 0
Isolates 15.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.28
Nodule 0
Rhizoplane 8.68
Rhizosphere 78.11
Stem 0
Stem Tuber 0
Unclassified 7.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1000124 3300002773 Bacteria 52334
2 Ga0065714_10108910 3300005288 Bacteria 1481
3 Ga0070677_10013904 3300005333 Bacteria 2825
4 Ga0070682_100020648 3300005337 Bacteria 3879
5 Ga0068868_100131593 3300005338 Bacteria 2047
6 Ga0068868_100176108 3300005338 Bacteria 1773
7 Ga0070668_100116087 3300005347 Bacteria 2134
8 Ga0070669_100047426 3300005353 Bacteria 3134
9 Ga0070673_100169326 3300005364 Bacteria 1863
10 Ga0070659_100273449 3300005366 Bacteria 1404
11 Ga0070678_100003890 3300005456 Bacteria 8390
12 Ga0070678_100349419 3300005456 Bacteria 1271
13 Ga0070685_10091171 3300005466 Bacteria 1844
14 Ga0070672_100099748 3300005543 Bacteria 2354
15 Ga0070665_100092793 3300005548 Bacteria 3024
16 Ga0070665_100223140 3300005548 Bacteria 1885
17 Ga0068857_100183737 3300005577 Bacteria 1903
18 Ga0068854_100065484 3300005578 Bacteria 2642
19 Ga0068854_100100577 3300005578 Bacteria 2167
20 Ga0075365_10096223 3300006038 Bacteria 2023
21 Ga0075363_100023603 3300006048 Bacteria 3120
22 Ga0075369_10094611 3300006186 Bacteria 1336
23 Ga0105244_10016573 3300009036 Bacteria 4194
24 Ga0105244_10029689 3300009036 Bacteria 2918
25 Ga0105245_10134061 3300009098 Bacteria 2326
26 Ga0105243_10026508 3300009148 Bacteria 4436
27 Ga0105239_10319078 3300010375 Bacteria 1752
28 Ga0105246_10027609 3300011119 Bacteria 3722
29 Ga0105246_10035070 3300011119 Bacteria 3350
30 Ga0105246_10038010 3300011119 Bacteria 3233
31 Ga0105246_10040091 3300011119 Bacteria 3159
32 Ga0163162_10050972 3300013306 Bacteria 4152
33 Ga0157375_10256363 3300013308 Bacteria 1910
34 Ga0157377_10169277 3300014745 Bacteria 1365
35 Ga0213873_10000058 3300021358 Bacteria 24370
36 Ga0213875_10005805 3300021388 Bacteria 6568
37 Ga0209148_1001288 3300025254 Bacteria 13617
38 Ga0209129_1000067 3300025258 Bacteria 219974
39 Ga0209025_1000971 3300025294 Bacteria 42988
40 Ga0207697_10020090 3300025315 Bacteria 2736
41 Ga0207697_10035796 3300025315 Bacteria 2033
42 Ga0207655_1005022 3300025728 Bacteria 9155
43 Ga0207655_1023262 3300025728 Bacteria 3079
44 Ga0207655_1047111 3300025728 Bacteria 1782
45 Ga0207705_10092607 3300025909 Bacteria 2215
46 Ga0207681_10051375 3300025923 Bacteria 2793
47 Ga0207664_10052555 3300025929 Bacteria 3223
48 Ga0207691_10000138 3300025940 Bacteria 66608
49 Ga0207689_10059387 3300025942 Bacteria 3145
50 Ga0207667_10322469 3300025949 Bacteria 1578
51 Ga0207668_10013500 3300025972 Bacteria 5032
52 Ga0207640_10123169 3300025981 Bacteria 1862
53 Ga0207677_10086081 3300026023 Bacteria 2270
54 Ga0207677_10089776 3300026023 Bacteria 2231
55 Ga0207678_10120499 3300026067 Bacteria 2239
56 Ga0207676_10076887 3300026095 Bacteria 2699
57 Ga0207674_10328864 3300026116 Bacteria 1478
58 Ga0207683_10012765 3300026121 Bacteria 7170
59 Ga0207683_10377217 3300026121 Bacteria 1303
60 Ga0207698_10143372 3300026142 Bacteria 2062
61 Ga0268266_10056651 3300028379 Bacteria 3372
62 Ga0307513_10238452 3300031456 Bacteria 1626
63 Ga0307408_100026408 3300031548 Bacteria 3989
64 Ga0307408_100027617 3300031548 Bacteria 3913
65 Ga0307408_100107753 3300031548 Bacteria 2134
66 Ga0307405_10002265 3300031731 Bacteria 8418
67 Ga0307405_10015791 3300031731 Bacteria 4099
68 Ga0307405_10031555 3300031731 Bacteria 3121
69 Ga0307405_10128367 3300031731 Bacteria 1747
70 Ga0307405_10132513 3300031731 Bacteria 1724
71 Ga0307413_10054741 3300031824 Bacteria 2423
72 Ga0307413_10075455 3300031824 Bacteria 2140
73 Ga0307413_10190051 3300031824 Bacteria 1473
74 Ga0307410_10003297 3300031852 Bacteria 8065
75 Ga0307410_10063220 3300031852 Bacteria 2538
76 Ga0307410_10159261 3300031852 Bacteria 1689
77 Ga0307406_10011160 3300031901 Bacteria 5091
78 Ga0307407_10092619 3300031903 Bacteria 1856
79 Ga0307407_10099337 3300031903 Bacteria 1803
80 Ga0307407_10118116 3300031903 Bacteria 1676
81 Ga0307412_10015778 3300031911 Bacteria 4484
82 Ga0307412_10020990 3300031911 Bacteria 3983
83 Ga0307412_10057369 3300031911 Bacteria 2599
84 Ga0307412_10115444 3300031911 Bacteria 1924
85 Ga0307409_100078490 3300031995 Bacteria 2656
86 Ga0307409_100300286 3300031995 Bacteria 1493
87 Ga0307416_100014337 3300032002 Bacteria 5427
88 Ga0307416_100032310 3300032002 Bacteria 3952
89 Ga0307416_100048957 3300032002 Bacteria 3357
90 Ga0307416_100052533 3300032002 Bacteria 3263
91 Ga0307416_100056291 3300032002 Bacteria 3173
92 Ga0307416_100085081 3300032002 Bacteria 2690
93 Ga0307416_100217252 3300032002 Bacteria 1830
94 Ga0307414_10042419 3300032004 Bacteria 3091
95 Ga0307414_10158165 3300032004 Bacteria 1796
96 Ga0307415_100022788 3300032126 Bacteria 3873
97 Ga0395899_0051616 3300037312 Bacteria 3051
98 Ga0395900_0008951 3300037418 Bacteria 10266
99 Ga0395900_0030495 3300037418 Bacteria 5537
100 Ga0395900_0362707 3300037418 Bacteria 1420
101 Ga0395898_0030878 3300037466 Bacteria 5359
102 Ga0395898_0100931 3300037466 Bacteria 2771
103 Ga0436364_1406928 3300037853 Bacteria 16191
104 Ga0436362_0111996 3300039453 Bacteria 17950
105 Ga0439436_0022389 3300041404 Bacteria 1872
106 Ga0439436_0025504 3300041404 Bacteria 1736
107 Ga0439438_001589 3300041405 Bacteria 9978
108 Ga0439466_0035023 3300041411 Bacteria 1699
109 Ga0439433_0000591 3300041999 Bacteria 6897
110 Ga0439442_000024 3300042002 Bacteria 40056
111 Ga0439442_000939 3300042002 Bacteria 5916
112 Ga0439442_001575 3300042002 Bacteria 4477
113 Ga0439442_014479 3300042002 Bacteria 1623
114 Ga0439442_016171 3300042002 Bacteria 1538
115 Ga0439432_000885 3300042006 Bacteria 11237
116 Ga0439432_019582 3300042006 Bacteria 2254
117 Ga0439449_0004598 3300042007 Bacteria 5333
118 Ga0439449_0005221 3300042007 Bacteria 4982
119 Ga0439449_0060009 3300042007 Bacteria 1403
120 Ga0439452_003080 3300042010 Bacteria 5915
121 Ga0439457_008439 3300042014 Bacteria 2430
122 Ga0439462_0000270 3300042015 Bacteria 9462
123 Ga0450920_002017 3300042122 Bacteria 3430
124 Ga0450920_002244 3300042122 Bacteria 3273
125 Ga0450920_009617 3300042122 Bacteria 1781
126 Ga0439446_0003097 3300042156 Bacteria 4085
127 Ga0450908_001486 3300042184 Bacteria 4549
128 Ga0439434_0002026 3300042435 Bacteria 5854
129 Ga0450918_004225 3300042531 Bacteria 2630
130 Ga0466969_0077046 3300044656 Bacteria 1596
131 Ga0466972_0046552 3300044658 Bacteria 2099
132 Ga0466972_0059064 3300044658 Bacteria 1841
133 Ga0466965_0030923 3300044683 Bacteria 2609
134 Ga0466965_0040312 3300044683 Bacteria 2299
135 Ga0466966_0023298 3300044684 Bacteria 4055
136 Ga0466966_0054127 3300044684 Bacteria 2544
137 Ga0466961_0006757 3300044693 Bacteria 7300
138 Ga0466963_0006631 3300044694 Bacteria 6870
139 Ga0466970_0003187 3300044765 Bacteria 7975
140 Ga0466970_0010987 3300044765 Bacteria 4606
141 Ga0466957_0002538 3300044842 Bacteria 9824
142 Ga0466957_0035004 3300044842 Bacteria 3013
143 Ga0466960_0000123 3300044901 Bacteria 25757
144 Ga0466959_0002920 3300045049 Bacteria 11025
145 Ga0466959_0010735 3300045049 Bacteria 6561
146 Ga0466958_0000011 3300045836 Bacteria 57675
147 Ga0466967_0000825 3300045976 Bacteria 16309
148 Ga0466967_0147117 3300045976 Bacteria 2198
149 Ga0495629_0114121 3300046459 Bacteria 1883
150 Ga0495653_0077519 3300046463 Bacteria 2467
151 Ga0495580_0001442 3300046472 Bacteria 20833
152 Ga0495639_0069278 3300046475 Bacteria 1627
153 Ga0495662_0028632 3300046476 Bacteria 2689
154 Ga0495643_0074513 3300046522 Bacteria 1777
155 Ga0495642_0051371 3300046528 Bacteria 1696
156 Ga0495665_0001329 3300046531 Bacteria 13191
157 Ga0495586_0003057 3300046535 Bacteria 9021
158 Ga0495586_0004092 3300046535 Bacteria 7814
159 Ga0495586_0060466 3300046535 Bacteria 2060
160 Ga0495587_0000295 3300046536 Bacteria 35493
161 Ga0495645_0004137 3300046543 Bacteria 9910
162 Ga0495622_0017955 3300046557 Bacteria 3295
163 Ga0495667_0004212 3300046559 Bacteria 9693
164 Ga0495656_0021444 3300046615 Bacteria 2515
165 Ga0495588_0003405 3300046674 Bacteria 6910
166 Ga0495588_0005125 3300046674 Bacteria 5819
167 Ga0495588_0009309 3300046674 Bacteria 4536
168 Ga0495657_0042411 3300046675 Bacteria 3107
169 Ga0495670_0016447 3300046691 Bacteria 3635
170 Ga0495581_0004383 3300047315 Bacteria 8155
171 Ga0495581_0009593 3300047315 Bacteria 5598
172 Ga0495636_0006018 3300047318 Bacteria 4760
173 Ga0495675_0003818 3300047444 Bacteria 9125
174 Ga0495686_0012887 3300047472 Bacteria 5829
175 Ga0495593_0054875 3300047673 Bacteria 2099
176 Ga0496101_0035796 3300048904 Bacteria 3512
177 Ga0496101_0138784 3300048904 Bacteria 1851
178 Ga0496102_0085127 3300048905 Bacteria 2918
179 Ga0496102_0099067 3300048905 Bacteria 2705
180 Ga0496102_0207070 3300048905 Bacteria 1849
181 Ga0496103_0049616 3300048906 Bacteria 2595
182 Ga0496103_0152018 3300048906 Bacteria 1483
183 Ga0496104_0178855 3300048907 Bacteria 2031
184 Ga0496106_0073295 3300048909 Bacteria 2619
185 Ga0496106_0141266 3300048909 Bacteria 1894
186 Ga0496107_0131253 3300048910 Bacteria 1849
187 Ga0496108_0095187 3300048911 Bacteria 2535
188 Ga0496109_0092574 3300048912 Bacteria 2796
189 Ga0496109_0112016 3300048912 Bacteria 2537
190 Ga0496110_0036282 3300048913 Bacteria 4280
191 Ga0496111_0148478 3300048914 Bacteria 1738
192 Ga0496112_0005227 3300048915 Bacteria 11174
193 Ga0496112_0007714 3300048915 Bacteria 9574
194 Ga0496112_0035672 3300048915 Bacteria 4847
195 Ga0496113_0013413 3300048916 Bacteria 5552
196 Ga0496113_0064215 3300048916 Bacteria 2775
197 Ga0496114_0113642 3300048917 Bacteria 2321
198 Ga0496114_0262239 3300048917 Bacteria 1521
199 Ga0496121_0135340 3300048924 Bacteria 1837
200 Ga0496125_0035890 3300048928 Bacteria 4339
201 Ga0501032_0017527 3300049569 Bacteria 5027
202 Ga0501034_0000016 3300049571 Bacteria 289751
203 Ga0501037_0010170 3300049573 Bacteria 6902
204 Ga0501037_0058703 3300049573 Bacteria 2807
205 Ga0501038_0096337 3300049574 Bacteria 2470
206 Ga0501039_0021729 3300049575 Bacteria 4923
207 Ga0501039_0057801 3300049575 Bacteria 3003
208 Ga0501043_0125747 3300049579 Bacteria 2010
209 Ga0501046_0068327 3300049580 Bacteria 2766
210 Ga0501047_0033801 3300049581 Bacteria 4936
211 Ga0501069_0066154 3300049585 Bacteria 2021
212 Ga0501035_0281761 3300049822 Bacteria 1405
213 Ga0501044_0023512 3300049823 Bacteria 6556
214 Ga0501044_0227009 3300049823 Bacteria 1816
215 nmdc:mga03n38_6894_c1 3300050490 Bacteria 3987
216 nmdc:mga0yw44_70653_c1 3300050492 Bacteria 2165
217 nmdc:mga0yw44_76842_c1 3300050492 Bacteria 2085
218 Ga0500556_0003096 3300053104 Bacteria 4970
219 Ga0500652_037180 3300053131 Bacteria 1941
220 Ga0500645_000030 3300053730 Bacteria 121213
221 Ga0500645_028622 3300053730 Bacteria 1685
222 Ga0466962_0007800 3300061719 Bacteria 5131
223 Ga0466962_0008267 3300061719 Bacteria 4987

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048906 Ga0496103_0152018 Ga0496103_0152018_503_1459 302
2 3300048916 Ga0496113_0013413 Ga0496113_0013413_16_999 311
3 3300049580 Ga0501046_0068327 Ga0501046_0068327_1422_2471 322
4 3300005338 Ga0068868_100131593 Ga0068868_1001315932 343
5 3300049579 Ga0501043_0125747 Ga0501043_0125747_361_1575 347
6 3300044683 Ga0466965_0030923 Ga0466965_0030923_1194_2321 348
7 3300044901 Ga0466960_0000123 Ga0466960_0000123_16306_17433 348
8 3300005466 Ga0070685_10091171 Ga0070685_100911711 352
9 3300005548 Ga0070665_100092793 Ga0070665_1000927934 352
10 3300005577 Ga0068857_100183737 Ga0068857_1001837372 352
11 3300005578 Ga0068854_100065484 Ga0068854_1000654842 352
12 3300025909 Ga0207705_10092607 Ga0207705_100926073 352
13 3300025942 Ga0207689_10059387 Ga0207689_100593872 352
14 3300026023 Ga0207677_10089776 Ga0207677_100897762 352
15 3300026067 Ga0207678_10120499 Ga0207678_101204992 352
16 3300026095 Ga0207676_10076887 Ga0207676_100768873 352
17 3300026116 Ga0207674_10328864 Ga0207674_103288642 352
18 3300026142 Ga0207698_10143372 Ga0207698_101433721 352
19 3300028379 Ga0268266_10056651 Ga0268266_100566514 352
20 3300044684 Ga0466966_0023298 Ga0466966_0023298_644_1780 353
21 3300044694 Ga0466963_0006631 Ga0466963_0006631_2969_4105 353
22 3300044842 Ga0466957_0002538 Ga0466957_0002538_2123_3259 353
23 3300045049 Ga0466959_0002920 Ga0466959_0002920_1207_2343 353
24 3300045836 Ga0466958_0000011 Ga0466958_0000011_2847_3983 353
25 3300045976 Ga0466967_0147117 Ga0466967_0147117_569_1705 353
26 3300061719 Ga0466962_0007800 Ga0466962_0007800_2186_3322 353
27 3300049823 Ga0501044_0023512 Ga0501044_0023512_4453_5604 354
28 3300048905 Ga0496102_0207070 Ga0496102_0207070_682_1839 356
29 3300031548 Ga0307408_100027617 Ga0307408_1000276172 357
30 3300031911 Ga0307412_10020990 Ga0307412_100209904 357
31 3300032002 Ga0307416_100056291 Ga0307416_1000562913 357
32 3300049575 Ga0501039_0057801 Ga0501039_0057801_1614_2828 358
33 3300049573 Ga0501037_0010170 Ga0501037_0010170_5126_6340 359
34 3300049574 Ga0501038_0096337 Ga0501038_0096337_472_1686 359
35 3300049575 Ga0501039_0021729 Ga0501039_0021729_176_1390 359
36 3300031731 Ga0307405_10132513 Ga0307405_101325131 360
37 3300031852 Ga0307410_10159261 Ga0307410_101592612 360
38 3300042122 Ga0450920_009617 Ga0450920_009617_70_1197 360
39 3300049573 Ga0501037_0058703 Ga0501037_0058703_1364_2578 360
40 3300031824 Ga0307413_10054741 Ga0307413_100547412 361
41 3300031852 Ga0307410_10003297 Ga0307410_100032974 361
42 3300031911 Ga0307412_10057369 Ga0307412_100573692 361
43 3300032002 Ga0307416_100048957 Ga0307416_1000489574 361
44 3300032002 Ga0307416_100052533 Ga0307416_1000525332 361
45 3300032002 Ga0307416_100217252 Ga0307416_1002172522 361
46 3300031731 Ga0307405_10031555 Ga0307405_100315552 363
47 3300025949 Ga0207667_10322469 Ga0207667_103224692 370
48 3300044656 Ga0466969_0077046 Ga0466969_0077046_97_1257 370
49 3300044658 Ga0466972_0046552 Ga0466972_0046552_254_1414 370
50 3300044658 Ga0466972_0059064 Ga0466972_0059064_231_1403 370
51 3300044684 Ga0466966_0054127 Ga0466966_0054127_696_1856 370
52 3300044693 Ga0466961_0006757 Ga0466961_0006757_962_2122 370
53 3300044765 Ga0466970_0003187 Ga0466970_0003187_5311_6471 370
54 3300044842 Ga0466957_0035004 Ga0466957_0035004_1045_2205 370
55 3300045049 Ga0466959_0010735 Ga0466959_0010735_4385_5545 370
56 3300061719 Ga0466962_0008267 Ga0466962_0008267_3065_4225 370
57 iso_pu_bacteria 2919713450 2919718863 370
58 3300005347 Ga0070668_100116087 Ga0070668_1001160872 371
59 3300006038 Ga0075365_10096223 Ga0075365_100962232 371
60 3300025972 Ga0207668_10013500 Ga0207668_100135002 371
61 3300031731 Ga0307405_10002265 Ga0307405_100022654 371
62 3300031901 Ga0307406_10011160 Ga0307406_100111602 371
63 3300032002 Ga0307416_100014337 Ga0307416_1000143371 371
64 3300032126 Ga0307415_100022788 Ga0307415_1000227882 371
65 3300050492 nmdc:mga0yw44_76842_c1 nmdc:mga0yw44_76842_c1_640_1818 371
66 3300005288 Ga0065714_10108910 Ga0065714_101089101 372
67 3300005333 Ga0070677_10013904 Ga0070677_100139042 372
68 3300005353 Ga0070669_100047426 Ga0070669_1000474262 372
69 3300005364 Ga0070673_100169326 Ga0070673_1001693261 372
70 3300005456 Ga0070678_100003890 Ga0070678_1000038903 372
71 3300005456 Ga0070678_100349419 Ga0070678_1003494191 372
72 3300005543 Ga0070672_100099748 Ga0070672_1000997483 372
73 3300005548 Ga0070665_100223140 Ga0070665_1002231401 372
74 3300009036 Ga0105244_10029689 Ga0105244_100296892 372
75 3300013306 Ga0163162_10050972 Ga0163162_100509722 372
76 3300025315 Ga0207697_10035796 Ga0207697_100357961 372
77 3300025728 Ga0207655_1047111 Ga0207655_10471112 372
78 3300025923 Ga0207681_10051375 Ga0207681_100513752 372
79 3300025940 Ga0207691_10000138 Ga0207691_1000013836 372
80 3300026121 Ga0207683_10012765 Ga0207683_100127654 372
81 3300026121 Ga0207683_10377217 Ga0207683_103772171 372
82 3300031852 Ga0307410_10063220 Ga0307410_100632202 372
83 3300031903 Ga0307407_10099337 Ga0307407_100993372 372
84 3300046475 Ga0495639_0069278 Ga0495639_0069278_239_1480 372
85 3300046522 Ga0495643_0074513 Ga0495643_0074513_279_1520 372
86 3300046557 Ga0495622_0017955 Ga0495622_0017955_1119_2360 372
87 3300046674 Ga0495588_0003405 Ga0495588_0003405_2755_3996 372
88 3300048904 Ga0496101_0035796 Ga0496101_0035796_415_1671 372
89 3300048905 Ga0496102_0085127 Ga0496102_0085127_1510_2757 372
90 3300048906 Ga0496103_0049616 Ga0496103_0049616_886_2133 372
91 3300048907 Ga0496104_0178855 Ga0496104_0178855_88_1344 372
92 3300048910 Ga0496107_0131253 Ga0496107_0131253_94_1350 372
93 3300048912 Ga0496109_0112016 Ga0496109_0112016_941_2197 372
94 3300048914 Ga0496111_0148478 Ga0496111_0148478_142_1398 372
95 3300048915 Ga0496112_0035672 Ga0496112_0035672_2302_3558 372
96 3300048916 Ga0496113_0064215 Ga0496113_0064215_987_2243 372
97 3300048917 Ga0496114_0113642 Ga0496114_0113642_725_1981 372
98 3300048928 Ga0496125_0035890 Ga0496125_0035890_1028_2284 372
99 iso_pu_bacteria 2643221692 2644518217 372
100 3300006186 Ga0075369_10094611 Ga0075369_100946111 373
101 3300032004 Ga0307414_10042419 Ga0307414_100424192 373
102 3300042002 Ga0439442_016171 Ga0439442_016171_214_1443 373
103 3300050492 nmdc:mga0yw44_70653_c1 nmdc:mga0yw44_70653_c1_87_1268 373
104 3300053730 Ga0500645_028622 Ga0500645_028622_26_1207 373
105 3300005337 Ga0070682_100020648 Ga0070682_1000206482 374
106 3300005338 Ga0068868_100176108 Ga0068868_1001761082 374
107 3300005366 Ga0070659_100273449 Ga0070659_1002734491 374
108 3300005578 Ga0068854_100100577 Ga0068854_1001005772 374
109 3300006048 Ga0075363_100023603 Ga0075363_1000236033 374
110 3300009098 Ga0105245_10134061 Ga0105245_101340612 374
111 3300010375 Ga0105239_10319078 Ga0105239_103190782 374
112 3300013308 Ga0157375_10256363 Ga0157375_102563631 374
113 3300014745 Ga0157377_10169277 Ga0157377_101692772 374
114 3300025929 Ga0207664_10052555 Ga0207664_100525552 374
115 3300025981 Ga0207640_10123169 Ga0207640_101231692 374
116 3300026023 Ga0207677_10086081 Ga0207677_100860812 374
117 3300048911 Ga0496108_0095187 Ga0496108_0095187_657_1829 374
118 3300048912 Ga0496109_0092574 Ga0496109_0092574_901_2073 374
119 3300048915 Ga0496112_0007714 Ga0496112_0007714_8034_9206 374
120 3300049585 Ga0501069_0066154 Ga0501069_0066154_243_1541 374
121 3300050490 nmdc:mga03n38_6894_c1 nmdc:mga03n38_6894_c1_1673_2845 374
122 iso_pu_bacteria 8004021418 8004022796 374
123 iso_pu_bacteria 2939582691 2939588084 375
124 iso_pu_bacteria 8004025490 8004029474 375
125 3300053104 Ga0500556_0003096 Ga0500556_0003096_3420_4598 376
126 3300053730 Ga0500645_000030 Ga0500645_000030_109598_110794 376
127 iso_pu_bacteria 2738541274 2738708181 376
128 iso_pu_bacteria 2904765812 2904769246 376
129 iso_pu_bacteria 2904770941 2904776306 376
130 iso_pu_bacteria 2908811453 2908814392 376
131 iso_pu_bacteria 2919420072 2919422833 376
132 iso_pu_bacteria 2919432681 2919434914 376
133 3300021358 Ga0213873_10000058 Ga0213873_1000005815 377
134 3300031456 Ga0307513_10238452 Ga0307513_102384521 377
135 3300031548 Ga0307408_100107753 Ga0307408_1001077532 377
136 3300037853 Ga0436364_1406928 Ga0436364_1406928_6628_7809 377
137 3300039453 Ga0436362_0111996 Ga0436362_0111996_14525_15706 377
138 3300044765 Ga0466970_0010987 Ga0466970_0010987_3039_4220 377
139 3300045976 Ga0466967_0000825 Ga0466967_0000825_788_1969 377
140 3300047472 Ga0495686_0012887 Ga0495686_0012887_4172_5383 377
141 3300049581 Ga0501047_0033801 Ga0501047_0033801_3729_4916 377
142 3300049822 Ga0501035_0281761 Ga0501035_0281761_62_1249 377
143 3300049823 Ga0501044_0227009 Ga0501044_0227009_277_1464 377
144 3300037418 Ga0395900_0362707 Ga0395900_0362707_56_1270 380
145 3300048924 Ga0496121_0135340 Ga0496121_0135340_270_1481 380
146 3300053131 Ga0500652_037180 Ga0500652_037180_671_1891 380
147 3300021388 Ga0213875_10005805 Ga0213875_100058056 381
148 3300048909 Ga0496106_0141266 Ga0496106_0141266_565_1800 381
149 iso_pu_bacteria 2537561592 2537897820 382
150 iso_pu_bacteria 2690315906 2691513797 382
151 iso_pu_bacteria 2808606370 2808891119 382
152 iso_pu_bacteria 2919391150 2919395571 382
153 iso_pu_bacteria 2939598168 2939601365 382
154 iso_pu_bacteria 2945920336 2945920605 382
155 iso_pu_bacteria 2945941187 2945943164 382
156 iso_pu_bacteria 2945956166 2945959047 382
157 iso_pu_bacteria 2946037020 2946039084 382
158 iso_pu_bacteria 2953998280 2954000473 382
159 3300031731 Ga0307405_10128367 Ga0307405_101283672 383
160 3300031824 Ga0307413_10190051 Ga0307413_101900511 383
161 3300032002 Ga0307416_100085081 Ga0307416_1000850812 383
162 iso_pu_bacteria 2775506735 2775658052 383
163 iso_pu_bacteria 2808606357 2808831068 383
164 iso_pu_bacteria 2808606360 2808852330 383
165 iso_pu_bacteria 2808606366 2808879384 383
166 iso_pu_bacteria 2808606371 2808896378 383
167 iso_pu_bacteria 2811994871 2812321240 383
168 iso_pu_bacteria 2844849076 2844852667 383
169 iso_pu_bacteria 2857740372 2857742180 383
170 iso_pu_bacteria 2904776348 2904777648 383
171 iso_pu_bacteria 2910809715 2910811595 383
172 iso_pu_bacteria 2919034639 2919035019 383
173 iso_pu_bacteria 2919059106 2919059842 383
174 iso_pu_bacteria 2919538618 2919540476 383
175 iso_pu_bacteria 2932426870 2932428332 383
176 iso_pu_bacteria 2933418574 2933422439 383
177 iso_pu_bacteria 2939647034 2939648736 383
178 iso_pu_bacteria 2939674588 2939675210 383
179 iso_pu_bacteria 2945916053 2945918993 383
180 iso_pu_bacteria 2946059875 2946062850 383
181 iso_pu_bacteria 2974302888 2974306988 383
182 iso_pu_bacteria 8054107350 8054111997 383
183 3300044683 Ga0466965_0040312 Ga0466965_0040312_264_1466 385
184 3300011119 Ga0105246_10040091 Ga0105246_100400912 386
185 3300025315 Ga0207697_10020090 Ga0207697_100200902 386
186 3300025728 Ga0207655_1023262 Ga0207655_10232622 386
187 3300031548 Ga0307408_100026408 Ga0307408_1000264083 386
188 3300031731 Ga0307405_10015791 Ga0307405_100157912 386
189 3300031824 Ga0307413_10075455 Ga0307413_100754552 386
190 3300031903 Ga0307407_10092619 Ga0307407_100926192 386
191 3300031911 Ga0307412_10015778 Ga0307412_100157783 386
192 3300031911 Ga0307412_10115444 Ga0307412_101154441 386
193 3300031995 Ga0307409_100300286 Ga0307409_1003002861 386
194 3300032004 Ga0307414_10158165 Ga0307414_101581652 386
195 3300041404 Ga0439436_0022389 Ga0439436_0022389_476_1711 386
196 3300041405 Ga0439438_001589 Ga0439438_001589_3828_5057 386
197 3300041999 Ga0439433_0000591 Ga0439433_0000591_1254_2483 386
198 3300042002 Ga0439442_000024 Ga0439442_000024_31100_32335 386
199 3300042002 Ga0439442_000939 Ga0439442_000939_2002_3237 386
200 3300042002 Ga0439442_014479 Ga0439442_014479_166_1395 386
201 3300042006 Ga0439432_000885 Ga0439432_000885_7185_8414 386
202 3300042006 Ga0439432_019582 Ga0439432_019582_836_2071 386
203 3300042007 Ga0439449_0060009 Ga0439449_0060009_139_1374 386
204 3300042010 Ga0439452_003080 Ga0439452_003080_4521_5750 386
205 3300042014 Ga0439457_008439 Ga0439457_008439_185_1414 386
206 3300042015 Ga0439462_0000270 Ga0439462_0000270_4682_5911 386
207 3300042122 Ga0450920_002017 Ga0450920_002017_2076_3311 386
208 3300042122 Ga0450920_002244 Ga0450920_002244_1526_2761 386
209 3300042156 Ga0439446_0003097 Ga0439446_0003097_1687_2916 386
210 3300042184 Ga0450908_001486 Ga0450908_001486_386_1615 386
211 3300042435 Ga0439434_0002026 Ga0439434_0002026_3241_4476 386
212 3300042531 Ga0450918_004225 Ga0450918_004225_383_1618 386
213 3300002773 JGI25152J39213_1000124 JGI25152J39213_100012428 387
214 3300009036 Ga0105244_10016573 Ga0105244_100165733 387
215 3300009148 Ga0105243_10026508 Ga0105243_100265082 387
216 3300011119 Ga0105246_10027609 Ga0105246_100276092 387
217 3300011119 Ga0105246_10035070 Ga0105246_100350702 387
218 3300011119 Ga0105246_10038010 Ga0105246_100380103 387
219 3300025254 Ga0209148_1001288 Ga0209148_10012882 387
220 3300025258 Ga0209129_1000067 Ga0209129_100006757 387
221 3300025294 Ga0209025_1000971 Ga0209025_100097117 387
222 3300025728 Ga0207655_1005022 Ga0207655_10050224 387
223 3300031903 Ga0307407_10118116 Ga0307407_101181161 387
224 3300031995 Ga0307409_100078490 Ga0307409_1000784902 387
225 3300032002 Ga0307416_100032310 Ga0307416_1000323103 387
226 3300037312 Ga0395899_0051616 Ga0395899_0051616_1193_2434 387
227 3300037418 Ga0395900_0008951 Ga0395900_0008951_565_1806 387
228 3300037418 Ga0395900_0030495 Ga0395900_0030495_3642_4883 387
229 3300037466 Ga0395898_0030878 Ga0395898_0030878_1414_2628 387
230 3300037466 Ga0395898_0100931 Ga0395898_0100931_601_1842 387
231 3300041404 Ga0439436_0025504 Ga0439436_0025504_123_1400 387
232 3300041411 Ga0439466_0035023 Ga0439466_0035023_378_1655 387
233 3300042002 Ga0439442_001575 Ga0439442_001575_163_1395 387
234 3300042007 Ga0439449_0004598 Ga0439449_0004598_56_1333 387
235 3300042007 Ga0439449_0005221 Ga0439449_0005221_2201_3439 387
236 3300046459 Ga0495629_0114121 Ga0495629_0114121_206_1471 387
237 3300046463 Ga0495653_0077519 Ga0495653_0077519_445_1779 387
238 3300046472 Ga0495580_0001442 Ga0495580_0001442_15697_16917 387
239 3300046476 Ga0495662_0028632 Ga0495662_0028632_347_1681 387
240 3300046528 Ga0495642_0051371 Ga0495642_0051371_361_1668 387
241 3300046531 Ga0495665_0001329 Ga0495665_0001329_4017_5351 387
242 3300046535 Ga0495586_0003057 Ga0495586_0003057_4518_5852 387
243 3300046535 Ga0495586_0004092 Ga0495586_0004092_6452_7717 387
244 3300046535 Ga0495586_0060466 Ga0495586_0060466_385_1770 387
245 3300046536 Ga0495587_0000295 Ga0495587_0000295_13639_14973 387
246 3300046543 Ga0495645_0004137 Ga0495645_0004137_5608_6942 387
247 3300046559 Ga0495667_0004212 Ga0495667_0004212_2972_4306 387
248 3300046615 Ga0495656_0021444 Ga0495656_0021444_1158_2459 387
249 3300046674 Ga0495588_0005125 Ga0495588_0005125_3600_4919 387
250 3300046674 Ga0495588_0009309 Ga0495588_0009309_2935_4200 387
251 3300046675 Ga0495657_0042411 Ga0495657_0042411_1712_3046 387
252 3300046691 Ga0495670_0016447 Ga0495670_0016447_1386_2687 387
253 3300047315 Ga0495581_0004383 Ga0495581_0004383_74_1408 387
254 3300047315 Ga0495581_0009593 Ga0495581_0009593_3361_4626 387
255 3300047318 Ga0495636_0006018 Ga0495636_0006018_2577_3878 387
256 3300047444 Ga0495675_0003818 Ga0495675_0003818_2404_3738 387
257 3300047673 Ga0495593_0054875 Ga0495593_0054875_413_1666 387
258 3300048904 Ga0496101_0138784 Ga0496101_0138784_82_1410 387
259 3300048905 Ga0496102_0099067 Ga0496102_0099067_684_1904 387
260 3300048909 Ga0496106_0073295 Ga0496106_0073295_42_1334 387
261 3300048913 Ga0496110_0036282 Ga0496110_0036282_92_1399 387
262 3300048915 Ga0496112_0005227 Ga0496112_0005227_8141_9361 387
263 3300048917 Ga0496114_0262239 Ga0496114_0262239_194_1483 387
264 3300049569 Ga0501032_0017527 Ga0501032_0017527_1222_2433 387
265 3300049571 Ga0501034_0000016 Ga0501034_0000016_30241_31452 387

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01121

CoaE

Dephospho-CoA kinase

2

180

0.99

PF04229

GrpB

GrpB protein

213

384

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
8u97-assembly1.cif.gz_A crystal structure of dephospho-coa kinase from klebsiella aerogenes (amp-pnp bound) 0.9148 1 202
8u97-assembly1.cif.gz_A crystal structure of dephospho-coa kinase from klebsiella aerogenes (amp-pnp bound) 0.9063 1 202
6n39-assembly1.cif.gz_A crystal structure of an dephospho-coa kinase coae from mycobacterium paratuberculosis 0.8941 2 383
6n39-assembly1.cif.gz_A crystal structure of an dephospho-coa kinase coae from mycobacterium paratuberculosis 0.8809 2 383
1vhl-assembly2.cif.gz_B crystal structure of dephospho-coa kinase with adenosine-5'-diphosphate 0.8559 2 208
ID Description Score Start End Superfamily
af_P9WPA3_1_200_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.896 1 200 3.40.50.300
af_P9WPA3_208_401_3.30.460.10 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.893 209 376 3.30.460.10
af_P9WPA3_1_200_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8919 1 200 3.40.50.300
af_Q4D748_1_97_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8759 111 191 3.40.50.300
af_Q5AK15_1_205_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8642 1 192 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A1I5I0U7-F1-model_v4 Dephospho-CoA kinase (EC 2.7.1.24) (Dephosphocoenzyme A kinase) 0.9601 1 200 GO:0004140
GO:0005524
GO:0005737
GO:0015937
AF-Q9S2K7-F1-model_v4 Dephospho-CoA kinase (EC 2.7.1.24) (Dephosphocoenzyme A kinase) 0.9563 1 198 GO:0004140
GO:0005524
GO:0005737
GO:0015937
AF-A0A646KDM4-F1-model_v4 Dephospho-CoA kinase (EC 2.7.1.24) (Dephosphocoenzyme A kinase) 0.9515 1 199 GO:0004140
GO:0005524
GO:0005737
GO:0015937
AF-A0A1I5I0U7-F1-model_v4 Dephospho-CoA kinase (EC 2.7.1.24) (Dephosphocoenzyme A kinase) 0.9463 1 200 GO:0004140
GO:0005524
GO:0005737
GO:0015937
AF-A0A7K3BR13-F1-model_v4 deleted 0.9439 1 202

Feature Viewer

pLDDT pTM Quality
90.5 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map