F373462

General Info

Members Datasets Scaffolds Average Seq Length
265 183 261 200

Family's Representative Sequence

Representative Sequence 3300035691|Ga0373931_0186558|Ga0373931_0186558_375_1037
Length 220
Sequence MQPHAAAAALARPASKHGAIMNDTVRPVIPDAALDRLFRTARSFNDFTPAPVTDAELRALYEIAKWGPTTANSQPQRIVFVRSAEAKERLKPALSGANQRKVMGAPVVAILAYDMRFYEHLPRLFHNPQARSWYETTPEHIRTTALRNATLQGAYLMLAARAIGLDCGPMSGFKNDVVDAAFFPDGRFKSNFLCCLGHGDPSTLPPHDYRFSFDEACQIV

Samples

Sample ID Description Type Environment
1 2511231008 Pseudomonas sp. GM21 Isolate Nodule
2 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
3 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
4 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
8 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
12 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
13 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
14 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
71 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
72 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
74 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
75 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
77 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
78 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
107 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
111 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
112 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
113 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
114 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
115 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
116 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
117 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
118 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
119 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
120 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
121 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
122 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
123 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
124 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
125 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
126 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
127 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
128 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
129 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
130 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
131 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
132 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
133 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
134 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
135 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
136 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
137 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
138 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
139 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
140 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
141 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
142 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
143 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
144 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
145 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
146 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
159 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
160 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
161 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
162 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
163 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
164 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
165 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
166 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
167 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
168 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
169 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
170 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
171 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
172 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
173 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
174 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
175 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
176 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
177 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
178 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
179 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
180 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
181 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
182 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
183 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.49
Metatranscriptomes 0
Isolates 1.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.19
Nodule 0.38
Rhizoplane 0.75
Rhizosphere 85.28
Stem 0
Stem Tuber 0
Unclassified 3.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000239 3300002737 Bacteria 54751
2 JGI25157J39369_1000293 3300002741 Bacteria 36433
3 JGI25163J39215_1001211 3300002771 Bacteria 4862
4 JGI25164J39214_1000200 3300002772 Bacteria 50877
5 JGI25165J46597_1000319 3300003214 Bacteria 57885
6 rootH2_10060382 3300003320 Bacteria 14607
7 Ga0055538_1000592 3300003751 Bacteria 12098
8 Ga0055535_1000242 3300003761 Bacteria 57885
9 Ga0055542_1000298 3300003762 Bacteria 55290
10 Ga0055529_1000437 3300003763 Bacteria 41881
11 Ga0070658_10025099 3300005327 Bacteria 4778
12 Ga0070658_10027117 3300005327 Bacteria 4599
13 Ga0070658_10148448 3300005327 Bacteria 1962
14 Ga0070658_10157777 3300005327 Bacteria 1902
15 Ga0070658_10787594 3300005327 Bacteria 826
16 Ga0070658_10873637 3300005327 Bacteria 782
17 Ga0070683_100026580 3300005329 Bacteria 5214
18 Ga0070670_100266882 3300005331 Bacteria 1493
19 Ga0070680_100008159 3300005336 Bacteria 8001
20 Ga0070680_100010175 3300005336 Bacteria 7253
21 Ga0070682_100011843 3300005337 Bacteria 4988
22 Ga0070660_100002774 3300005339 Bacteria 12030
23 Ga0070660_100265217 3300005339 Bacteria 1403
24 Ga0070660_100369631 3300005339 Bacteria 1183
25 Ga0070660_100518217 3300005339 Bacteria 993
26 Ga0070660_100718941 3300005339 Bacteria 838
27 Ga0070687_100302838 3300005343 Bacteria 1015
28 Ga0070661_100001360 3300005344 Bacteria 17080
29 Ga0070668_100273204 3300005347 Bacteria 1409
30 Ga0070668_100521487 3300005347 Bacteria 1031
31 Ga0070675_100228962 3300005354 Bacteria 1621
32 Ga0070674_100036567 3300005356 Bacteria 3297
33 Ga0070674_100924392 3300005356 Bacteria 761
34 Ga0070659_100049170 3300005366 Bacteria 3315
35 Ga0070659_100137843 3300005366 Bacteria 1985
36 Ga0070659_100539748 3300005366 Bacteria 997
37 Ga0070714_100233568 3300005435 Bacteria 1695
38 Ga0070708_100075183 3300005445 Bacteria 3048
39 Ga0070708_100814663 3300005445 Unclassified 877
40 Ga0070678_100125879 3300005456 Bacteria 2028
41 Ga0070662_100000942 3300005457 Bacteria 17780
42 Ga0070662_100010012 3300005457 Bacteria 6208
43 Ga0070662_100077177 3300005457 Bacteria 2472
44 Ga0070662_100415428 3300005457 Bacteria 1112
45 Ga0070681_10009566 3300005458 Bacteria 9535
46 Ga0070681_10055049 3300005458 Bacteria 3963
47 Ga0070681_10727953 3300005458 Bacteria 908
48 Ga0070681_10889022 3300005458 Bacteria 809
49 Ga0068867_100750439 3300005459 Bacteria 866
50 Ga0070685_10123259 3300005466 Bacteria 1612
51 Ga0070706_100092514 3300005467 Bacteria 2805
52 Ga0070679_100045759 3300005530 Bacteria 4360
53 Ga0070679_100096165 3300005530 Bacteria 2949
54 Ga0070679_100117267 3300005530 Bacteria 2647
55 Ga0070679_100903297 3300005530 Bacteria 827
56 Ga0070697_100049318 3300005536 Unclassified 3417
57 Ga0070697_100717570 3300005536 Unclassified 882
58 Ga0068853_100000508 3300005539 Bacteria 26343
59 Ga0068853_100711377 3300005539 Bacteria 958
60 Ga0070672_100035464 3300005543 Bacteria 3792
61 Ga0070693_100462331 3300005547 Bacteria 893
62 Ga0068855_100002675 3300005563 Bacteria 21961
63 Ga0068855_100004449 3300005563 Bacteria 17123
64 Ga0068855_100014465 3300005563 Bacteria 9502
65 Ga0070664_100002777 3300005564 Bacteria 14127
66 Ga0070664_100396100 3300005564 Bacteria 1262
67 Ga0068857_100122433 3300005577 Bacteria 2343
68 Ga0068857_100174551 3300005577 Bacteria 1954
69 Ga0068854_100037407 3300005578 Bacteria 3407
70 Ga0068856_100112944 3300005614 Bacteria 2715
71 Ga0068861_100476002 3300005719 Bacteria 1124
72 Ga0068863_100343498 3300005841 Unclassified 1452
73 Ga0068860_100017668 3300005843 Bacteria 6949
74 Ga0075362_10034434 3300006177 Bacteria 2208
75 Ga0075366_10015772 3300006195 Bacteria 4337
76 Ga0068871_100226407 3300006358 Bacteria 1622
77 Ga0075428_100384850 3300006844 Bacteria 1504
78 Ga0075431_100812556 3300006847 Bacteria 908
79 Ga0105240_10359942 3300009093 Bacteria 1648
80 Ga0111539_11123749 3300009094 Bacteria 913
81 Ga0105245_10335499 3300009098 Bacteria 1494
82 Ga0105245_10801731 3300009098 Bacteria 980
83 Ga0114129_10337981 3300009147 Bacteria 1998
84 Ga0114129_10393678 3300009147 Bacteria 1827
85 Ga0105246_10000302 3300011119 Bacteria 26080
86 Ga0157373_10002751 3300013100 Bacteria 13318
87 Ga0157373_10005489 3300013100 Bacteria 9518
88 Ga0157371_10002035 3300013102 Bacteria 19932
89 Ga0157371_10019109 3300013102 Bacteria 5059
90 Ga0157370_10001275 3300013104 Bacteria 31520
91 Ga0157369_10002907 3300013105 Bacteria 20471
92 Ga0157378_10905970 3300013297 Bacteria 913
93 Ga0157378_11587282 3300013297 Bacteria 700
94 Ga0163162_10198272 3300013306 Bacteria 2136
95 Ga0157372_10001844 3300013307 Bacteria 22969
96 Ga0157372_10433216 3300013307 Bacteria 1533
97 Ga0163163_10873979 3300014325 Unclassified 962
98 Ga0157380_10258120 3300014326 Bacteria 1581
99 Ga0157380_10654521 3300014326 Bacteria 1048
100 Ga0157380_11280199 3300014326 Unclassified 780
101 Ga0163161_10870953 3300017792 Bacteria 761
102 Ga0209784_100163 3300025224 Bacteria 57927
103 Ga0209672_103203 3300025228 Bacteria 3492
104 Ga0207427_100196 3300025231 Bacteria 57937
105 Ga0209437_100345 3300025233 Bacteria 54531
106 Ga0209258_100384 3300025242 Bacteria 56539
107 Ga0209646_1000786 3300025246 Bacteria 10918
108 Ga0209026_1000286 3300025250 Bacteria 57937
109 Ga0209148_1000047 3300025254 Bacteria 434369
110 Ga0209759_1000651 3300025256 Bacteria 32313
111 Ga0209233_1000100 3300025261 Bacteria 293905
112 Ga0209455_1000270 3300025272 Bacteria 57937
113 Ga0207697_10166742 3300025315 Bacteria 962
114 Ga0207705_10004463 3300025909 Bacteria 10570
115 Ga0207705_10005744 3300025909 Bacteria 9259
116 Ga0207705_10027709 3300025909 Bacteria 4041
117 Ga0207705_10763738 3300025909 Bacteria 751
118 Ga0207684_10542972 3300025910 Bacteria 995
119 Ga0207707_10014673 3300025912 Bacteria 6827
120 Ga0207707_10079341 3300025912 Bacteria 2866
121 Ga0207695_10379369 3300025913 Bacteria 1299
122 Ga0207660_10008332 3300025917 Bacteria 6702
123 Ga0207657_10000124 3300025919 Bacteria 77147
124 Ga0207657_10075800 3300025919 Bacteria 2838
125 Ga0207657_10143670 3300025919 Bacteria 1948
126 Ga0207649_10011021 3300025920 Bacteria 4974
127 Ga0207652_10002025 3300025921 Bacteria 17479
128 Ga0207652_10014883 3300025921 Bacteria 6307
129 Ga0207652_10039714 3300025921 Bacteria 3994
130 Ga0207652_10249388 3300025921 Bacteria 1601
131 Ga0207652_10322964 3300025921 Bacteria 1393
132 Ga0207664_10206837 3300025929 Bacteria 1697
133 Ga0207690_10000924 3300025932 Bacteria 18761
134 Ga0207690_10125336 3300025932 Bacteria 1872
135 Ga0207706_10000160 3300025933 Bacteria 75222
136 Ga0207706_10010885 3300025933 Bacteria 8299
137 Ga0207706_10412423 3300025933 Bacteria 1170
138 Ga0207669_10049404 3300025937 Bacteria 2507
139 Ga0207661_10107630 3300025944 Bacteria 2352
140 Ga0207679_10546880 3300025945 Bacteria 1038
141 Ga0207667_10014608 3300025949 Bacteria 8942
142 Ga0207667_10049873 3300025949 Bacteria 4419
143 Ga0207667_11021944 3300025949 Bacteria 813
144 Ga0207668_10403120 3300025972 Bacteria 1157
145 Ga0207668_10608547 3300025972 Bacteria 952
146 Ga0207640_10035773 3300025981 Bacteria 3111
147 Ga0207639_10000426 3300026041 Bacteria 29198
148 Ga0207639_10007827 3300026041 Bacteria 7298
149 Ga0207678_10062092 3300026067 Bacteria 3213
150 Ga0207678_10473593 3300026067 Bacteria 1090
151 Ga0207678_10977375 3300026067 Bacteria 749
152 Ga0207708_10349355 3300026075 Bacteria 1213
153 Ga0207708_10810289 3300026075 Bacteria 806
154 Ga0207702_10379948 3300026078 Bacteria 1358
155 Ga0207648_11248193 3300026089 Bacteria 698
156 Ga0207676_10984903 3300026095 Bacteria 830
157 Ga0207674_10032601 3300026116 Bacteria 5463
158 Ga0207674_10135484 3300026116 Bacteria 2425
159 Ga0207674_10497790 3300026116 Bacteria 1177
160 Ga0207683_10021127 3300026121 Bacteria 5571
161 Ga0207698_10363760 3300026142 Bacteria 1371
162 Ga0209813_10044553 3300027866 Bacteria 1363
163 Ga0209974_10015073 3300027876 Bacteria 2567
164 Ga0268266_10254884 3300028379 Unclassified 1624
165 Ga0268264_10043299 3300028381 Bacteria 3730
166 Ga0265334_10026541 3300028573 Bacteria 2338
167 Ga0307515_10150540 3300028794 Bacteria 2435
168 Ga0265332_10061384 3300031238 Bacteria 1607
169 Ga0265325_10001345 3300031241 Bacteria 17418
170 Ga0307408_100489373 3300031548 Bacteria 1075
171 Ga0307408_100495324 3300031548 Bacteria 1069
172 Ga0307405_10009308 3300031731 Bacteria 5029
173 Ga0307405_10148132 3300031731 Bacteria 1647
174 Ga0307413_10067144 3300031824 Bacteria 2241
175 Ga0307413_10083328 3300031824 Bacteria 2057
176 Ga0307410_10240299 3300031852 Bacteria 1403
177 Ga0307406_11022689 3300031901 Bacteria 710
178 Ga0307407_10212268 3300031903 Bacteria 1304
179 Ga0307412_10054765 3300031911 Bacteria 2649
180 Ga0307412_10136867 3300031911 Bacteria 1788
181 Ga0307409_101139044 3300031995 Bacteria 802
182 Ga0307414_10037649 3300032004 Bacteria 3241
183 Ga0307414_10548946 3300032004 Bacteria 1029
184 Ga0307411_10064867 3300032005 Bacteria 2447
185 Ga0307411_10565343 3300032005 Bacteria 972
186 Ga0373941_0234578 3300035115 Bacteria 710
187 Ga0373960_0233743 3300035121 Bacteria 662
188 Ga0373943_0136222 3300035170 Bacteria 1319
189 Ga0316574_0357624 3300035398 Bacteria 923
190 Ga0373931_0186558 3300035691 Bacteria 1231
191 Ga0373937_0155931 3300036401 Bacteria 2140
192 Ga0316584_0042668 3300036712 Bacteria 3381
193 Ga0400483_045020 3300039062 Bacteria 3008
194 Ga0400483_280406 3300039062 Bacteria 1908
195 Ga0450912_000089 3300042116 Bacteria 3074
196 Ga0450898_032376 3300042134 Bacteria 964
197 Ga0439435_0044997 3300042436 Bacteria 1246
198 Ga0451577_0003516 3300042876 Bacteria 17368
199 Ga0451576_0000023 3300045051 Bacteria 477965
200 Ga0451576_0000408 3300045051 Bacteria 99970
201 Ga0451576_0088855 3300045051 Bacteria 3214
202 Ga0451576_0154541 3300045051 Bacteria 2393
203 Ga0495591_000092 3300046458 Bacteria 101358
204 Ga0495637_0015673 3300046520 Bacteria 3555
205 Ga0495648_0151805 3300046524 Bacteria 1208
206 Ga0495625_0160758 3300046660 Bacteria 1505
207 Ga0495588_0032205 3300046674 Bacteria 2641
208 Ga0495669_0000267 3300046684 Bacteria 29896
209 Ga0495671_0000127 3300046692 Bacteria 68445
210 Ga0495677_0008387 3300047445 Bacteria 3839
211 Ga0496115_0232958 3300048918 Bacteria 1518
212 Ga0496115_0941157 3300048918 Bacteria 664
213 Ga0501031_0005726 3300049568 Bacteria 8101
214 Ga0501032_0029644 3300049569 Bacteria 3753
215 Ga0501033_0244197 3300049570 Bacteria 1273
216 Ga0501034_0149140 3300049571 Bacteria 2315
217 Ga0501034_0173115 3300049571 Bacteria 2125
218 Ga0501034_0182424 3300049571 Bacteria 2063
219 Ga0501036_0018924 3300049572 Bacteria 5777
220 Ga0501037_0020598 3300049573 Bacteria 4869
221 Ga0501038_0054363 3300049574 Bacteria 3444
222 Ga0501038_0133735 3300049574 Bacteria 2033
223 Ga0501039_0214270 3300049575 Bacteria 1514
224 Ga0501043_0121392 3300049579 Bacteria 2049
225 Ga0501046_0037465 3300049580 Bacteria 3896
226 Ga0501047_0216476 3300049581 Bacteria 1772
227 Ga0501047_0241571 3300049581 Bacteria 1657
228 Ga0501048_0014835 3300049582 Bacteria 5762
229 Ga0501067_0107001 3300049583 Bacteria 1554
230 Ga0501068_0534647 3300049584 Bacteria 761
231 Ga0501069_0021385 3300049585 Bacteria 3510
232 Ga0501069_0144084 3300049585 Bacteria 1367
233 Ga0501070_0091437 3300049586 Bacteria 2518
234 Ga0501071_0027173 3300049587 Bacteria 4024
235 Ga0501072_0138832 3300049588 Bacteria 1938
236 Ga0501072_0295881 3300049588 Bacteria 1287
237 Ga0501073_0004410 3300049589 Bacteria 10575
238 Ga0501074_0155220 3300049590 Bacteria 1635
239 Ga0501076_0051839 3300049592 Bacteria 3249
240 Ga0501076_0736590 3300049592 Bacteria 814
241 Ga0501080_0440742 3300049742 Bacteria 1168
242 Ga0501083_0002674 3300049744 Bacteria 12270
243 Ga0501044_0119560 3300049823 Bacteria 2637
244 Ga0501044_0244525 3300049823 Bacteria 1737
245 Ga0501044_0266429 3300049823 Bacteria 1650
246 Ga0501044_0715982 3300049823 Bacteria 885
247 nmdc:mga03683_38616_c2 3300050489 Bacteria 1259
248 nmdc:mga0k408_363892_c1 3300050493 Bacteria 862
249 nmdc:mga0k408_7009_c1 3300050493 Bacteria 6015
250 nmdc:mga04h51_27389_c1 3300050495 Bacteria 1770
251 nmdc:mga05p37_316267_c1 3300050507 Bacteria 1849
252 nmdc:mga09592_854899_c1 3300050508 Bacteria 767
253 nmdc:mga06r32_437508_c1 3300050510 Bacteria 1288
254 nmdc:mga08x19_317506_c1 3300050514 Unclassified 1084
255 Ga0495655_0004134 3300053083 Bacteria 2459
256 Ga0500643_000389 3300053087 Bacteria 33994
257 Ga0500562_060464 3300053108 Bacteria 1018
258 Ga0500614_028114 3300053123 Bacteria 1356
259 Ga0500590_003626 3300053148 Bacteria 7161
260 Ga0590075_021681 3300059424 Bacteria 1605
261 Ga0501082_0124288 3300060353 Bacteria 2237

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046660 Ga0495625_0160758 Ga0495625_0160758_733_1242 168
2 3300046692 Ga0495671_0000127 Ga0495671_0000127_26011_26520 168
3 3300050514 nmdc:mga08x19_317506_c1 nmdc:mga08x19_317506_c1_410_1039 182
4 3300045051 Ga0451576_0088855 Ga0451576_0088855_361_954 184
5 3300005445 Ga0070708_100075183 Ga0070708_1000751831 185
6 3300005467 Ga0070706_100092514 Ga0070706_1000925145 185
7 3300005536 Ga0070697_100717570 Ga0070697_1007175701 185
8 3300049588 Ga0501072_0295881 Ga0501072_0295881_532_1095 186
9 3300059424 Ga0590075_021681 Ga0590075_021681_826_1401 189
10 3300042876 Ga0451577_0003516 Ga0451577_0003516_11527_12117 192
11 iso_pu_bacteria 2511231008 2511276246 192
12 iso_pu_bacteria 2896253425 2896255690 192
13 3300005347 Ga0070668_100273204 Ga0070668_1002732042 193
14 3300005356 Ga0070674_100924392 Ga0070674_1009243921 193
15 3300005456 Ga0070678_100125879 Ga0070678_1001258791 193
16 3300005543 Ga0070672_100035464 Ga0070672_1000354642 193
17 3300005719 Ga0068861_100476002 Ga0068861_1004760022 193
18 3300014325 Ga0163163_10873979 Ga0163163_108739792 193
19 3300014326 Ga0157380_11280199 Ga0157380_112801991 193
20 3300025937 Ga0207669_10049404 Ga0207669_100494043 193
21 3300025972 Ga0207668_10608547 Ga0207668_106085472 193
22 3300026067 Ga0207678_10062092 Ga0207678_100620924 193
23 3300026067 Ga0207678_10977375 Ga0207678_109773751 193
24 3300026121 Ga0207683_10021127 Ga0207683_100211274 193
25 3300031731 Ga0307405_10148132 Ga0307405_101481321 193
26 3300031852 Ga0307410_10240299 Ga0307410_102402991 193
27 3300053087 Ga0500643_000389 Ga0500643_000389_2188_2775 193
28 iso_pu_bacteria 2882806704 2882807304 193
29 iso_pu_bacteria 2895880812 2895885996 193
30 3300005458 Ga0070681_10889022 Ga0070681_108890222 194
31 3300005327 Ga0070658_10148448 Ga0070658_101484482 195
32 3300005336 Ga0070680_100008159 Ga0070680_1000081593 195
33 3300005339 Ga0070660_100518217 Ga0070660_1005182172 195
34 3300005343 Ga0070687_100302838 Ga0070687_1003028382 195
35 3300005347 Ga0070668_100521487 Ga0070668_1005214871 195
36 3300005356 Ga0070674_100036567 Ga0070674_1000365672 195
37 3300005458 Ga0070681_10055049 Ga0070681_100550492 195
38 3300005459 Ga0068867_100750439 Ga0068867_1007504391 195
39 3300005466 Ga0070685_10123259 Ga0070685_101232592 195
40 3300005530 Ga0070679_100045759 Ga0070679_1000457592 195
41 3300005547 Ga0070693_100462331 Ga0070693_1004623312 195
42 3300005564 Ga0070664_100396100 Ga0070664_1003961002 195
43 3300005841 Ga0068863_100343498 Ga0068863_1003434982 195
44 3300006177 Ga0075362_10034434 Ga0075362_100344342 195
45 3300006195 Ga0075366_10015772 Ga0075366_100157722 195
46 3300006358 Ga0068871_100226407 Ga0068871_1002264072 195
47 3300009094 Ga0111539_11123749 Ga0111539_111237491 195
48 3300009098 Ga0105245_10335499 Ga0105245_103354992 195
49 3300009098 Ga0105245_10801731 Ga0105245_108017311 195
50 3300009147 Ga0114129_10393678 Ga0114129_103936782 195
51 3300013297 Ga0157378_10905970 Ga0157378_109059701 195
52 3300013297 Ga0157378_11587282 Ga0157378_115872821 195
53 3300013306 Ga0163162_10198272 Ga0163162_101982722 195
54 3300014326 Ga0157380_10258120 Ga0157380_102581202 195
55 3300025315 Ga0207697_10166742 Ga0207697_101667421 195
56 3300025912 Ga0207707_10079341 Ga0207707_100793412 195
57 3300025919 Ga0207657_10075800 Ga0207657_100758004 195
58 3300025921 Ga0207652_10039714 Ga0207652_100397144 195
59 3300025972 Ga0207668_10403120 Ga0207668_104031202 195
60 3300026041 Ga0207639_10007827 Ga0207639_100078277 195
61 3300026075 Ga0207708_10349355 Ga0207708_103493552 195
62 3300026089 Ga0207648_11248193 Ga0207648_112481931 195
63 3300027866 Ga0209813_10044553 Ga0209813_100445532 195
64 3300028794 Ga0307515_10150540 Ga0307515_101505401 195
65 3300031238 Ga0265332_10061384 Ga0265332_100613842 195
66 3300031241 Ga0265325_10001345 Ga0265325_100013453 195
67 3300031548 Ga0307408_100495324 Ga0307408_1004953241 195
68 3300031824 Ga0307413_10067144 Ga0307413_100671442 195
69 3300031911 Ga0307412_10136867 Ga0307412_101368673 195
70 3300031995 Ga0307409_101139044 Ga0307409_1011390442 195
71 3300032004 Ga0307414_10037649 Ga0307414_100376492 195
72 3300035115 Ga0373941_0234578 Ga0373941_0234578_55_654 195
73 3300035121 Ga0373960_0233743 Ga0373960_0233743_44_652 195
74 3300035170 Ga0373943_0136222 Ga0373943_0136222_476_1138 195
75 3300035691 Ga0373931_0186558 Ga0373931_0186558_375_1037 195
76 3300036401 Ga0373937_0155931 Ga0373937_0155931_1106_1708 195
77 3300042116 Ga0450912_000089 Ga0450912_000089_209_814 195
78 3300042134 Ga0450898_032376 Ga0450898_032376_87_692 195
79 3300042436 Ga0439435_0044997 Ga0439435_0044997_314_907 195
80 3300045051 Ga0451576_0154541 Ga0451576_0154541_756_1343 195
81 3300046458 Ga0495591_000092 Ga0495591_000092_36750_37340 195
82 3300046520 Ga0495637_0015673 Ga0495637_0015673_514_1104 195
83 3300046524 Ga0495648_0151805 Ga0495648_0151805_327_917 195
84 3300048918 Ga0496115_0232958 Ga0496115_0232958_227_829 195
85 3300048918 Ga0496115_0941157 Ga0496115_0941157_35_643 195
86 3300049568 Ga0501031_0005726 Ga0501031_0005726_7374_7967 195
87 3300049569 Ga0501032_0029644 Ga0501032_0029644_347_940 195
88 3300049570 Ga0501033_0244197 Ga0501033_0244197_566_1159 195
89 3300049571 Ga0501034_0173115 Ga0501034_0173115_247_840 195
90 3300049571 Ga0501034_0182424 Ga0501034_0182424_113_706 195
91 3300049572 Ga0501036_0018924 Ga0501036_0018924_4353_4946 195
92 3300049573 Ga0501037_0020598 Ga0501037_0020598_115_708 195
93 3300049574 Ga0501038_0054363 Ga0501038_0054363_1314_1907 195
94 3300049574 Ga0501038_0133735 Ga0501038_0133735_217_810 195
95 3300049575 Ga0501039_0214270 Ga0501039_0214270_618_1211 195
96 3300049579 Ga0501043_0121392 Ga0501043_0121392_1151_1744 195
97 3300049580 Ga0501046_0037465 Ga0501046_0037465_1357_1950 195
98 3300049581 Ga0501047_0216476 Ga0501047_0216476_139_732 195
99 3300049582 Ga0501048_0014835 Ga0501048_0014835_1151_1744 195
100 3300049583 Ga0501067_0107001 Ga0501067_0107001_361_954 195
101 3300049584 Ga0501068_0534647 Ga0501068_0534647_37_630 195
102 3300049585 Ga0501069_0021385 Ga0501069_0021385_2829_3431 195
103 3300049585 Ga0501069_0144084 Ga0501069_0144084_70_663 195
104 3300049586 Ga0501070_0091437 Ga0501070_0091437_363_956 195
105 3300049587 Ga0501071_0027173 Ga0501071_0027173_1092_1685 195
106 3300049588 Ga0501072_0138832 Ga0501072_0138832_798_1391 195
107 3300049589 Ga0501073_0004410 Ga0501073_0004410_832_1425 195
108 3300049590 Ga0501074_0155220 Ga0501074_0155220_39_632 195
109 3300049592 Ga0501076_0051839 Ga0501076_0051839_2267_2860 195
110 3300049742 Ga0501080_0440742 Ga0501080_0440742_144_737 195
111 3300049744 Ga0501083_0002674 Ga0501083_0002674_7356_7949 195
112 3300049823 Ga0501044_0244525 Ga0501044_0244525_1097_1690 195
113 3300050489 nmdc:mga03683_38616_c2 nmdc:mga03683_38616_c2_503_1111 195
114 3300050493 nmdc:mga0k408_363892_c1 nmdc:mga0k408_363892_c1_118_723 195
115 3300050493 nmdc:mga0k408_7009_c1 nmdc:mga0k408_7009_c1_4999_5607 195
116 3300050495 nmdc:mga04h51_27389_c1 nmdc:mga04h51_27389_c1_804_1412 195
117 3300050507 nmdc:mga05p37_316267_c1 nmdc:mga05p37_316267_c1_678_1286 195
118 3300053083 Ga0495655_0004134 Ga0495655_0004134_1558_2163 195
119 3300060353 Ga0501082_0124288 Ga0501082_0124288_21_614 195
120 3300005327 Ga0070658_10025099 Ga0070658_100250997 196
121 3300005327 Ga0070658_10027117 Ga0070658_100271172 196
122 3300005327 Ga0070658_10157777 Ga0070658_101577772 196
123 3300005327 Ga0070658_10787594 Ga0070658_107875942 196
124 3300005327 Ga0070658_10873637 Ga0070658_108736371 196
125 3300005329 Ga0070683_100026580 Ga0070683_1000265803 196
126 3300005331 Ga0070670_100266882 Ga0070670_1002668821 196
127 3300005336 Ga0070680_100010175 Ga0070680_1000101755 196
128 3300005337 Ga0070682_100011843 Ga0070682_1000118434 196
129 3300005339 Ga0070660_100002774 Ga0070660_1000027747 196
130 3300005339 Ga0070660_100265217 Ga0070660_1002652172 196
131 3300005339 Ga0070660_100369631 Ga0070660_1003696312 196
132 3300005339 Ga0070660_100718941 Ga0070660_1007189412 196
133 3300005344 Ga0070661_100001360 Ga0070661_1000013606 196
134 3300005354 Ga0070675_100228962 Ga0070675_1002289621 196
135 3300005366 Ga0070659_100049170 Ga0070659_1000491706 196
136 3300005366 Ga0070659_100137843 Ga0070659_1001378433 196
137 3300005366 Ga0070659_100539748 Ga0070659_1005397482 196
138 3300005435 Ga0070714_100233568 Ga0070714_1002335683 196
139 3300005445 Ga0070708_100814663 Ga0070708_1008146631 196
140 3300005457 Ga0070662_100000942 Ga0070662_1000009426 196
141 3300005457 Ga0070662_100010012 Ga0070662_1000100123 196
142 3300005457 Ga0070662_100077177 Ga0070662_1000771773 196
143 3300005457 Ga0070662_100415428 Ga0070662_1004154282 196
144 3300005458 Ga0070681_10009566 Ga0070681_100095664 196
145 3300005458 Ga0070681_10727953 Ga0070681_107279532 196
146 3300005530 Ga0070679_100096165 Ga0070679_1000961651 196
147 3300005530 Ga0070679_100117267 Ga0070679_1001172673 196
148 3300005530 Ga0070679_100903297 Ga0070679_1009032971 196
149 3300005536 Ga0070697_100049318 Ga0070697_1000493182 196
150 3300005539 Ga0068853_100000508 Ga0068853_1000005086 196
151 3300005539 Ga0068853_100711377 Ga0068853_1007113771 196
152 3300005563 Ga0068855_100002675 Ga0068855_1000026757 196
153 3300005563 Ga0068855_100004449 Ga0068855_1000044497 196
154 3300005563 Ga0068855_100014465 Ga0068855_1000144659 196
155 3300005564 Ga0070664_100002777 Ga0070664_1000027777 196
156 3300005577 Ga0068857_100122433 Ga0068857_1001224332 196
157 3300005577 Ga0068857_100174551 Ga0068857_1001745513 196
158 3300005578 Ga0068854_100037407 Ga0068854_1000374075 196
159 3300005614 Ga0068856_100112944 Ga0068856_1001129443 196
160 3300006844 Ga0075428_100384850 Ga0075428_1003848503 196
161 3300006847 Ga0075431_100812556 Ga0075431_1008125561 196
162 3300009093 Ga0105240_10359942 Ga0105240_103599422 196
163 3300009147 Ga0114129_10337981 Ga0114129_103379813 196
164 3300011119 Ga0105246_10000302 Ga0105246_1000030221 196
165 3300013100 Ga0157373_10002751 Ga0157373_100027518 196
166 3300013100 Ga0157373_10005489 Ga0157373_100054893 196
167 3300013102 Ga0157371_10002035 Ga0157371_1000203511 196
168 3300013102 Ga0157371_10019109 Ga0157371_100191091 196
169 3300013104 Ga0157370_10001275 Ga0157370_1000127516 196
170 3300013105 Ga0157369_10002907 Ga0157369_1000290712 196
171 3300013307 Ga0157372_10001844 Ga0157372_100018445 196
172 3300013307 Ga0157372_10433216 Ga0157372_104332163 196
173 3300014326 Ga0157380_10654521 Ga0157380_106545212 196
174 3300017792 Ga0163161_10870953 Ga0163161_108709532 196
175 3300025909 Ga0207705_10004463 Ga0207705_1000446311 196
176 3300025909 Ga0207705_10005744 Ga0207705_100057444 196
177 3300025909 Ga0207705_10027709 Ga0207705_100277093 196
178 3300025909 Ga0207705_10763738 Ga0207705_107637381 196
179 3300025910 Ga0207684_10542972 Ga0207684_105429722 196
180 3300025912 Ga0207707_10014673 Ga0207707_100146733 196
181 3300025913 Ga0207695_10379369 Ga0207695_103793691 196
182 3300025917 Ga0207660_10008332 Ga0207660_100083322 196
183 3300025919 Ga0207657_10000124 Ga0207657_1000012412 196
184 3300025919 Ga0207657_10143670 Ga0207657_101436702 196
185 3300025920 Ga0207649_10011021 Ga0207649_100110213 196
186 3300025921 Ga0207652_10002025 Ga0207652_1000202511 196
187 3300025921 Ga0207652_10014883 Ga0207652_100148836 196
188 3300025921 Ga0207652_10249388 Ga0207652_102493883 196
189 3300025921 Ga0207652_10322964 Ga0207652_103229642 196
190 3300025929 Ga0207664_10206837 Ga0207664_102068372 196
191 3300025932 Ga0207690_10000924 Ga0207690_1000092414 196
192 3300025932 Ga0207690_10125336 Ga0207690_101253361 196
193 3300025933 Ga0207706_10000160 Ga0207706_1000016061 196
194 3300025933 Ga0207706_10010885 Ga0207706_1001088510 196
195 3300025933 Ga0207706_10412423 Ga0207706_104124232 196
196 3300025944 Ga0207661_10107630 Ga0207661_101076301 196
197 3300025945 Ga0207679_10546880 Ga0207679_105468802 196
198 3300025949 Ga0207667_10014608 Ga0207667_100146086 196
199 3300025949 Ga0207667_10049873 Ga0207667_100498733 196
200 3300025949 Ga0207667_11021944 Ga0207667_110219442 196
201 3300025981 Ga0207640_10035773 Ga0207640_100357735 196
202 3300026041 Ga0207639_10000426 Ga0207639_100004269 196
203 3300026067 Ga0207678_10473593 Ga0207678_104735932 196
204 3300026075 Ga0207708_10810289 Ga0207708_108102891 196
205 3300026078 Ga0207702_10379948 Ga0207702_103799482 196
206 3300026095 Ga0207676_10984903 Ga0207676_109849031 196
207 3300026116 Ga0207674_10032601 Ga0207674_100326012 196
208 3300026116 Ga0207674_10135484 Ga0207674_101354843 196
209 3300026116 Ga0207674_10497790 Ga0207674_104977902 196
210 3300026142 Ga0207698_10363760 Ga0207698_103637602 196
211 3300027876 Ga0209974_10015073 Ga0209974_100150732 196
212 3300028379 Ga0268266_10254884 Ga0268266_102548843 196
213 3300028573 Ga0265334_10026541 Ga0265334_100265412 196
214 3300031548 Ga0307408_100489373 Ga0307408_1004893732 196
215 3300031731 Ga0307405_10009308 Ga0307405_100093087 196
216 3300031824 Ga0307413_10083328 Ga0307413_100833283 196
217 3300031901 Ga0307406_11022689 Ga0307406_110226891 196
218 3300031903 Ga0307407_10212268 Ga0307407_102122682 196
219 3300031911 Ga0307412_10054765 Ga0307412_100547655 196
220 3300032004 Ga0307414_10548946 Ga0307414_105489462 196
221 3300032005 Ga0307411_10064867 Ga0307411_100648673 196
222 3300032005 Ga0307411_10565343 Ga0307411_105653431 196
223 3300035398 Ga0316574_0357624 Ga0316574_0357624_284_877 196
224 3300036712 Ga0316584_0042668 Ga0316584_0042668_2767_3360 196
225 3300039062 Ga0400483_045020 Ga0400483_045020_81_674 196
226 3300039062 Ga0400483_280406 Ga0400483_280406_797_1390 196
227 3300045051 Ga0451576_0000023 Ga0451576_0000023_423527_424135 196
228 3300045051 Ga0451576_0000408 Ga0451576_0000408_58028_58621 196
229 3300046674 Ga0495588_0032205 Ga0495588_0032205_1008_1646 196
230 3300046684 Ga0495669_0000267 Ga0495669_0000267_15968_16579 196
231 3300047445 Ga0495677_0008387 Ga0495677_0008387_2435_3046 196
232 3300049571 Ga0501034_0149140 Ga0501034_0149140_1006_1614 196
233 3300049581 Ga0501047_0241571 Ga0501047_0241571_355_954 196
234 3300049592 Ga0501076_0736590 Ga0501076_0736590_127_720 196
235 3300049823 Ga0501044_0119560 Ga0501044_0119560_1249_1857 196
236 3300049823 Ga0501044_0266429 Ga0501044_0266429_608_1207 196
237 3300049823 Ga0501044_0715982 Ga0501044_0715982_179_778 196
238 3300050508 nmdc:mga09592_854899_c1 nmdc:mga09592_854899_c1_59_712 196
239 3300050510 nmdc:mga06r32_437508_c1 nmdc:mga06r32_437508_c1_621_1274 196
240 3300053108 Ga0500562_060464 Ga0500562_060464_332_994 196
241 3300053123 Ga0500614_028114 Ga0500614_028114_587_1186 196
242 3300053148 Ga0500590_003626 Ga0500590_003626_4576_5181 196
243 3300002737 JGI25162J39368_1000239 JGI25162J39368_100023940 197
244 3300002741 JGI25157J39369_1000293 JGI25157J39369_100029316 197
245 3300002771 JGI25163J39215_1001211 JGI25163J39215_10012113 197
246 3300002772 JGI25164J39214_1000200 JGI25164J39214_100020013 197
247 3300003214 JGI25165J46597_1000319 JGI25165J46597_100031940 197
248 3300003320 rootH2_10060382 rootH2_100603829 197
249 3300003751 Ga0055538_1000592 Ga0055538_100059210 197
250 3300003761 Ga0055535_1000242 Ga0055535_100024240 197
251 3300003762 Ga0055542_1000298 Ga0055542_100029812 197
252 3300003763 Ga0055529_1000437 Ga0055529_100043740 197
253 3300005843 Ga0068860_100017668 Ga0068860_1000176683 197
254 3300025224 Ga0209784_100163 Ga0209784_10016315 197
255 3300025228 Ga0209672_103203 Ga0209672_1032032 197
256 3300025231 Ga0207427_100196 Ga0207427_10019615 197
257 3300025233 Ga0209437_100345 Ga0209437_10034537 197
258 3300025242 Ga0209258_100384 Ga0209258_10038440 197
259 3300025246 Ga0209646_1000786 Ga0209646_100078610 197
260 3300025250 Ga0209026_1000286 Ga0209026_100028615 197
261 3300025254 Ga0209148_1000047 Ga0209148_100004740 197
262 3300025256 Ga0209759_1000651 Ga0209759_100065112 197
263 3300025261 Ga0209233_1000100 Ga0209233_1000100230 197
264 3300025272 Ga0209455_1000270 Ga0209455_100027015 197
265 3300028381 Ga0268264_10043299 Ga0268264_100432994 197

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00881

Nitroreductase

Nitroreductase family

38

198

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7vqk-assembly1.cif.gz_B catalytic manifolds of a fmn-dependent oxidoreductase rube7, expanding the functional diversity of the flavoenzyme superfamily 0.9572 3 197
7vqk-assembly1.cif.gz_B catalytic manifolds of a fmn-dependent oxidoreductase rube7, expanding the functional diversity of the flavoenzyme superfamily 0.9477 3 197
3ge5-assembly1.cif.gz_B crystal structure of a putative nad(p)h:fmn oxidoreductase (pg0310) from porphyromonas gingivalis w83 at 1.70 a resolution 0.8753 14 196
2b67-assembly2.cif.gz_C crystal structure of the nitroreductase family protein from streptococcus pneumoniae tigr4 0.8594 10 197
1nox-assembly1.cif.gz_A-2 nadh oxidase from thermus thermophilus 0.8508 11 197
ID Description Score Start End Superfamily
af_P75894_8_194_3.40.109.10 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.9934 9 195 3.40.109.10
af_P75894_8_194_3.40.109.10 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.9829 9 195 3.40.109.10
3ge5B00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.866 13 196 3.40.109.10
2b67D00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8542 10 197 3.40.109.10
1noxA00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8508 11 197 3.40.109.10
ID Description Score Start End GO Terms
AF-A0A6P2U9X0-F1-model_v4 Malonic semialdehyde reductase 0.9985 3 167 GO:0016491
AF-A0A2V3QT80-F1-model_v4 deleted 0.9977 3 197
AF-A0A358HY47-F1-model_v4 Malonic semialdehyde reductase 0.9975 4 173 GO:0016491
AF-A0A318JG00-F1-model_v4 Putative NADH dehydrogenase/NAD(P)H nitroreductase DFR42_1011006 (EC 1.-.-.-) 0.995 4 197 GO:0016491
AF-A0A238HC25-F1-model_v4 Putative NADH dehydrogenase/NAD(P)H nitroreductase BSIN_5254 (EC 1.-.-.-) 0.9945 3 197 GO:0016491

Feature Viewer

pLDDT pTM Quality
96.14 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map