F373350

General Info

Members Datasets Scaffolds Average Seq Length
265 187 244 194

Family's Representative Sequence

Representative Sequence 3300025304|Ga0209257_1096339|Ga0209257_10963391
Length 192
Sequence MNKLSVIYHSGHGHTEHIAKQVLAGALTVYDTEAHLLEAQDVTRHPDVLQGYDGYIFGSPTYLGGVSGQFKTTFMDATGRLWRTQQLKGRLAAGFTVSSLPAGDKQSTLNSMFTVSMQHGMLWVGNPILPEQHAGVPYEEAANRLGSWSGLMAQAGHSAPADSFAPGDIKTARMFGRNFAKSLERLGSTVAV

Samples

Sample ID Description Type Environment
1 2547132374 Acidovorax radicis N35 Isolate Unclassified
2 2551306352 Acinetobacter sp. GG2 Isolate Rhizosphere
3 2639762793 Acinetobacter calcoaceticus GK1 Isolate Rhizosphere
4 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
5 2643221570 Acidovorax sp. Root568 Isolate Unclassified
6 2643221596 Acidovorax sp. Root70 Isolate Unclassified
7 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
8 2643221638 Duganella sp. Root336D2 Isolate Unclassified
9 2643221652 Acidovorax sp. Root402 Isolate Unclassified
10 2643221717 Acidovorax sp. Root267 Isolate Unclassified
11 2675903507 Acinetobacter calcoaceticus GK2 Isolate Unclassified
12 2773857761 Acinetobacter sp. 3664 Isolate Unclassified
13 2773857770 Acinetobacter sp. 3636 Isolate Unclassified
14 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
15 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
16 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
17 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
18 2919182534 Acinetobacter calcoaceticus 2589 Isolate Rhizosphere
19 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
20 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
21 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
22 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
23 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
24 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
25 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
26 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
27 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
28 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
29 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
30 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
31 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
32 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
33 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
34 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
35 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
36 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
37 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
38 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
39 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
40 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
41 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
42 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
43 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
44 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
45 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
46 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
47 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
48 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
67 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
68 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
83 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
84 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
85 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
88 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
91 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
94 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
115 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
116 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
117 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
118 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
119 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
120 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
121 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
122 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
123 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
125 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
126 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
127 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
128 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
129 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
130 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
131 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
132 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
133 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
134 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
135 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
136 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
137 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
138 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
139 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
140 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
141 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
142 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
143 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
144 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
145 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
146 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
147 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
148 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
149 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
150 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
151 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
152 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
153 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
154 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
155 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
156 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
157 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
158 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
159 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
160 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
161 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
170 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
171 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
172 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
173 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
174 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
175 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
176 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
177 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
178 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
179 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
180 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
181 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
182 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
184 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
185 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
186 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
187 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.08
Metatranscriptomes 0
Isolates 7.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25.28
Nodule 0
Rhizoplane 3.4
Rhizosphere 62.26
Stem 0
Stem Tuber 0
Unclassified 9.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1000788 3300002739 Bacteria 6039
2 JGI25152J39213_1000567 3300002773 Bacteria 20201
3 JGI25152J39213_1011781 3300002773 Bacteria 1913
4 JGI25150J39212_1000411 3300002774 Bacteria 19890
5 JGI25150J39212_1002976 3300002774 Bacteria 4084
6 JGI25159J45721_1015887 3300002987 Bacteria 1628
7 JGI25153J46596_10013727 3300003215 Bacteria 3408
8 rootH1_10014665 3300003316 Bacteria 15887
9 rootH2_10102231 3300003320 Bacteria 1787
10 rootL2_10000123 3300003322 Bacteria 51034
11 rootL2_10018294 3300003322 Bacteria 3002
12 rootH1_10169853 3300003323 Bacteria 2000
13 JGI25160J50197_1002160 3300003354 Bacteria 9309
14 JGI25161J50226_1008209 3300003374 Bacteria 1632
15 JGI25161J50226_1008250 3300003374 Bacteria 1624
16 Ga0055526_1006069 3300003771 Bacteria 6680
17 Ga0055526_1031573 3300003771 Bacteria 1514
18 Ga0055526_1068586 3300003771 Bacteria 727
19 Ga0055537_1008020 3300003773 Bacteria 2476
20 Ga0055537_1017090 3300003773 Bacteria 1205
21 Ga0055524_1000318 3300003775 Bacteria 45388
22 Ga0055524_1000652 3300003775 Bacteria 24532
23 Ga0055524_1002375 3300003775 Bacteria 9765
24 Ga0055524_1039813 3300003775 Bacteria 1209
25 Ga0055528_1011814 3300003790 Bacteria 3435
26 Ga0055530_10006725 3300003791 Bacteria 5033
27 Ga0055530_10007348 3300003791 Bacteria 4663
28 Ga0055530_10027795 3300003791 Bacteria 1539
29 Ga0055540_1040282 3300003792 Bacteria 1013
30 Ga0055531_10001129 3300003794 Bacteria 20643
31 Ga0055531_10008693 3300003794 Bacteria 5306
32 Ga0055531_10011490 3300003794 Bacteria 4262
33 Ga0058692_1000067 3300003856 Bacteria 88996
34 Ga0055543_1000391 3300004625 Bacteria 28334
35 Ga0055543_1021229 3300004625 Bacteria 1185
36 Ga0065165_1022078 3300005262 Bacteria 2191
37 Ga0065703_1000507 3300005272 Bacteria 24291
38 Ga0068869_100576953 3300005334 Bacteria 948
39 Ga0070669_100007800 3300005353 Bacteria 7648
40 Ga0070671_100067243 3300005355 Bacteria 2988
41 Ga0070673_100018592 3300005364 Bacteria 4969
42 Ga0070688_100015126 3300005365 Unclassified 4382
43 Ga0070659_101250771 3300005366 Bacteria 657
44 Ga0070678_100457255 3300005456 Bacteria 1119
45 Ga0070685_10000566 3300005466 Bacteria 20735
46 Ga0070679_100044475 3300005530 Unclassified 4423
47 Ga0068853_100112091 3300005539 Unclassified 2424
48 Ga0070693_100043379 3300005547 Bacteria 2539
49 Ga0070665_100004663 3300005548 Bacteria 14320
50 Ga0070665_100010864 3300005548 Bacteria 9209
51 Ga0070665_100135128 3300005548 Unclassified 2468
52 Ga0068852_100382572 3300005616 Bacteria 1381
53 Ga0068859_100036835 3300005617 Unclassified 4912
54 Ga0068864_100128012 3300005618 Bacteria 2278
55 Ga0068863_100013354 3300005841 Bacteria 7918
56 Ga0068860_100003003 3300005843 Bacteria 17425
57 Ga0068862_100422519 3300005844 Bacteria 1251
58 Ga0075362_10113043 3300006177 Bacteria 1280
59 Ga0075366_10023228 3300006195 Bacteria 3612
60 Ga0075366_10361022 3300006195 Bacteria 892
61 Ga0097621_100393662 3300006237 Bacteria 1239
62 Ga0075370_10019645 3300006353 Bacteria 3682
63 Ga0097620_100036835 3300006931 Unclassified 4912
64 Ga0105251_10046271 3300009011 Bacteria 2094
65 Ga0105244_10014301 3300009036 Bacteria 4595
66 Ga0105244_10088740 3300009036 Bacteria 1522
67 Ga0105244_10088837 3300009036 Bacteria 1521
68 Ga0105250_10139301 3300009092 Bacteria 1005
69 Ga0105240_10026186 3300009093 Bacteria 7652
70 Ga0105247_10004673 3300009101 Bacteria 8727
71 Ga0105243_10000263 3300009148 Bacteria 59080
72 Ga0105248_10014679 3300009177 Bacteria 8621
73 Ga0105237_10540043 3300009545 Bacteria 1172
74 Ga0105238_10453620 3300009551 Unclassified 1279
75 Ga0157319_1000004 3300012497 Bacteria 394735
76 Ga0157371_10041782 3300013102 Bacteria 3271
77 Ga0157370_10436615 3300013104 Bacteria 1204
78 Ga0157370_10564841 3300013104 Bacteria 1043
79 Ga0157372_10054182 3300013307 Bacteria 4473
80 Ga0157379_10189220 3300014968 Bacteria 1860
81 Ga0157376_10405611 3300014969 Bacteria 1319
82 Ga0163161_10012349 3300017792 Bacteria 5929
83 Ga0209436_100246 3300025208 Bacteria 24967
84 Ga0207425_1000013 3300025245 Bacteria 497384
85 Ga0207425_1001515 3300025245 Bacteria 9583
86 Ga0209129_1000152 3300025258 Bacteria 112977
87 Ga0209129_1007631 3300025258 Bacteria 3173
88 Ga0209565_1000443 3300025263 Bacteria 32988
89 Ga0209565_1001844 3300025263 Bacteria 8497
90 Ga0209565_1002631 3300025263 Bacteria 6336
91 Ga0209565_1003871 3300025263 Bacteria 4713
92 Ga0209565_1003909 3300025263 Bacteria 4676
93 Ga0209565_1005650 3300025263 Bacteria 3613
94 Ga0209673_1010829 3300025273 Bacteria 3811
95 Ga0209130_1000652 3300025284 Bacteria 31893
96 Ga0209130_1001871 3300025284 Bacteria 12030
97 Ga0209675_1001155 3300025291 Bacteria 16063
98 Ga0209675_1026248 3300025291 Bacteria 1453
99 Ga0209564_1002169 3300025295 Bacteria 16539
100 Ga0209564_1006564 3300025295 Bacteria 6245
101 Ga0209758_1000031 3300025297 Bacteria 497252
102 Ga0209050_1000525 3300025298 Bacteria 63749
103 Ga0209050_1005478 3300025298 Bacteria 7950
104 Ga0209256_1000085 3300025299 Bacteria 219043
105 Ga0209256_1000414 3300025299 Bacteria 67073
106 Ga0209256_1001153 3300025299 Bacteria 29957
107 Ga0209256_1009869 3300025299 Bacteria 4103
108 Ga0207426_1001966 3300025302 Bacteria 14593
109 Ga0209051_1005967 3300025303 Bacteria 6967
110 Ga0209257_1000157 3300025304 Bacteria 181004
111 Ga0209257_1000612 3300025304 Bacteria 58171
112 Ga0209257_1007823 3300025304 Bacteria 6325
113 Ga0209257_1096339 3300025304 Bacteria 730
114 Ga0207696_1014948 3300025711 Bacteria 2644
115 Ga0207696_1020638 3300025711 Bacteria 2121
116 Ga0207696_1066897 3300025711 Bacteria 1003
117 Ga0207655_1014210 3300025728 Bacteria 4515
118 Ga0207655_1014306 3300025728 Bacteria 4494
119 Ga0207655_1018711 3300025728 Bacteria 3659
120 Ga0207713_1001489 3300025735 Bacteria 18523
121 Ga0207713_1029929 3300025735 Bacteria 2430
122 Ga0207710_10000455 3300025900 Bacteria 26350
123 Ga0207710_10002212 3300025900 Bacteria 9145
124 Ga0207660_10227129 3300025917 Bacteria 1467
125 Ga0207681_10000495 3300025923 Bacteria 27581
126 Ga0207644_10032179 3300025931 Bacteria 3657
127 Ga0207709_10000158 3300025935 Bacteria 91810
128 Ga0207711_10045730 3300025941 Bacteria 3741
129 Ga0207651_10011322 3300025960 Bacteria 4990
130 Ga0207702_10521242 3300026078 Bacteria 1160
131 Ga0207641_10006368 3300026088 Bacteria 9965
132 Ga0207698_10291935 3300026142 Bacteria 1514
133 Ga0209371_1000196 3300027312 Bacteria 89093
134 Ga0209974_10021323 3300027876 Bacteria 2145
135 Ga0268266_10003943 3300028379 Bacteria 14418
136 Ga0268266_10007323 3300028379 Bacteria 9973
137 Ga0268265_10405607 3300028380 Bacteria 1261
138 Ga0268264_10001628 3300028381 Bacteria 20748
139 Ga0268256_1000158 3300030500 Bacteria 89061
140 Ga0265327_10000147 3300031251 Bacteria 153254
141 Ga0307408_100000102 3300031548 Bacteria 94058
142 Ga0307408_100000861 3300031548 Bacteria 23836
143 Ga0307408_100005671 3300031548 Bacteria 8318
144 Ga0307408_100006223 3300031548 Bacteria 7927
145 Ga0307408_100012700 3300031548 Bacteria 5585
146 Ga0307408_100046871 3300031548 Bacteria 3093
147 Ga0307408_100152143 3300031548 Bacteria 1828
148 Ga0307516_10057380 3300031730 Bacteria 3793
149 Ga0307413_10391474 3300031824 Bacteria 1086
150 Ga0307406_10001224 3300031901 Bacteria 14373
151 Ga0307406_10305795 3300031901 Bacteria 1224
152 Ga0307412_10118699 3300031911 Bacteria 1901
153 Ga0307412_10811306 3300031911 Bacteria 813
154 Ga0307416_100003550 3300032002 Bacteria 9194
155 Ga0307411_10283751 3300032005 Bacteria 1319
156 Ga0307411_10283937 3300032005 Bacteria 1319
157 Ga0373937_0121307 3300036401 Bacteria 2436
158 Ga0395899_0006427 3300037312 Bacteria 9106
159 Ga0395899_0021613 3300037312 Bacteria 4879
160 Ga0395900_0221540 3300037418 Bacteria 1906
161 Ga0395905_0009255 3300037471 Bacteria 9642
162 Ga0395905_0087069 3300037471 Bacteria 2928
163 Ga0395905_0241901 3300037471 Bacteria 1686
164 Ga0395905_0485893 3300037471 Bacteria 1134
165 Ga0395901_0027415 3300038443 Bacteria 5853
166 Ga0395901_0281955 3300038443 Bacteria 1726
167 Ga0400487_09666 3300039110 Bacteria 1169
168 Ga0439466_0002729 3300041411 Bacteria 6912
169 Ga0439432_064579 3300042006 Bacteria 1123
170 Ga0450890_005747 3300042127 Bacteria 1595
171 Ga0450905_014066 3300042142 Bacteria 1138
172 Ga0439459_0000966 3300042438 Bacteria 4077
173 Ga0451577_0008279 3300042876 Bacteria 10126
174 Ga0451577_0129423 3300042876 Bacteria 2264
175 Ga0451577_0269677 3300042876 Bacteria 1541
176 Ga0451577_0332893 3300042876 Bacteria 1377
177 Ga0451577_1191170 3300042876 Unclassified 680
178 Ga0453684_0003051 3300044712 Bacteria 38906
179 Ga0466960_0105960 3300044901 Bacteria 1454
180 Ga0451576_1125029 3300045051 Bacteria 821
181 Ga0495627_005662 3300046453 Bacteria 4992
182 Ga0495627_077413 3300046453 Bacteria 966
183 Ga0495638_0080269 3300046460 Bacteria 1982
184 Ga0495650_0002446 3300046471 Bacteria 15012
185 Ga0495607_0025737 3300046501 Bacteria 3657
186 Ga0495607_0164735 3300046501 Bacteria 1123
187 Ga0495606_0345733 3300046507 Bacteria 791
188 Ga0495632_0171761 3300046519 Bacteria 995
189 Ga0495643_0120098 3300046522 Bacteria 1328
190 Ga0495663_0003137 3300046525 Bacteria 4824
191 Ga0495663_0011672 3300046525 Bacteria 2444
192 Ga0495633_0044505 3300046558 Bacteria 2103
193 Ga0495649_0020211 3300046694 Bacteria 3736
194 Ga0495681_0045377 3300047470 Bacteria 2104
195 Ga0495681_0045635 3300047470 Bacteria 2095
196 Ga0495615_0040108 3300048090 Bacteria 1164
197 Ga0496102_0065976 3300048905 Bacteria 3318
198 Ga0496105_0151318 3300048908 Bacteria 1907
199 Ga0496108_0075488 3300048911 Bacteria 2848
200 Ga0496108_0107859 3300048911 Bacteria 2378
201 Ga0496109_0126552 3300048912 Bacteria 2382
202 Ga0496109_0409026 3300048912 Bacteria 1282
203 Ga0496111_0436541 3300048914 Bacteria 967
204 Ga0496112_0141329 3300048915 Bacteria 2376
205 Ga0496113_0026104 3300048916 Bacteria 4173
206 Ga0496116_0001160 3300048919 Bacteria 31071
207 Ga0496118_0117684 3300048921 Bacteria 1742
208 Ga0496124_0028330 3300048927 Bacteria 5012
209 Ga0495682_0008116 3300049460 Bacteria 4145
210 Ga0501032_0006498 3300049569 Bacteria 8597
211 Ga0501032_0039593 3300049569 Bacteria 3206
212 Ga0501034_0054310 3300049571 Bacteria 4033
213 Ga0501034_0099210 3300049571 Bacteria 2908
214 Ga0501034_0099576 3300049571 Bacteria 2901
215 Ga0501036_0141242 3300049572 Bacteria 2032
216 Ga0501038_0067522 3300049574 Bacteria 3042
217 Ga0501039_0437349 3300049575 Bacteria 1027
218 Ga0501043_0319029 3300049579 Bacteria 1185
219 Ga0501043_0648749 3300049579 Bacteria 775
220 Ga0501046_0078681 3300049580 Bacteria 2550
221 Ga0501047_0000446 3300049581 Bacteria 45717
222 Ga0501047_0057294 3300049581 Bacteria 3768
223 Ga0501047_0384420 3300049581 Bacteria 1238
224 Ga0501067_0000639 3300049583 Bacteria 18826
225 Ga0501068_0036950 3300049584 Bacteria 2923
226 Ga0501069_0040644 3300049585 Bacteria 2570
227 Ga0501070_0071574 3300049586 Bacteria 2870
228 Ga0501072_0012915 3300049588 Bacteria 6387
229 Ga0501073_0031075 3300049589 Bacteria 3811
230 Ga0501074_0003396 3300049590 Bacteria 11272
231 Ga0501249_036194 3300049679 Bacteria 1112
232 Ga0501079_0094593 3300049741 Bacteria 2315
233 Ga0501080_0000686 3300049742 Bacteria 27086
234 Ga0501083_0000225 3300049744 Bacteria 36374
235 Ga0501263_002046 3300049760 Bacteria 2005
236 Ga0501266_000070 3300049763 Bacteria 13981
237 Ga0501035_0315225 3300049822 Bacteria 1315
238 Ga0501035_0450932 3300049822 Bacteria 1064
239 Ga0501044_0023949 3300049823 Bacteria 6488
240 Ga0501044_0069479 3300049823 Bacteria 3585
241 Ga0501044_0140868 3300049823 Bacteria 2400
242 nmdc:mga0k408_172479_c1 3300050493 Bacteria 1289
243 nmdc:mga07m45_33297_c1 3300050496 Bacteria 2861
244 Ga0501084_0049716 3300054114 Bacteria 3509

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300027876 Ga0209974_10021323 Ga0209974_100213233 163
2 3300048921 Ga0496118_0117684 Ga0496118_0117684_759_1313 172
3 3300048927 Ga0496124_0028330 Ga0496124_0028330_3354_3908 172
4 iso_pu_bacteria 8011350971 8011353982 180
5 iso_pu_bacteria 2547132374 2548497905 182
6 iso_pu_bacteria 2551306352 2552746419 182
7 iso_pu_bacteria 2639762793 2640736439 182
8 iso_pu_bacteria 2643221554 2643788994 182
9 iso_pu_bacteria 2643221570 2643868603 182
10 iso_pu_bacteria 2643221596 2643990978 182
11 iso_pu_bacteria 2643221603 2644031093 182
12 iso_pu_bacteria 2643221638 2644213081 182
13 iso_pu_bacteria 2643221652 2644295882 182
14 iso_pu_bacteria 2643221717 2644649530 182
15 iso_pu_bacteria 2675903507 2678229666 182
16 iso_pu_bacteria 2773857761 2774391359 182
17 iso_pu_bacteria 2773857770 2774436093 182
18 iso_pu_bacteria 2808606373 2808904685 182
19 iso_pu_bacteria 2858688981 2858692243 182
20 iso_pu_bacteria 2881101125 2881105050 182
21 iso_pu_bacteria 2919182534 2919185236 182
22 iso_pu_bacteria 2990196909 2990200261 182
23 iso_pu_bacteria 2990710928 2990711498 182
24 3300005456 Ga0070678_100457255 Ga0070678_1004572553 184
25 3300005548 Ga0070665_100010864 Ga0070665_1000108648 184
26 3300028379 Ga0268266_10003943 Ga0268266_1000394311 184
27 iso_pu_bacteria 2886848708 2886850412 184
28 3300002739 JGI25158J39367_1000788 JGI25158J39367_10007884 186
29 3300002773 JGI25152J39213_1000567 JGI25152J39213_100056721 186
30 3300002773 JGI25152J39213_1011781 JGI25152J39213_10117813 186
31 3300002774 JGI25150J39212_1000411 JGI25150J39212_10004112 186
32 3300002774 JGI25150J39212_1002976 JGI25150J39212_10029762 186
33 3300002987 JGI25159J45721_1015887 JGI25159J45721_10158872 186
34 3300003215 JGI25153J46596_10013727 JGI25153J46596_100137274 186
35 3300003316 rootH1_10014665 rootH1_100146652 186
36 3300003320 rootH2_10102231 rootH2_101022313 186
37 3300003322 rootL2_10000123 rootL2_1000012328 186
38 3300003322 rootL2_10018294 rootL2_100182943 186
39 3300003323 rootH1_10169853 rootH1_101698532 186
40 3300003354 JGI25160J50197_1002160 JGI25160J50197_10021605 186
41 3300003374 JGI25161J50226_1008209 JGI25161J50226_10082092 186
42 3300003374 JGI25161J50226_1008250 JGI25161J50226_10082502 186
43 3300003771 Ga0055526_1006069 Ga0055526_10060695 186
44 3300003771 Ga0055526_1031573 Ga0055526_10315732 186
45 3300003771 Ga0055526_1068586 Ga0055526_10685861 186
46 3300003773 Ga0055537_1008020 Ga0055537_10080202 186
47 3300003773 Ga0055537_1017090 Ga0055537_10170902 186
48 3300003775 Ga0055524_1000318 Ga0055524_100031824 186
49 3300003775 Ga0055524_1000652 Ga0055524_10006521 186
50 3300003775 Ga0055524_1002375 Ga0055524_10023752 186
51 3300003775 Ga0055524_1039813 Ga0055524_10398131 186
52 3300003790 Ga0055528_1011814 Ga0055528_10118145 186
53 3300003791 Ga0055530_10006725 Ga0055530_100067252 186
54 3300003791 Ga0055530_10007348 Ga0055530_100073488 186
55 3300003791 Ga0055530_10027795 Ga0055530_100277952 186
56 3300003792 Ga0055540_1040282 Ga0055540_10402821 186
57 3300003794 Ga0055531_10001129 Ga0055531_1000112915 186
58 3300003794 Ga0055531_10008693 Ga0055531_100086938 186
59 3300003794 Ga0055531_10011490 Ga0055531_100114902 186
60 3300003856 Ga0058692_1000067 Ga0058692_100006785 186
61 3300004625 Ga0055543_1000391 Ga0055543_100039124 186
62 3300004625 Ga0055543_1021229 Ga0055543_10212292 186
63 3300005262 Ga0065165_1022078 Ga0065165_10220782 186
64 3300005272 Ga0065703_1000507 Ga0065703_10005075 186
65 3300005334 Ga0068869_100576953 Ga0068869_1005769532 186
66 3300005353 Ga0070669_100007800 Ga0070669_1000078005 186
67 3300005355 Ga0070671_100067243 Ga0070671_1000672432 186
68 3300005364 Ga0070673_100018592 Ga0070673_1000185924 186
69 3300005365 Ga0070688_100015126 Ga0070688_1000151266 186
70 3300005366 Ga0070659_101250771 Ga0070659_1012507711 186
71 3300005466 Ga0070685_10000566 Ga0070685_1000056610 186
72 3300005530 Ga0070679_100044475 Ga0070679_1000444756 186
73 3300005539 Ga0068853_100112091 Ga0068853_1001120913 186
74 3300005547 Ga0070693_100043379 Ga0070693_1000433794 186
75 3300005548 Ga0070665_100004663 Ga0070665_1000046636 186
76 3300005548 Ga0070665_100135128 Ga0070665_1001351283 186
77 3300005616 Ga0068852_100382572 Ga0068852_1003825721 186
78 3300005617 Ga0068859_100036835 Ga0068859_1000368357 186
79 3300005618 Ga0068864_100128012 Ga0068864_1001280123 186
80 3300005841 Ga0068863_100013354 Ga0068863_1000133549 186
81 3300005843 Ga0068860_100003003 Ga0068860_10000300315 186
82 3300005844 Ga0068862_100422519 Ga0068862_1004225192 186
83 3300006177 Ga0075362_10113043 Ga0075362_101130432 186
84 3300006195 Ga0075366_10023228 Ga0075366_100232285 186
85 3300006195 Ga0075366_10361022 Ga0075366_103610222 186
86 3300006237 Ga0097621_100393662 Ga0097621_1003936622 186
87 3300006353 Ga0075370_10019645 Ga0075370_100196454 186
88 3300006931 Ga0097620_100036835 Ga0097620_1000368357 186
89 3300009011 Ga0105251_10046271 Ga0105251_100462712 186
90 3300009036 Ga0105244_10014301 Ga0105244_100143012 186
91 3300009036 Ga0105244_10088740 Ga0105244_100887402 186
92 3300009036 Ga0105244_10088837 Ga0105244_100888372 186
93 3300009092 Ga0105250_10139301 Ga0105250_101393011 186
94 3300009093 Ga0105240_10026186 Ga0105240_100261866 186
95 3300009101 Ga0105247_10004673 Ga0105247_1000467310 186
96 3300009148 Ga0105243_10000263 Ga0105243_100002635 186
97 3300009177 Ga0105248_10014679 Ga0105248_100146798 186
98 3300009545 Ga0105237_10540043 Ga0105237_105400432 186
99 3300009551 Ga0105238_10453620 Ga0105238_104536203 186
100 3300012497 Ga0157319_1000004 Ga0157319_1000004229 186
101 3300013102 Ga0157371_10041782 Ga0157371_100417822 186
102 3300013104 Ga0157370_10436615 Ga0157370_104366151 186
103 3300013104 Ga0157370_10564841 Ga0157370_105648412 186
104 3300013307 Ga0157372_10054182 Ga0157372_100541824 186
105 3300014968 Ga0157379_10189220 Ga0157379_101892202 186
106 3300014969 Ga0157376_10405611 Ga0157376_104056112 186
107 3300017792 Ga0163161_10012349 Ga0163161_100123494 186
108 3300025208 Ga0209436_100246 Ga0209436_10024613 186
109 3300025245 Ga0207425_1000013 Ga0207425_100001399 186
110 3300025245 Ga0207425_1001515 Ga0207425_10015153 186
111 3300025258 Ga0209129_1000152 Ga0209129_1000152100 186
112 3300025258 Ga0209129_1007631 Ga0209129_10076312 186
113 3300025263 Ga0209565_1000443 Ga0209565_100044320 186
114 3300025263 Ga0209565_1001844 Ga0209565_10018445 186
115 3300025263 Ga0209565_1002631 Ga0209565_100263110 186
116 3300025263 Ga0209565_1003871 Ga0209565_10038718 186
117 3300025263 Ga0209565_1003909 Ga0209565_10039095 186
118 3300025263 Ga0209565_1005650 Ga0209565_10056505 186
119 3300025273 Ga0209673_1010829 Ga0209673_10108292 186
120 3300025284 Ga0209130_1000652 Ga0209130_100065224 186
121 3300025284 Ga0209130_1001871 Ga0209130_10018716 186
122 3300025291 Ga0209675_1001155 Ga0209675_10011554 186
123 3300025291 Ga0209675_1026248 Ga0209675_10262484 186
124 3300025295 Ga0209564_1002169 Ga0209564_100216914 186
125 3300025295 Ga0209564_1006564 Ga0209564_10065649 186
126 3300025297 Ga0209758_1000031 Ga0209758_1000031365 186
127 3300025298 Ga0209050_1000525 Ga0209050_100052557 186
128 3300025298 Ga0209050_1005478 Ga0209050_10054782 186
129 3300025299 Ga0209256_1000085 Ga0209256_1000085179 186
130 3300025299 Ga0209256_1000414 Ga0209256_100041454 186
131 3300025299 Ga0209256_1001153 Ga0209256_100115321 186
132 3300025299 Ga0209256_1009869 Ga0209256_10098692 186
133 3300025302 Ga0207426_1001966 Ga0207426_100196614 186
134 3300025303 Ga0209051_1005967 Ga0209051_10059675 186
135 3300025304 Ga0209257_1000157 Ga0209257_100015784 186
136 3300025304 Ga0209257_1000612 Ga0209257_100061225 186
137 3300025304 Ga0209257_1007823 Ga0209257_100782310 186
138 3300025304 Ga0209257_1096339 Ga0209257_10963391 186
139 3300025711 Ga0207696_1014948 Ga0207696_10149482 186
140 3300025711 Ga0207696_1020638 Ga0207696_10206384 186
141 3300025711 Ga0207696_1066897 Ga0207696_10668971 186
142 3300025728 Ga0207655_1014210 Ga0207655_10142103 186
143 3300025728 Ga0207655_1014306 Ga0207655_10143063 186
144 3300025728 Ga0207655_1018711 Ga0207655_10187112 186
145 3300025735 Ga0207713_1001489 Ga0207713_100148918 186
146 3300025735 Ga0207713_1029929 Ga0207713_10299292 186
147 3300025900 Ga0207710_10000455 Ga0207710_100004556 186
148 3300025900 Ga0207710_10002212 Ga0207710_100022125 186
149 3300025917 Ga0207660_10227129 Ga0207660_102271292 186
150 3300025923 Ga0207681_10000495 Ga0207681_100004955 186
151 3300025931 Ga0207644_10032179 Ga0207644_100321794 186
152 3300025935 Ga0207709_10000158 Ga0207709_1000015890 186
153 3300025941 Ga0207711_10045730 Ga0207711_100457303 186
154 3300025960 Ga0207651_10011322 Ga0207651_100113224 186
155 3300026078 Ga0207702_10521242 Ga0207702_105212421 186
156 3300026088 Ga0207641_10006368 Ga0207641_1000636810 186
157 3300026142 Ga0207698_10291935 Ga0207698_102919352 186
158 3300027312 Ga0209371_1000196 Ga0209371_100019686 186
159 3300028379 Ga0268266_10007323 Ga0268266_100073235 186
160 3300028380 Ga0268265_10405607 Ga0268265_104056072 186
161 3300028381 Ga0268264_10001628 Ga0268264_1000162824 186
162 3300030500 Ga0268256_1000158 Ga0268256_10001586 186
163 3300031251 Ga0265327_10000147 Ga0265327_1000014745 186
164 3300031548 Ga0307408_100000102 Ga0307408_10000010243 186
165 3300031548 Ga0307408_100000861 Ga0307408_1000008614 186
166 3300031548 Ga0307408_100005671 Ga0307408_1000056716 186
167 3300031548 Ga0307408_100006223 Ga0307408_10000622310 186
168 3300031548 Ga0307408_100012700 Ga0307408_1000127009 186
169 3300031548 Ga0307408_100046871 Ga0307408_1000468712 186
170 3300031548 Ga0307408_100152143 Ga0307408_1001521433 186
171 3300031730 Ga0307516_10057380 Ga0307516_100573804 186
172 3300031824 Ga0307413_10391474 Ga0307413_103914742 186
173 3300031901 Ga0307406_10001224 Ga0307406_100012247 186
174 3300031901 Ga0307406_10305795 Ga0307406_103057952 186
175 3300031911 Ga0307412_10118699 Ga0307412_101186992 186
176 3300031911 Ga0307412_10811306 Ga0307412_108113062 186
177 3300032002 Ga0307416_100003550 Ga0307416_1000035508 186
178 3300032005 Ga0307411_10283751 Ga0307411_102837512 186
179 3300032005 Ga0307411_10283937 Ga0307411_102839372 186
180 3300036401 Ga0373937_0121307 Ga0373937_0121307_1527_2111 186
181 3300037312 Ga0395899_0006427 Ga0395899_0006427_3988_4557 186
182 3300037312 Ga0395899_0021613 Ga0395899_0021613_2915_3502 186
183 3300037418 Ga0395900_0221540 Ga0395900_0221540_908_1495 186
184 3300037471 Ga0395905_0009255 Ga0395905_0009255_724_1326 186
185 3300037471 Ga0395905_0087069 Ga0395905_0087069_2288_2851 186
186 3300037471 Ga0395905_0241901 Ga0395905_0241901_1043_1612 186
187 3300037471 Ga0395905_0485893 Ga0395905_0485893_488_1057 186
188 3300038443 Ga0395901_0027415 Ga0395901_0027415_780_1367 186
189 3300038443 Ga0395901_0281955 Ga0395901_0281955_554_1123 186
190 3300039110 Ga0400487_09666 Ga0400487_09666_53_631 186
191 3300041411 Ga0439466_0002729 Ga0439466_0002729_2404_3000 186
192 3300042006 Ga0439432_064579 Ga0439432_064579_254_859 186
193 3300042127 Ga0450890_005747 Ga0450890_005747_697_1353 186
194 3300042142 Ga0450905_014066 Ga0450905_014066_110_718 186
195 3300042438 Ga0439459_0000966 Ga0439459_0000966_2541_3197 186
196 3300042876 Ga0451577_0008279 Ga0451577_0008279_3190_3783 186
197 3300042876 Ga0451577_0129423 Ga0451577_0129423_77_640 186
198 3300042876 Ga0451577_0269677 Ga0451577_0269677_605_1198 186
199 3300042876 Ga0451577_0332893 Ga0451577_0332893_340_930 186
200 3300042876 Ga0451577_1191170 Ga0451577_1191170_27_605 186
201 3300044712 Ga0453684_0003051 Ga0453684_0003051_22675_23274 186
202 3300044901 Ga0466960_0105960 Ga0466960_0105960_138_707 186
203 3300045051 Ga0451576_1125029 Ga0451576_1125029_48_617 186
204 3300046453 Ga0495627_005662 Ga0495627_005662_3130_3696 186
205 3300046453 Ga0495627_077413 Ga0495627_077413_354_920 186
206 3300046460 Ga0495638_0080269 Ga0495638_0080269_308_874 186
207 3300046471 Ga0495650_0002446 Ga0495650_0002446_2434_3027 186
208 3300046501 Ga0495607_0025737 Ga0495607_0025737_3038_3604 186
209 3300046501 Ga0495607_0164735 Ga0495607_0164735_504_1070 186
210 3300046507 Ga0495606_0345733 Ga0495606_0345733_116_748 186
211 3300046519 Ga0495632_0171761 Ga0495632_0171761_15_647 186
212 3300046522 Ga0495643_0120098 Ga0495643_0120098_623_1255 186
213 3300046525 Ga0495663_0003137 Ga0495663_0003137_1675_2241 186
214 3300046525 Ga0495663_0011672 Ga0495663_0011672_327_893 186
215 3300046558 Ga0495633_0044505 Ga0495633_0044505_361_927 186
216 3300046694 Ga0495649_0020211 Ga0495649_0020211_473_1069 186
217 3300047470 Ga0495681_0045377 Ga0495681_0045377_734_1300 186
218 3300047470 Ga0495681_0045635 Ga0495681_0045635_1123_1755 186
219 3300048090 Ga0495615_0040108 Ga0495615_0040108_195_827 186
220 3300048905 Ga0496102_0065976 Ga0496102_0065976_1066_1626 186
221 3300048908 Ga0496105_0151318 Ga0496105_0151318_259_852 186
222 3300048911 Ga0496108_0075488 Ga0496108_0075488_1129_1698 186
223 3300048911 Ga0496108_0107859 Ga0496108_0107859_1441_2034 186
224 3300048912 Ga0496109_0126552 Ga0496109_0126552_562_1155 186
225 3300048912 Ga0496109_0409026 Ga0496109_0409026_183_752 186
226 3300048914 Ga0496111_0436541 Ga0496111_0436541_265_858 186
227 3300048915 Ga0496112_0141329 Ga0496112_0141329_875_1468 186
228 3300048916 Ga0496113_0026104 Ga0496113_0026104_2378_2971 186
229 3300048919 Ga0496116_0001160 Ga0496116_0001160_28978_29538 186
230 3300049460 Ga0495682_0008116 Ga0495682_0008116_545_1111 186
231 3300049569 Ga0501032_0006498 Ga0501032_0006498_6960_7577 186
232 3300049569 Ga0501032_0039593 Ga0501032_0039593_1105_1716 186
233 3300049571 Ga0501034_0054310 Ga0501034_0054310_1199_1810 186
234 3300049571 Ga0501034_0099210 Ga0501034_0099210_1139_1756 186
235 3300049571 Ga0501034_0099576 Ga0501034_0099576_542_1126 186
236 3300049572 Ga0501036_0141242 Ga0501036_0141242_439_1050 186
237 3300049574 Ga0501038_0067522 Ga0501038_0067522_1627_2238 186
238 3300049575 Ga0501039_0437349 Ga0501039_0437349_188_805 186
239 3300049579 Ga0501043_0319029 Ga0501043_0319029_358_939 186
240 3300049579 Ga0501043_0648749 Ga0501043_0648749_37_621 186
241 3300049580 Ga0501046_0078681 Ga0501046_0078681_1811_2395 186
242 3300049581 Ga0501047_0000446 Ga0501047_0000446_23536_24147 186
243 3300049581 Ga0501047_0057294 Ga0501047_0057294_1509_2093 186
244 3300049581 Ga0501047_0384420 Ga0501047_0384420_385_966 186
245 3300049583 Ga0501067_0000639 Ga0501067_0000639_7197_7808 186
246 3300049584 Ga0501068_0036950 Ga0501068_0036950_2274_2885 186
247 3300049585 Ga0501069_0040644 Ga0501069_0040644_1902_2513 186
248 3300049586 Ga0501070_0071574 Ga0501070_0071574_2179_2790 186
249 3300049588 Ga0501072_0012915 Ga0501072_0012915_3103_3714 186
250 3300049589 Ga0501073_0031075 Ga0501073_0031075_1022_1633 186
251 3300049590 Ga0501074_0003396 Ga0501074_0003396_9517_10128 186
252 3300049679 Ga0501249_036194 Ga0501249_036194_395_1012 186
253 3300049741 Ga0501079_0094593 Ga0501079_0094593_1003_1614 186
254 3300049742 Ga0501080_0000686 Ga0501080_0000686_2179_2790 186
255 3300049744 Ga0501083_0000225 Ga0501083_0000225_23927_24538 186
256 3300049760 Ga0501263_002046 Ga0501263_002046_1185_1745 186
257 3300049763 Ga0501266_000070 Ga0501266_000070_8938_9537 186
258 3300049822 Ga0501035_0315225 Ga0501035_0315225_106_687 186
259 3300049822 Ga0501035_0450932 Ga0501035_0450932_10_594 186
260 3300049823 Ga0501044_0023949 Ga0501044_0023949_755_1366 186
261 3300049823 Ga0501044_0069479 Ga0501044_0069479_2644_3225 186
262 3300049823 Ga0501044_0140868 Ga0501044_0140868_118_702 186
263 3300050493 nmdc:mga0k408_172479_c1 nmdc:mga0k408_172479_c1_234_890 186
264 3300050496 nmdc:mga07m45_33297_c1 nmdc:mga07m45_33297_c1_2243_2812 186
265 3300054114 Ga0501084_0049716 Ga0501084_0049716_2224_2835 186

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12724

Flavodoxin_5

Flavodoxin domain

5

124

0.81

PF03358

FMN_red

NADPH-dependent FMN reductase

9

134

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d7n-assembly1.cif.gz_A the crystal structure of the flavodoxin, wrba-like protein from agrobacterium tumefaciens 0.8849 1 185
5wid-assembly2.cif.gz_B structure of a flavodoxin from the domain archaea 0.8803 3 182
3d7n-assembly1.cif.gz_A the crystal structure of the flavodoxin, wrba-like protein from agrobacterium tumefaciens 0.8795 1 185
2ark-assembly2.cif.gz_E structure of a flavodoxin from aquifex aeolicus 0.8753 1 181
2a5l-assembly1.cif.gz_A the crystal structure of the trp repressor binding protein wrba from pseudomonas aeruginosa 0.875 1 184
ID Description Score Start End Superfamily
af_O33313_1_149_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8741 1 181 3.40.50.360
2a5lA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8686 1 184 3.40.50.360
af_O33313_1_149_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8632 1 181 3.40.50.360
2a5lA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8539 1 184 3.40.50.360
af_K7MW35_1_136_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8537 12 123 3.40.50.360
ID Description Score Start End GO Terms
AF-Q46X69-F1-model_v4 Flavoprotein WrbA 0.9925 1 185 GO:0003955
GO:0009055
GO:0010181
GO:0016020
AF-I8I5S6-F1-model_v4 NADPH-dependent FMN reductase 0.992 1 184 GO:0003955
GO:0009055
GO:0010181
GO:0016020
AF-A0A833KNR6-F1-model_v4 deleted 0.9914 1 175
AF-Q46X69-F1-model_v4 Flavoprotein WrbA 0.9872 1 185 GO:0003955
GO:0009055
GO:0010181
GO:0016020
AF-N9ETE1-F1-model_v4 deleted 0.9841 1 121

Feature Viewer

pLDDT pTM Quality
95.06 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map