F373485

General Info

Members Datasets Scaffolds Average Seq Length
265 170 248 231

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_0947615|Ga0436365_0947615_700_1500
Length 266
Sequence MAGPLKEILNPLDPLARRRFVIRVPAYAGVSGIKSVSAHRPRILVIDDEPQIHRFLAPALEAAGYEPVRADDAAAGLKAIASRPPDAVILDLGLPDMDGQEALERARAFFDGPILILSARDMETEKIAALDLGADDYVEKPFHVGELLARLRVALRHQIARAGAPAAVVRAGDITIDLVKRLVTRAGEPVRLSPREYDLLAKLAEGGGRVITHRQLLTAVWGPANAEDVQYLRVFIGHLRQKLEPDPAAPRHLVTEAGVGYRFVGD

Samples

Sample ID Description Type Environment
1 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
2 2643221609 Acidovorax sp. Root217 Isolate Unclassified
3 2643221611 Acidovorax sp. Root219 Isolate Unclassified
4 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
5 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
6 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
7 2738543012 Acidovorax sp. CF301 Isolate Unclassified
8 2816332133 Acidovorax radicis 2721A Isolate Unclassified
9 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
10 2849560528 Caulobacter zeae 410 Isolate Unclassified
11 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
12 2870801768 Micrococcus endophyticus DSM 17945 Isolate Unclassified
13 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
14 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
15 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
16 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
17 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
18 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
46 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
49 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
70 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
105 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
106 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
107 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
108 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
109 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
110 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
111 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
112 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
114 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
115 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
116 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
117 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
118 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
119 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
120 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
121 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
122 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
123 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
124 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
125 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
126 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
127 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
128 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
129 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
130 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
131 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
132 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
133 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
134 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
135 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
136 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
137 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
138 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
139 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
140 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
141 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
142 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
143 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
144 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
145 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
146 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
147 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
148 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
153 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
156 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
157 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
158 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
159 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
160 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
161 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
162 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
163 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
164 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
165 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
166 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
167 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
168 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
169 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
170 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.58
Metatranscriptomes 0
Isolates 6.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.68
Nodule 0
Rhizoplane 4.15
Rhizosphere 73.58
Stem 0
Stem Tuber 0
Unclassified 13.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10008201 3300003203 Bacteria 4743
2 rootH1_10060304 3300003316 Bacteria 6450
3 rootL2_10060600 3300003322 Bacteria 9327
4 Ga0065165_1000878 3300005262 Bacteria 38888
5 Ga0070658_10011879 3300005327 Bacteria 6992
6 Ga0070658_10103775 3300005327 Bacteria 2351
7 Ga0070658_10147101 3300005327 Bacteria 1971
8 Ga0070658_10280007 3300005327 Bacteria 1419
9 Ga0070658_10528026 3300005327 Bacteria 1021
10 Ga0070670_100000042 3300005331 Bacteria 143266
11 Ga0070680_100005525 3300005336 Bacteria 9568
12 Ga0070680_100024212 3300005336 Bacteria 4846
13 Ga0070660_100018122 3300005339 Bacteria 5138
14 Ga0070660_100274585 3300005339 Bacteria 1378
15 Ga0070668_100000270 3300005347 Bacteria 34249
16 Ga0070671_100041559 3300005355 Bacteria 3822
17 Ga0070671_100054068 3300005355 Bacteria 3337
18 Ga0070659_100000110 3300005366 Bacteria 60436
19 Ga0070659_100058208 3300005366 Bacteria 3049
20 Ga0070659_100768858 3300005366 Bacteria 836
21 Ga0070659_100799110 3300005366 Bacteria 820
22 Ga0070667_100005978 3300005367 Bacteria 10112
23 Ga0070663_100019726 3300005455 Bacteria 4452
24 Ga0070678_100398158 3300005456 Bacteria 1195
25 Ga0070662_100343428 3300005457 Bacteria 1222
26 Ga0070681_10037020 3300005458 Bacteria 4897
27 Ga0070681_10037241 3300005458 Bacteria 4882
28 Ga0070679_100045642 3300005530 Bacteria 4366
29 Ga0070679_100147013 3300005530 Bacteria 2334
30 Ga0070665_100000397 3300005548 Bacteria 64128
31 Ga0070665_100000527 3300005548 Bacteria 53996
32 Ga0070665_100001898 3300005548 Bacteria 23640
33 Ga0070665_100099764 3300005548 Bacteria 2908
34 Ga0068855_100023306 3300005563 Bacteria 7414
35 Ga0068855_100023581 3300005563 Bacteria 7368
36 Ga0068857_100299114 3300005577 Bacteria 1483
37 Ga0068856_100252448 3300005614 Bacteria 1779
38 Ga0068859_100663860 3300005617 Bacteria 1134
39 Ga0068864_100000905 3300005618 Bacteria 24899
40 Ga0068864_100044135 3300005618 Bacteria 3819
41 Ga0068864_100331017 3300005618 Bacteria 1433
42 Ga0068861_100178867 3300005719 Bacteria 1764
43 Ga0068863_100000942 3300005841 Bacteria 29204
44 Ga0068863_100448220 3300005841 Bacteria 1266
45 Ga0068863_100553014 3300005841 Bacteria 1136
46 Ga0068858_100000459 3300005842 Bacteria 42557
47 Ga0068858_100291245 3300005842 Bacteria 1556
48 Ga0068860_100003255 3300005843 Bacteria 16736
49 Ga0068862_100004999 3300005844 Bacteria 11159
50 Ga0081455_10073602 3300005937 Bacteria 2824
51 Ga0081538_10007941 3300005981 Bacteria 9078
52 Ga0081540_1007424 3300005983 Bacteria 7816
53 Ga0081539_10000076 3300005985 Bacteria 229037
54 Ga0081539_10050493 3300005985 Bacteria 2353
55 Ga0075368_10006848 3300006042 Bacteria 4005
56 Ga0075368_10078977 3300006042 Bacteria 1337
57 Ga0075363_100099656 3300006048 Bacteria 1607
58 Ga0075367_10015478 3300006178 Bacteria 4148
59 Ga0075369_10018968 3300006186 Bacteria 2805
60 Ga0075366_10027333 3300006195 Bacteria 3346
61 Ga0075430_100025642 3300006846 Bacteria 5017
62 Ga0068865_100000220 3300006881 Bacteria 31778
63 Ga0097620_100663805 3300006931 Bacteria 1134
64 Ga0105240_10008273 3300009093 Bacteria 14891
65 Ga0105240_10015368 3300009093 Bacteria 10409
66 Ga0105240_10019963 3300009093 Bacteria 8947
67 Ga0105240_10107354 3300009093 Bacteria 3385
68 Ga0105240_10354531 3300009093 Bacteria 1664
69 Ga0105245_10114058 3300009098 Bacteria 2517
70 Ga0105248_10344273 3300009177 Bacteria 1678
71 Ga0105248_11104174 3300009177 Bacteria 896
72 Ga0105237_10529369 3300009545 Bacteria 1185
73 Ga0105238_10034722 3300009551 Bacteria 5130
74 Ga0105238_10790840 3300009551 Bacteria 964
75 Ga0105238_10819107 3300009551 Bacteria 947
76 Ga0105249_10025543 3300009553 Bacteria 5319
77 Ga0105249_10520741 3300009553 Bacteria 1236
78 Ga0157369_10105934 3300013105 Bacteria 2993
79 Ga0163162_10041300 3300013306 Bacteria 4614
80 Ga0163162_10123807 3300013306 Bacteria 2691
81 Ga0163162_10619509 3300013306 Bacteria 1207
82 Ga0163162_11081310 3300013306 Bacteria 908
83 Ga0157372_11025093 3300013307 Bacteria 955
84 Ga0157375_10417484 3300013308 Bacteria 1508
85 Ga0157375_10463144 3300013308 Bacteria 1433
86 Ga0163163_10038233 3300014325 Bacteria 4675
87 Ga0163163_10052226 3300014325 Bacteria 4032
88 Ga0163163_10283306 3300014325 Bacteria 1709
89 Ga0163163_10990153 3300014325 Bacteria 904
90 Ga0157379_10452863 3300014968 Bacteria 1185
91 Ga0157376_10657572 3300014969 Bacteria 1049
92 Ga0209026_1001949 3300025250 Bacteria 8317
93 Ga0209673_1041232 3300025273 Bacteria 1313
94 Ga0209564_1000444 3300025295 Bacteria 71274
95 Ga0207680_10254566 3300025903 Bacteria 1214
96 Ga0207705_10001713 3300025909 Bacteria 17393
97 Ga0207705_10027404 3300025909 Bacteria 4064
98 Ga0207705_10067844 3300025909 Bacteria 2582
99 Ga0207705_10104508 3300025909 Bacteria 2086
100 Ga0207705_10240308 3300025909 Bacteria 1379
101 Ga0207705_10245503 3300025909 Bacteria 1364
102 Ga0207707_10026885 3300025912 Bacteria 5029
103 Ga0207707_10035600 3300025912 Bacteria 4352
104 Ga0207695_10002720 3300025913 Bacteria 25817
105 Ga0207695_10014862 3300025913 Bacteria 9192
106 Ga0207695_10022265 3300025913 Bacteria 7203
107 Ga0207695_10053864 3300025913 Bacteria 4205
108 Ga0207660_10042530 3300025917 Bacteria 3190
109 Ga0207657_10003130 3300025919 Bacteria 17691
110 Ga0207657_10009608 3300025919 Bacteria 9707
111 Ga0207649_10162812 3300025920 Bacteria 1547
112 Ga0207652_10006635 3300025921 Bacteria 9324
113 Ga0207652_10145718 3300025921 Bacteria 2119
114 Ga0207650_10000102 3300025925 Bacteria 111590
115 Ga0207644_10341294 3300025931 Bacteria 1215
116 Ga0207690_10000584 3300025932 Bacteria 23588
117 Ga0207690_10011028 3300025932 Bacteria 5388
118 Ga0207706_10160340 3300025933 Bacteria 1977
119 Ga0207704_10008048 3300025938 Bacteria 5016
120 Ga0207711_10002603 3300025941 Bacteria 16027
121 Ga0207667_10014636 3300025949 Bacteria 8933
122 Ga0207667_10087558 3300025949 Bacteria 3221
123 Ga0207712_10011862 3300025961 Bacteria 5555
124 Ga0207712_10320159 3300025961 Bacteria 1279
125 Ga0207668_10000003 3300025972 Bacteria 206959
126 Ga0207668_10000582 3300025972 Bacteria 22758
127 Ga0207658_10000700 3300025986 Bacteria 29056
128 Ga0207658_10015092 3300025986 Bacteria 5298
129 Ga0207703_10000582 3300026035 Bacteria 37244
130 Ga0207703_10325287 3300026035 Bacteria 1409
131 Ga0207639_10073434 3300026041 Bacteria 2681
132 Ga0207678_10018030 3300026067 Bacteria 6202
133 Ga0207641_10003608 3300026088 Bacteria 13657
134 Ga0207641_10124800 3300026088 Bacteria 2303
135 Ga0207676_10000777 3300026095 Bacteria 24854
136 Ga0207676_10026791 3300026095 Bacteria 4288
137 Ga0207676_10637488 3300026095 Bacteria 1027
138 Ga0207674_10334777 3300026116 Bacteria 1463
139 Ga0207675_100342250 3300026118 Bacteria 1464
140 Ga0209981_1010840 3300027378 Bacteria 1253
141 Ga0210000_1003286 3300027462 Bacteria 2328
142 Ga0209999_1005029 3300027543 Bacteria 2378
143 Ga0209983_1012340 3300027665 Bacteria 1753
144 Ga0268266_10000062 3300028379 Bacteria 253490
145 Ga0268266_10001107 3300028379 Bacteria 33695
146 Ga0268266_10010863 3300028379 Bacteria 7932
147 Ga0268266_10027138 3300028379 Bacteria 4871
148 Ga0268266_10027422 3300028379 Bacteria 4843
149 Ga0268266_10088125 3300028379 Bacteria 2716
150 Ga0268265_10001003 3300028380 Bacteria 25533
151 Ga0268264_10000454 3300028381 Bacteria 55899
152 Ga0307517_10008037 3300028786 Bacteria 15213
153 Ga0265338_10010781 3300028800 Bacteria 10658
154 Ga0307513_10000414 3300031456 Bacteria 61908
155 Ga0307513_10026092 3300031456 Bacteria 6746
156 Ga0307513_10132366 3300031456 Unclassified 2436
157 Ga0307513_10177626 3300031456 Bacteria 1997
158 Ga0307409_100113004 3300031995 Bacteria 2282
159 Ga0307510_10007780 3300033180 Bacteria 12782
160 Ga0307510_10179416 3300033180 Bacteria 1683
161 Ga0373923_0321219 3300035111 Bacteria 735
162 Ga0373946_0185094 3300035171 Bacteria 990
163 Ga0373927_0000947 3300035695 Bacteria 22105
164 Ga0373925_0000760 3300037068 Bacteria 29657
165 Ga0395899_0001203 3300037312 Bacteria 22718
166 Ga0395899_0122374 3300037312 Bacteria 1862
167 Ga0395900_0000004 3300037418 Bacteria 564908
168 Ga0395900_0052842 3300037418 Bacteria 4182
169 Ga0395898_0012910 3300037466 Bacteria 8616
170 Ga0395898_0157886 3300037466 Bacteria 2169
171 Ga0395905_0024131 3300037471 Bacteria 5739
172 Ga0395905_0098227 3300037471 Bacteria 2750
173 Ga0395901_0000005 3300038443 Bacteria 544998
174 Ga0395901_0042790 3300038443 Bacteria 4697
175 Ga0400490_31634 3300038726 Bacteria 1203
176 Ga0400485_04535 3300038735 Bacteria 1125
177 Ga0400485_16825 3300038735 Bacteria 2277
178 Ga0400488_36761 3300038741 Bacteria 2375
179 Ga0400486_04849 3300038742 Bacteria 2550
180 Ga0400486_08443 3300038742 Bacteria 1586
181 Ga0400487_45940 3300039110 Unclassified 1731
182 Ga0436365_0947615 3300039437 Bacteria 2595
183 Ga0436363_0855842 3300039450 Bacteria 881
184 Ga0451577_0000457 3300042876 Bacteria 71078
185 Ga0451577_0011556 3300042876 Bacteria 8344
186 Ga0451577_0039428 3300042876 Bacteria 4245
187 Ga0451577_0062607 3300042876 Bacteria 3318
188 Ga0453683_0046875 3300044673 Bacteria 2709
189 Ga0453683_0105812 3300044673 Bacteria 1768
190 Ga0453684_0000005 3300044712 Bacteria 1431632
191 Ga0453684_0002247 3300044712 Bacteria 47898
192 Ga0453684_0020978 3300044712 Bacteria 9799
193 Ga0453684_0636728 3300044712 Bacteria 1165
194 Ga0451576_0000119 3300045051 Bacteria 200621
195 Ga0451576_0000259 3300045051 Bacteria 129591
196 Ga0451576_0000262 3300045051 Bacteria 128472
197 Ga0451576_0068925 3300045051 Bacteria 3681
198 Ga0495638_0034936 3300046460 Bacteria 3207
199 Ga0495583_0041385 3300046506 Bacteria 2158
200 Ga0495628_0605678 3300046516 Bacteria 782
201 Ga0495648_0202883 3300046524 Bacteria 991
202 Ga0495642_0129016 3300046528 Bacteria 1088
203 Ga0495668_0109444 3300046616 Bacteria 1511
204 Ga0495668_0123645 3300046616 Bacteria 1416
205 Ga0495625_0029278 3300046660 Bacteria 4121
206 Ga0495625_0256570 3300046660 Bacteria 1133
207 Ga0495613_0173030 3300046689 Bacteria 1532
208 Ga0495649_0000538 3300046694 Bacteria 32158
209 Ga0495672_0064327 3300047320 Bacteria 2101
210 Ga0495686_0005126 3300047472 Bacteria 10465
211 Ga0496101_0642365 3300048904 Bacteria 839
212 Ga0496102_0071438 3300048905 Bacteria 3187
213 Ga0496102_0144755 3300048905 Bacteria 2230
214 Ga0496103_0071925 3300048906 Bacteria 2165
215 Ga0496107_0068404 3300048910 Bacteria 2578
216 Ga0496108_0085969 3300048911 Bacteria 2670
217 Ga0496109_0134127 3300048912 Bacteria 2313
218 Ga0496115_0004171 3300048918 Bacteria 10436
219 Ga0496115_0004665 3300048918 Bacteria 9930
220 Ga0496115_0227685 3300048918 Bacteria 1538
221 Ga0496115_0466667 3300048918 Bacteria 1018
222 Ga0496124_0001787 3300048927 Bacteria 29913
223 Ga0501032_0498309 3300049569 Bacteria 778
224 Ga0501038_0112290 3300049574 Bacteria 2256
225 Ga0501043_0077719 3300049579 Bacteria 2607
226 Ga0501047_0042339 3300049581 Bacteria 4401
227 Ga0501081_0230332 3300049743 Bacteria 1349
228 Ga0501035_0019627 3300049822 Bacteria 6211
229 Ga0501035_0072562 3300049822 Bacteria 3046
230 Ga0501044_0060155 3300049823 Bacteria 3890
231 Ga0501044_0106563 3300049823 Bacteria 2815
232 Ga0501045_0582859 3300049824 Bacteria 829
233 nmdc:mga03n38_64406_c1 3300050490 Bacteria 1677
234 nmdc:mga00v17_143260_c1 3300050491 Bacteria 1533
235 nmdc:mga06z11_75646_c1 3300050494 Bacteria 1794
236 nmdc:mga04h51_43573_c1 3300050495 Bacteria 1476
237 nmdc:mga0qj67_64970_c1 3300050509 Bacteria 2904
238 nmdc:mga0sz30_53947_c1 3300050516 Bacteria 1709
239 Ga0500643_007199 3300053087 Bacteria 4540
240 Ga0500562_000422 3300053108 Bacteria 10302
241 Ga0500562_004266 3300053108 Bacteria 3617
242 Ga0500594_0126974 3300053118 Bacteria 805
243 Ga0500608_002821 3300053122 Bacteria 6412
244 Ga0500608_101121 3300053122 Bacteria 1335
245 Ga0500559_0004621 3300053136 Bacteria 6500
246 Ga0500622_0005079 3300053156 Bacteria 8006
247 Ga0500645_001381 3300053730 Bacteria 12405
248 Ga0501082_0284057 3300060353 Bacteria 1441

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049823 Ga0501044_0060155 Ga0501044_0060155_13_561 174
2 3300037471 Ga0395905_0098227 Ga0395905_0098227_12_614 196
3 3300053108 Ga0500562_000422 Ga0500562_000422_3069_3770 200
4 3300042876 Ga0451577_0039428 Ga0451577_0039428_590_1279 206
5 3300044673 Ga0453683_0105812 Ga0453683_0105812_302_991 206
6 3300044712 Ga0453684_0002247 Ga0453684_0002247_25829_26518 206
7 3300045051 Ga0451576_0000259 Ga0451576_0000259_5761_6450 206
8 3300005331 Ga0070670_100000042 Ga0070670_100000042124 213
9 3300005456 Ga0070678_100398158 Ga0070678_1003981582 213
10 3300005548 Ga0070665_100001898 Ga0070665_1000018982 213
11 3300005618 Ga0068864_100000905 Ga0068864_10000090523 213
12 3300005719 Ga0068861_100178867 Ga0068861_1001788672 213
13 3300005841 Ga0068863_100000942 Ga0068863_1000009429 213
14 3300005842 Ga0068858_100000459 Ga0068858_10000045913 213
15 3300005843 Ga0068860_100003255 Ga0068860_10000325512 213
16 3300005844 Ga0068862_100004999 Ga0068862_1000049992 213
17 3300005985 Ga0081539_10050493 Ga0081539_100504933 213
18 3300009553 Ga0105249_10025543 Ga0105249_100255433 213
19 3300013306 Ga0163162_10123807 Ga0163162_101238072 213
20 3300014325 Ga0163163_10038233 Ga0163163_100382333 213
21 3300025925 Ga0207650_10000102 Ga0207650_1000010273 213
22 3300025961 Ga0207712_10011862 Ga0207712_100118624 213
23 3300025972 Ga0207668_10000582 Ga0207668_100005822 213
24 3300025986 Ga0207658_10000700 Ga0207658_1000070023 213
25 3300026035 Ga0207703_10000582 Ga0207703_1000058214 213
26 3300026088 Ga0207641_10003608 Ga0207641_100036085 213
27 3300026095 Ga0207676_10000777 Ga0207676_1000077723 213
28 3300026118 Ga0207675_100342250 Ga0207675_1003422502 213
29 3300028379 Ga0268266_10027138 Ga0268266_100271384 213
30 3300028380 Ga0268265_10001003 Ga0268265_1000100323 213
31 3300028381 Ga0268264_10000454 Ga0268264_1000045427 213
32 3300048905 Ga0496102_0071438 Ga0496102_0071438_899_1606 213
33 3300048906 Ga0496103_0071925 Ga0496103_0071925_630_1337 213
34 iso_pu_bacteria 2894817345 2894821367 217
35 3300049569 Ga0501032_0498309 Ga0501032_0498309_34_717 219
36 3300049574 Ga0501038_0112290 Ga0501038_0112290_1441_2124 219
37 3300049579 Ga0501043_0077719 Ga0501043_0077719_129_812 219
38 3300049581 Ga0501047_0042339 Ga0501047_0042339_3593_4276 219
39 3300049822 Ga0501035_0019627 Ga0501035_0019627_4873_5556 219
40 3300049824 Ga0501045_0582859 Ga0501045_0582859_46_729 219
41 3300053122 Ga0500608_101121 Ga0500608_101121_433_1104 219
42 iso_pu_bacteria 2870801768 2870803377 219
43 3300009551 Ga0105238_10034722 Ga0105238_100347223 220
44 3300035111 Ga0373923_0321219 Ga0373923_0321219_18_698 220
45 3300042876 Ga0451577_0011556 Ga0451577_0011556_6592_7299 220
46 3300005327 Ga0070658_10011879 Ga0070658_100118795 221
47 3300009098 Ga0105245_10114058 Ga0105245_101140583 221
48 3300025909 Ga0207705_10027404 Ga0207705_100274043 221
49 3300060353 Ga0501082_0284057 Ga0501082_0284057_289_972 221
50 iso_pu_bacteria 2643221614 2644087725 221
51 iso_pu_bacteria 2643221661 2644344232 221
52 iso_pu_bacteria 2643221666 2644367083 221
53 3300005327 Ga0070658_10103775 Ga0070658_101037753 222
54 3300006042 Ga0075368_10078977 Ga0075368_100789772 222
55 3300013105 Ga0157369_10105934 Ga0157369_101059342 222
56 3300025909 Ga0207705_10104508 Ga0207705_101045082 222
57 3300049822 Ga0501035_0072562 Ga0501035_0072562_417_1103 222
58 3300049823 Ga0501044_0106563 Ga0501044_0106563_965_1651 222
59 3300050495 nmdc:mga04h51_43573_c1 nmdc:mga04h51_43573_c1_185_877 222
60 3300005577 Ga0068857_100299114 Ga0068857_1002991142 223
61 3300005842 Ga0068858_100291245 Ga0068858_1002912452 223
62 3300006186 Ga0075369_10018968 Ga0075369_100189682 223
63 3300009093 Ga0105240_10019963 Ga0105240_100199631 223
64 3300014968 Ga0157379_10452863 Ga0157379_104528631 223
65 3300025250 Ga0209026_1001949 Ga0209026_10019492 223
66 3300025903 Ga0207680_10254566 Ga0207680_102545661 223
67 3300025913 Ga0207695_10014862 Ga0207695_100148624 223
68 3300026035 Ga0207703_10325287 Ga0207703_103252871 223
69 3300026116 Ga0207674_10334777 Ga0207674_103347772 223
70 3300046460 Ga0495638_0034936 Ga0495638_0034936_2006_2698 223
71 3300046694 Ga0495649_0000538 Ga0495649_0000538_30596_31288 223
72 3300047472 Ga0495686_0005126 Ga0495686_0005126_3492_4181 223
73 3300048918 Ga0496115_0466667 Ga0496115_0466667_194_889 223
74 3300048927 Ga0496124_0001787 Ga0496124_0001787_15277_15972 223
75 3300049743 Ga0501081_0230332 Ga0501081_0230332_622_1308 223
76 3300050516 nmdc:mga0sz30_53947_c1 nmdc:mga0sz30_53947_c1_126_821 223
77 3300053122 Ga0500608_002821 Ga0500608_002821_1099_1794 223
78 3300053136 Ga0500559_0004621 Ga0500559_0004621_2335_3030 223
79 3300053156 Ga0500622_0005079 Ga0500622_0005079_5870_6565 223
80 3300053730 Ga0500645_001381 Ga0500645_001381_11616_12305 223
81 iso_pu_bacteria 2643221598 2644001045 223
82 iso_pu_bacteria 2643221609 2644062717 223
83 iso_pu_bacteria 2643221611 2644076269 223
84 iso_pu_bacteria 2738543012 2739244603 223
85 iso_pu_bacteria 2816332133 2816475193 223
86 iso_pu_bacteria 2849560528 2849565154 223
87 3300005455 Ga0070663_100019726 Ga0070663_1000197265 224
88 3300005548 Ga0070665_100099764 Ga0070665_1000997643 224
89 3300005937 Ga0081455_10073602 Ga0081455_100736023 224
90 3300005981 Ga0081538_10007941 Ga0081538_100079415 224
91 3300006846 Ga0075430_100025642 Ga0075430_1000256421 224
92 3300009545 Ga0105237_10529369 Ga0105237_105293691 224
93 3300013307 Ga0157372_11025093 Ga0157372_110250932 224
94 3300026067 Ga0207678_10018030 Ga0207678_100180303 224
95 3300028379 Ga0268266_10010863 Ga0268266_100108633 224
96 3300037312 Ga0395899_0001203 Ga0395899_0001203_11577_12266 224
97 3300037418 Ga0395900_0000004 Ga0395900_0000004_449721_450410 224
98 3300037466 Ga0395898_0012910 Ga0395898_0012910_245_934 224
99 3300037471 Ga0395905_0024131 Ga0395905_0024131_129_818 224
100 3300038443 Ga0395901_0000005 Ga0395901_0000005_115157_115846 224
101 3300038726 Ga0400490_31634 Ga0400490_31634_186_875 224
102 3300038735 Ga0400485_04535 Ga0400485_04535_231_920 224
103 3300038735 Ga0400485_16825 Ga0400485_16825_963_1652 224
104 3300038741 Ga0400488_36761 Ga0400488_36761_1477_2166 224
105 3300038742 Ga0400486_04849 Ga0400486_04849_51_740 224
106 3300038742 Ga0400486_08443 Ga0400486_08443_75_764 224
107 3300039110 Ga0400487_45940 Ga0400487_45940_944_1633 224
108 3300039437 Ga0436365_0947615 Ga0436365_0947615_700_1500 224
109 3300039450 Ga0436363_0855842 Ga0436363_0855842_123_815 224
110 3300048910 Ga0496107_0068404 Ga0496107_0068404_395_1084 224
111 3300050509 nmdc:mga0qj67_64970_c1 nmdc:mga0qj67_64970_c1_121_807 224
112 iso_pu_bacteria 2929199973 2929200931 224
113 iso_pu_bacteria 8055909800 8055911674 224
114 3300003316 rootH1_10060304 rootH1_100603045 225
115 3300003322 rootL2_10060600 rootL2_100606007 225
116 3300005262 Ga0065165_1000878 Ga0065165_100087833 225
117 3300005327 Ga0070658_10280007 Ga0070658_102800071 225
118 3300005327 Ga0070658_10528026 Ga0070658_105280261 225
119 3300005336 Ga0070680_100005525 Ga0070680_1000055254 225
120 3300005336 Ga0070680_100024212 Ga0070680_1000242122 225
121 3300005339 Ga0070660_100018122 Ga0070660_1000181224 225
122 3300005339 Ga0070660_100274585 Ga0070660_1002745852 225
123 3300005347 Ga0070668_100000270 Ga0070668_1000002703 225
124 3300005355 Ga0070671_100041559 Ga0070671_1000415592 225
125 3300005355 Ga0070671_100054068 Ga0070671_1000540682 225
126 3300005366 Ga0070659_100000110 Ga0070659_10000011012 225
127 3300005366 Ga0070659_100058208 Ga0070659_1000582081 225
128 3300005366 Ga0070659_100768858 Ga0070659_1007688581 225
129 3300005366 Ga0070659_100799110 Ga0070659_1007991101 225
130 3300005367 Ga0070667_100005978 Ga0070667_1000059788 225
131 3300005457 Ga0070662_100343428 Ga0070662_1003434282 225
132 3300005458 Ga0070681_10037020 Ga0070681_100370203 225
133 3300005458 Ga0070681_10037241 Ga0070681_100372413 225
134 3300005530 Ga0070679_100045642 Ga0070679_1000456422 225
135 3300005530 Ga0070679_100147013 Ga0070679_1001470132 225
136 3300005548 Ga0070665_100000397 Ga0070665_10000039757 225
137 3300005548 Ga0070665_100000527 Ga0070665_10000052735 225
138 3300005563 Ga0068855_100023306 Ga0068855_1000233062 225
139 3300005563 Ga0068855_100023581 Ga0068855_1000235813 225
140 3300005614 Ga0068856_100252448 Ga0068856_1002524482 225
141 3300005617 Ga0068859_100663860 Ga0068859_1006638601 225
142 3300005618 Ga0068864_100044135 Ga0068864_1000441352 225
143 3300005618 Ga0068864_100331017 Ga0068864_1003310172 225
144 3300005841 Ga0068863_100448220 Ga0068863_1004482202 225
145 3300005841 Ga0068863_100553014 Ga0068863_1005530142 225
146 3300005983 Ga0081540_1007424 Ga0081540_10074243 225
147 3300006042 Ga0075368_10006848 Ga0075368_100068481 225
148 3300006048 Ga0075363_100099656 Ga0075363_1000996562 225
149 3300006178 Ga0075367_10015478 Ga0075367_100154783 225
150 3300006195 Ga0075366_10027333 Ga0075366_100273332 225
151 3300006881 Ga0068865_100000220 Ga0068865_10000022027 225
152 3300006931 Ga0097620_100663805 Ga0097620_1006638051 225
153 3300009093 Ga0105240_10008273 Ga0105240_100082733 225
154 3300009093 Ga0105240_10015368 Ga0105240_100153686 225
155 3300009093 Ga0105240_10107354 Ga0105240_101073543 225
156 3300009093 Ga0105240_10354531 Ga0105240_103545311 225
157 3300009177 Ga0105248_10344273 Ga0105248_103442732 225
158 3300009177 Ga0105248_11104174 Ga0105248_111041741 225
159 3300009551 Ga0105238_10790840 Ga0105238_107908402 225
160 3300009551 Ga0105238_10819107 Ga0105238_108191072 225
161 3300009553 Ga0105249_10520741 Ga0105249_105207412 225
162 3300013306 Ga0163162_10041300 Ga0163162_100413002 225
163 3300013306 Ga0163162_10619509 Ga0163162_106195092 225
164 3300013306 Ga0163162_11081310 Ga0163162_110813102 225
165 3300013308 Ga0157375_10417484 Ga0157375_104174841 225
166 3300013308 Ga0157375_10463144 Ga0157375_104631442 225
167 3300014325 Ga0163163_10052226 Ga0163163_100522265 225
168 3300014325 Ga0163163_10283306 Ga0163163_102833063 225
169 3300014325 Ga0163163_10990153 Ga0163163_109901532 225
170 3300014969 Ga0157376_10657572 Ga0157376_106575722 225
171 3300025273 Ga0209673_1041232 Ga0209673_10412322 225
172 3300025295 Ga0209564_1000444 Ga0209564_100044421 225
173 3300025909 Ga0207705_10001713 Ga0207705_100017139 225
174 3300025909 Ga0207705_10067844 Ga0207705_100678442 225
175 3300025909 Ga0207705_10240308 Ga0207705_102403082 225
176 3300025909 Ga0207705_10245503 Ga0207705_102455032 225
177 3300025912 Ga0207707_10026885 Ga0207707_100268852 225
178 3300025912 Ga0207707_10035600 Ga0207707_100356002 225
179 3300025913 Ga0207695_10002720 Ga0207695_1000272017 225
180 3300025913 Ga0207695_10022265 Ga0207695_100222655 225
181 3300025913 Ga0207695_10053864 Ga0207695_100538642 225
182 3300025917 Ga0207660_10042530 Ga0207660_100425302 225
183 3300025919 Ga0207657_10003130 Ga0207657_1000313015 225
184 3300025919 Ga0207657_10009608 Ga0207657_100096087 225
185 3300025920 Ga0207649_10162812 Ga0207649_101628122 225
186 3300025921 Ga0207652_10006635 Ga0207652_100066353 225
187 3300025921 Ga0207652_10145718 Ga0207652_101457182 225
188 3300025931 Ga0207644_10341294 Ga0207644_103412941 225
189 3300025932 Ga0207690_10000584 Ga0207690_1000058411 225
190 3300025932 Ga0207690_10011028 Ga0207690_100110283 225
191 3300025933 Ga0207706_10160340 Ga0207706_101603401 225
192 3300025938 Ga0207704_10008048 Ga0207704_100080482 225
193 3300025941 Ga0207711_10002603 Ga0207711_100026039 225
194 3300025949 Ga0207667_10014636 Ga0207667_100146366 225
195 3300025949 Ga0207667_10087558 Ga0207667_100875583 225
196 3300025961 Ga0207712_10320159 Ga0207712_103201592 225
197 3300025972 Ga0207668_10000003 Ga0207668_10000003175 225
198 3300025986 Ga0207658_10015092 Ga0207658_100150922 225
199 3300026041 Ga0207639_10073434 Ga0207639_100734342 225
200 3300026088 Ga0207641_10124800 Ga0207641_101248002 225
201 3300026095 Ga0207676_10026791 Ga0207676_100267913 225
202 3300027378 Ga0209981_1010840 Ga0209981_10108402 225
203 3300027462 Ga0210000_1003286 Ga0210000_10032862 225
204 3300027543 Ga0209999_1005029 Ga0209999_10050292 225
205 3300027665 Ga0209983_1012340 Ga0209983_10123402 225
206 3300028379 Ga0268266_10000062 Ga0268266_10000062130 225
207 3300028379 Ga0268266_10001107 Ga0268266_1000110724 225
208 3300028379 Ga0268266_10027422 Ga0268266_100274223 225
209 3300028379 Ga0268266_10088125 Ga0268266_100881251 225
210 3300028786 Ga0307517_10008037 Ga0307517_1000803715 225
211 3300028800 Ga0265338_10010781 Ga0265338_100107813 225
212 3300031456 Ga0307513_10000414 Ga0307513_1000041413 225
213 3300031456 Ga0307513_10026092 Ga0307513_100260925 225
214 3300031456 Ga0307513_10132366 Ga0307513_101323662 225
215 3300031456 Ga0307513_10177626 Ga0307513_101776261 225
216 3300031995 Ga0307409_100113004 Ga0307409_1001130041 225
217 3300033180 Ga0307510_10007780 Ga0307510_100077807 225
218 3300033180 Ga0307510_10179416 Ga0307510_101794162 225
219 3300035171 Ga0373946_0185094 Ga0373946_0185094_94_840 225
220 3300035695 Ga0373927_0000947 Ga0373927_0000947_11933_12679 225
221 3300037068 Ga0373925_0000760 Ga0373925_0000760_17675_18421 225
222 3300037312 Ga0395899_0122374 Ga0395899_0122374_828_1538 225
223 3300037418 Ga0395900_0052842 Ga0395900_0052842_377_1087 225
224 3300037466 Ga0395898_0157886 Ga0395898_0157886_1327_2037 225
225 3300038443 Ga0395901_0042790 Ga0395901_0042790_914_1624 225
226 3300042876 Ga0451577_0000457 Ga0451577_0000457_23148_23837 225
227 3300042876 Ga0451577_0062607 Ga0451577_0062607_924_1622 225
228 3300044673 Ga0453683_0046875 Ga0453683_0046875_243_941 225
229 3300044712 Ga0453684_0000005 Ga0453684_0000005_52614_53303 225
230 3300044712 Ga0453684_0636728 Ga0453684_0636728_248_946 225
231 3300045051 Ga0451576_0000119 Ga0451576_0000119_97164_97862 225
232 3300045051 Ga0451576_0068925 Ga0451576_0068925_1296_1994 225
233 3300046506 Ga0495583_0041385 Ga0495583_0041385_827_1528 225
234 3300046516 Ga0495628_0605678 Ga0495628_0605678_63_758 225
235 3300046524 Ga0495648_0202883 Ga0495648_0202883_73_771 225
236 3300046528 Ga0495642_0129016 Ga0495642_0129016_211_921 225
237 3300046616 Ga0495668_0109444 Ga0495668_0109444_573_1274 225
238 3300046616 Ga0495668_0123645 Ga0495668_0123645_278_976 225
239 3300046660 Ga0495625_0029278 Ga0495625_0029278_1293_2033 225
240 3300046660 Ga0495625_0256570 Ga0495625_0256570_100_801 225
241 3300046689 Ga0495613_0173030 Ga0495613_0173030_562_1266 225
242 3300047320 Ga0495672_0064327 Ga0495672_0064327_700_1398 225
243 3300048904 Ga0496101_0642365 Ga0496101_0642365_13_714 225
244 3300048905 Ga0496102_0144755 Ga0496102_0144755_626_1327 225
245 3300048911 Ga0496108_0085969 Ga0496108_0085969_855_1556 225
246 3300048912 Ga0496109_0134127 Ga0496109_0134127_377_1078 225
247 3300048918 Ga0496115_0004171 Ga0496115_0004171_9220_9915 225
248 3300048918 Ga0496115_0004665 Ga0496115_0004665_3156_3869 225
249 3300048918 Ga0496115_0227685 Ga0496115_0227685_685_1380 225
250 3300050490 nmdc:mga03n38_64406_c1 nmdc:mga03n38_64406_c1_385_1080 225
251 3300050491 nmdc:mga00v17_143260_c1 nmdc:mga00v17_143260_c1_287_982 225
252 3300050494 nmdc:mga06z11_75646_c1 nmdc:mga06z11_75646_c1_769_1464 225
253 3300053087 Ga0500643_007199 Ga0500643_007199_2669_3373 225
254 3300053108 Ga0500562_004266 Ga0500562_004266_2230_2925 225
255 3300053118 Ga0500594_0126974 Ga0500594_0126974_26_763 225
256 3300005327 Ga0070658_10147101 Ga0070658_101471012 226
257 3300044712 Ga0453684_0020978 Ga0453684_0020978_4354_5049 226
258 iso_pu_bacteria 2842775625 2842780297 226
259 iso_pu_bacteria 2870068957 2870076877 226
260 3300026095 Ga0207676_10637488 Ga0207676_106374882 227
261 iso_pu_bacteria 2870068957 2870077076 228
262 iso_pu_bacteria 2894772417 2894776007 230
263 3300003203 JGI25406J46586_10008201 JGI25406J46586_100082011 231
264 3300005985 Ga0081539_10000076 Ga0081539_100000761 231
265 3300045051 Ga0451576_0000262 Ga0451576_0000262_79375_80091 231

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00486

Trans_reg_C

Transcriptional regulatory protein, C terminal

187

263

0.99

PF00072

Response_reg

Response regulator receiver domain

43

152

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zh4-assembly1.cif.gz_A crystal structure of the mg+2/bef3-bound receiver domain of kdp potassium transport system response regulator kdpe 0.9857 7 124
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.9843 6 124
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.9802 7 122
1nxx-assembly1.cif.gz_A-2 micarec ph 5.5 0.9795 7 122
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.979 7 122
ID Description Score Start End Superfamily
af_P9WGN1_2_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.989 7 84 3.40.50.2300
af_P21866_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9868 6 84 3.40.50.2300
af_Q06065_2_134_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9807 5 124 3.40.50.2300
af_Q2FWH6_1_124_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9777 5 124 3.40.50.2300
5hm6B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9718 5 122 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A3B8YBM5-F1-model_v4 deleted 0.986 5 125
AF-A0A7X7W0G5-F1-model_v4 Stage 0 sporulation protein A homolog 0.9851 5 124 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A2N2ZAQ2-F1-model_v4 Response regulatory domain-containing protein 0.9841 5 124 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-X1MWU9-F1-model_v4 Response regulatory domain-containing protein 0.9838 5 124 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A7K0D7I6-F1-model_v4 Regulator of RpoS 0.9823 5 123 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993

Feature Viewer

pLDDT pTM Quality
89.46 0.57 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map