F373161

General Info

Members Datasets Scaffolds Average Seq Length
265 169 530 122

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100197436|Ga0070698_1001974361
Length 114
Sequence MPQTAKVVINLATGLEDGERVTVALLVGGAAFLTKEAVRLAVPGYGEAIACDGCPPVPGLLEQYAERGGQLLVCPVCFNARKLNENELVANARIGGATPLWEWIGDDSATVFSY

Samples

Sample ID Description Type Environment
1 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
51 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
61 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
63 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
87 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
88 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
89 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
90 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
91 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
92 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
93 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
94 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
95 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
96 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
97 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
98 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
99 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
100 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
101 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
102 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
103 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
104 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
105 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
106 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
107 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
108 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
109 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
110 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
111 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
112 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
113 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
114 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
115 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
116 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
117 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
118 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
119 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
120 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
121 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
122 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
123 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
124 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
125 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
126 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
127 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
128 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
129 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
130 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
131 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
132 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
146 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
147 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
148 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
149 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
150 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
151 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
152 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
153 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
154 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
155 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
156 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
157 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
158 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
159 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
160 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
162 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
163 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
164 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
165 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
166 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
167 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
168 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
169 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.62
Metatranscriptomes 0.38
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.42
Rhizosphere 91.32
Stem 0
Stem Tuber 0
Unclassified 14.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070698_100197436 3300005471 Unclassified 1948
2 Ga0070658_10121385 3300005327 Bacteria 2171
3 Ga0070658_10632747 3300005327 Bacteria 928
4 Ga0070683_100042813 3300005329 Bacteria 4171
5 Ga0070683_100061693 3300005329 Bacteria 3486
6 Ga0070680_100010669 3300005336 Bacteria 7089
7 Ga0070680_100018009 3300005336 Bacteria 5578
8 Ga0070682_100013854 3300005337 Bacteria 4649
9 Ga0070682_100279969 3300005337 Bacteria 1215
10 Ga0068868_100173441 3300005338 Bacteria 1786
11 Ga0070660_100061123 3300005339 Bacteria 2925
12 Ga0070661_100005024 3300005344 Bacteria 9118
13 Ga0070661_100072246 3300005344 Bacteria 2539
14 Ga0070674_101963899 3300005356 Unclassified 532
15 Ga0070659_100007250 3300005366 Bacteria 8046
16 Ga0070659_101885968 3300005366 Bacteria 536
17 Ga0070714_100021404 3300005435 Bacteria 5292
18 Ga0070713_100043365 3300005436 Bacteria 3677
19 Ga0070663_100102067 3300005455 Bacteria 2142
20 Ga0070681_10000899 3300005458 Bacteria 25153
21 Ga0070681_10016603 3300005458 Bacteria 7351
22 Ga0070706_100472418 3300005467 Unclassified 1167
23 Ga0070706_100737037 3300005467 Bacteria 913
24 Ga0070707_101289890 3300005468 Archaea 697
25 Ga0070698_100088905 3300005471 Bacteria 3073
26 Ga0070698_100273218 3300005471 Unclassified 1622
27 Ga0070699_100444952 3300005518 Bacteria 1174
28 Ga0070679_100016294 3300005530 Bacteria 7162
29 Ga0070679_100017668 3300005530 Bacteria 6905
30 Ga0070679_100023919 3300005530 Bacteria 5985
31 Ga0070684_100012022 3300005535 Bacteria 6919
32 Ga0070684_100015511 3300005535 Bacteria 6208
33 Ga0070697_101132963 3300005536 Unclassified 697
34 Ga0068853_100017496 3300005539 Bacteria 5916
35 Ga0068853_100146823 3300005539 Bacteria 2120
36 Ga0068853_101220833 3300005539 Bacteria 726
37 Ga0070696_100346907 3300005546 Unclassified 1149
38 Ga0070693_100190407 3300005547 Bacteria 1326
39 Ga0070704_100091722 3300005549 Bacteria 2266
40 Ga0068855_100173135 3300005563 Bacteria 2444
41 Ga0068855_100440490 3300005563 Bacteria 1423
42 Ga0068855_100827141 3300005563 Unclassified 983
43 Ga0070664_100200852 3300005564 Bacteria 1779
44 Ga0068857_100710233 3300005577 Unclassified 956
45 Ga0068854_100068729 3300005578 Bacteria 2584
46 Ga0068854_100227725 3300005578 Bacteria 1478
47 Ga0068856_100013327 3300005614 Bacteria 7961
48 Ga0068856_100028952 3300005614 Bacteria 5412
49 Ga0068856_102079267 3300005614 Bacteria 578
50 Ga0068852_100011965 3300005616 Bacteria 6561
51 Ga0068866_10826032 3300005718 Bacteria 646
52 Ga0068861_101390966 3300005719 Bacteria 685
53 Ga0081538_10215306 3300005981 Bacteria 769
54 Ga0070717_10008331 3300006028 Bacteria 7742
55 Ga0070717_10414699 3300006028 Unclassified 1211
56 Ga0070717_10457380 3300006028 Bacteria 1151
57 Ga0070717_11264365 3300006028 Bacteria 671
58 Ga0068871_101977034 3300006358 Bacteria 555
59 Ga0075428_101008392 3300006844 Unclassified 881
60 Ga0075430_100442554 3300006846 Bacteria 1073
61 Ga0075431_100445417 3300006847 Bacteria 1291
62 Ga0075429_101963683 3300006880 Bacteria 507
63 Ga0105240_10016373 3300009093 Bacteria 10039
64 Ga0105245_10417065 3300009098 Bacteria 1345
65 Ga0105247_11372302 3300009101 Unclassified 571
66 Ga0114129_10079822 3300009147 Bacteria 4549
67 Ga0105243_11421264 3300009148 Unclassified 715
68 Ga0105241_11670439 3300009174 Bacteria 618
69 Ga0105241_12633787 3300009174 Bacteria 505
70 Ga0105237_10019734 3300009545 Bacteria 6960
71 Ga0105238_10016732 3300009551 Bacteria 7432
72 Ga0105238_10479475 3300009551 Bacteria 1243
73 Ga0105239_10400852 3300010375 Bacteria 1552
74 Ga0105239_10429361 3300010375 Bacteria 1498
75 Ga0105246_10676029 3300011119 Bacteria 902
76 Ga0157316_1032817 3300012510 Bacteria 638
77 Ga0157373_10058382 3300013100 Bacteria 2736
78 Ga0157371_10047782 3300013102 Bacteria 3042
79 Ga0157370_10020193 3300013104 Bacteria 6658
80 Ga0157370_10999523 3300013104 Bacteria 757
81 Ga0157370_11064104 3300013104 Bacteria 731
82 Ga0157369_10007795 3300013105 Bacteria 12321
83 Ga0157369_10023318 3300013105 Bacteria 6893
84 Ga0157374_11287176 3300013296 Unclassified 753
85 Ga0157372_10018828 3300013307 Bacteria 7429
86 Ga0157372_10038149 3300013307 Bacteria 5302
87 Ga0163163_10616320 3300014325 Bacteria 1149
88 Ga0157377_10061817 3300014745 Bacteria 2141
89 Ga0157379_11337469 3300014968 Bacteria 693
90 Ga0182007_10204408 3300015262 Bacteria 692
91 Ga0206356_11058509 3300020070 Bacteria 743
92 Ga0213876_10035708 3300021384 Bacteria 2622
93 Ga0213876_10083940 3300021384 Bacteria 1685
94 Ga0207705_10111780 3300025909 Unclassified 2019
95 Ga0207705_10423638 3300025909 Bacteria 1031
96 Ga0207684_10268002 3300025910 Unclassified 1473
97 Ga0207684_10678624 3300025910 Bacteria 877
98 Ga0207707_10007431 3300025912 Bacteria 9546
99 Ga0207707_10017618 3300025912 Bacteria 6229
100 Ga0207695_10058359 3300025913 Bacteria 4006
101 Ga0207671_10295170 3300025914 Bacteria 1280
102 Ga0207660_10007687 3300025917 Bacteria 6981
103 Ga0207660_10008579 3300025917 Bacteria 6612
104 Ga0207660_10225558 3300025917 Bacteria 1472
105 Ga0207657_10023200 3300025919 Bacteria 5784
106 Ga0207649_10097239 3300025920 Bacteria 1941
107 Ga0207649_10293396 3300025920 Bacteria 1186
108 Ga0207652_10013838 3300025921 Bacteria 6528
109 Ga0207652_10033699 3300025921 Bacteria 4313
110 Ga0207652_10334870 3300025921 Bacteria 1366
111 Ga0207694_10750823 3300025924 Bacteria 823
112 Ga0207687_10544656 3300025927 Bacteria 973
113 Ga0207664_10106833 3300025929 Bacteria 2322
114 Ga0207664_10620295 3300025929 Bacteria 972
115 Ga0207664_10719669 3300025929 Unclassified 898
116 Ga0207690_10032376 3300025932 Bacteria 3355
117 Ga0207690_10351465 3300025932 Unclassified 1166
118 Ga0207690_11287819 3300025932 Bacteria 611
119 Ga0207661_10002546 3300025944 Bacteria 12550
120 Ga0207661_10020352 3300025944 Bacteria 4958
121 Ga0207679_10044242 3300025945 Bacteria 3212
122 Ga0207667_10385900 3300025949 Bacteria 1427
123 Ga0207640_12044848 3300025981 Bacteria 519
124 Ga0207639_10022426 3300026041 Bacteria 4548
125 Ga0207639_10032618 3300026041 Bacteria 3836
126 Ga0207678_10136472 3300026067 Bacteria 2093
127 Ga0207702_10148264 3300026078 Bacteria 2131
128 Ga0207702_10386171 3300026078 Bacteria 1347
129 Ga0207674_10028459 3300026116 Bacteria 5898
130 Ga0207675_100477211 3300026118 Bacteria 1239
131 Ga0207698_10005877 3300026142 Bacteria 7626
132 Ga0307408_101179268 3300031548 Bacteria 714
133 Ga0307406_10655230 3300031901 Bacteria 872
134 Ga0307416_102880334 3300032002 Bacteria 576
135 Ga0307415_100487976 3300032126 Bacteria 1074
136 Ga0373943_0888925 3300035170 Bacteria 532
137 Ga0373927_0518604 3300035695 Bacteria 788
138 Ga0373925_0405658 3300037068 Bacteria 1112
139 Ga0395899_0138084 3300037312 Unclassified 1736
140 Ga0395899_0180829 3300037312 Bacteria 1481
141 Ga0395900_0004399 3300037418 Bacteria 14940
142 Ga0395900_0034047 3300037418 Bacteria 5244
143 Ga0395900_0074792 3300037418 Bacteria 3482
144 Ga0395900_0789113 3300037418 Bacteria 878
145 Ga0395900_1876078 3300037418 Unclassified 510
146 Ga0395898_0031321 3300037466 Bacteria 5316
147 Ga0395898_0302554 3300037466 Bacteria 1525
148 Ga0395898_0389332 3300037466 Unclassified 1329
149 Ga0395898_1587747 3300037466 Bacteria 579
150 Ga0395905_0004254 3300037471 Bacteria 14952
151 Ga0395905_0009937 3300037471 Bacteria 9271
152 Ga0395905_0880599 3300037471 Unclassified 798
153 Ga0436364_1078181 3300037853 Unclassified 660
154 Ga0395901_0030719 3300038443 Bacteria 5535
155 Ga0395901_0184143 3300038443 Bacteria 2190
156 Ga0436365_1327609 3300039437 Bacteria 21571
157 Ga0436365_1764924 3300039437 Bacteria 2614
158 Ga0436363_0942293 3300039450 Unclassified 1689
159 Ga0436362_0945398 3300039453 Bacteria 1555
160 Ga0466965_0352807 3300044683 Bacteria 806
161 Ga0466965_0616012 3300044683 Bacteria 618
162 Ga0466966_0073688 3300044684 Bacteria 2135
163 Ga0466966_0133040 3300044684 Bacteria 1522
164 Ga0466966_0756845 3300044684 Bacteria 586
165 Ga0466961_0159880 3300044693 Bacteria 1404
166 Ga0466961_0486217 3300044693 Bacteria 746
167 Ga0466961_0584417 3300044693 Unclassified 672
168 Ga0466963_0035079 3300044694 Bacteria 3267
169 Ga0466964_0032758 3300044706 Bacteria 2067
170 Ga0466964_0527187 3300044706 Bacteria 638
171 Ga0466971_0082857 3300044719 Bacteria 1464
172 Ga0466971_0212114 3300044719 Unclassified 916
173 Ga0466968_0057809 3300044735 Unclassified 1668
174 Ga0466968_0065993 3300044735 Unclassified 1567
175 Ga0466968_0180331 3300044735 Unclassified 982
176 Ga0466970_0032439 3300044765 Bacteria 2760
177 Ga0466957_0124514 3300044842 Bacteria 1646
178 Ga0466957_0313852 3300044842 Bacteria 1056
179 Ga0466960_0949785 3300044901 Unclassified 526
180 Ga0466959_0085125 3300045049 Bacteria 2276
181 Ga0466959_0087010 3300045049 Bacteria 2248
182 Ga0466959_0229312 3300045049 Bacteria 1286
183 Ga0466959_0378821 3300045049 Bacteria 963
184 Ga0466959_1164775 3300045049 Bacteria 512
185 Ga0451576_1969926 3300045051 Bacteria 602
186 Ga0466958_0072790 3300045836 Bacteria 2105
187 Ga0466958_0146294 3300045836 Bacteria 1489
188 Ga0466958_0306218 3300045836 Bacteria 1020
189 Ga0466958_0897587 3300045836 Bacteria 578
190 Ga0466967_0015036 3300045976 Bacteria 6054
191 Ga0466967_0052851 3300045976 Bacteria 3569
192 Ga0466967_0067980 3300045976 Bacteria 3180
193 Ga0466967_0570605 3300045976 Bacteria 1115
194 Ga0495664_0053876 3300046477 Bacteria 2392
195 Ga0495652_0686322 3300046529 Bacteria 690
196 Ga0495652_0867042 3300046529 Bacteria 597
197 Ga0495609_0422081 3300046538 Bacteria 532
198 Ga0495676_1042713 3300047321 Bacteria 521
199 Ga0495593_0509853 3300047673 Bacteria 603
200 Ga0496101_0225019 3300048904 Bacteria 1457
201 Ga0496101_0873440 3300048904 Bacteria 708
202 Ga0496104_0249094 3300048907 Bacteria 1689
203 Ga0496105_0615486 3300048908 Bacteria 841
204 Ga0496108_0012822 3300048911 Bacteria 6826
205 Ga0496108_1067429 3300048911 Unclassified 687
206 Ga0496109_0037855 3300048912 Bacteria 4359
207 Ga0496110_0007321 3300048913 Bacteria 8807
208 Ga0496111_0022518 3300048914 Bacteria 4412
209 Ga0496111_1332214 3300048914 Unclassified 505
210 Ga0496112_0059527 3300048915 Bacteria 3764
211 Ga0496112_0450793 3300048915 Unclassified 1224
212 Ga0496113_0210610 3300048916 Bacteria 1547
213 Ga0496113_0296652 3300048916 Bacteria 1294
214 Ga0496114_0114288 3300048917 Bacteria 2315
215 Ga0496114_0440421 3300048917 Bacteria 1154
216 Ga0496115_0395192 3300048918 Bacteria 1122
217 Ga0501031_0412767 3300049568 Unclassified 873
218 Ga0501032_0096173 3300049569 Bacteria 1963
219 Ga0501032_0900605 3300049569 Unclassified 557
220 Ga0501034_0032817 3300049571 Bacteria 5272
221 Ga0501034_1218747 3300049571 Bacteria 631
222 Ga0501036_0006603 3300049572 Bacteria 9425
223 Ga0501038_0032658 3300049574 Bacteria 4590
224 Ga0501039_0003192 3300049575 Bacteria 12257
225 Ga0501040_0002485 3300049576 Bacteria 11878
226 Ga0501041_0003371 3300049577 Bacteria 9195
227 Ga0501041_0956259 3300049577 Bacteria 551
228 Ga0501042_0002258 3300049578 Bacteria 11761
229 Ga0501043_0003886 3300049579 Bacteria 12267
230 Ga0501046_0007444 3300049580 Bacteria 9622
231 Ga0501047_0275292 3300049581 Unclassified 1529
232 Ga0501048_0005165 3300049582 Bacteria 9950
233 Ga0501067_0000359 3300049583 Bacteria 24901
234 Ga0501068_0019802 3300049584 Bacteria 3912
235 Ga0501068_0035994 3300049584 Unclassified 2958
236 Ga0501069_0003425 3300049585 Bacteria 8147
237 Ga0501069_0114733 3300049585 Unclassified 1536
238 Ga0501070_0021104 3300049586 Bacteria 5465
239 Ga0501070_0098250 3300049586 Bacteria 2421
240 Ga0501071_0002233 3300049587 Bacteria 11647
241 Ga0501072_0003116 3300049588 Bacteria 12472
242 Ga0501073_0012858 3300049589 Bacteria 6102
243 Ga0501073_0410626 3300049589 Unclassified 935
244 Ga0501074_0004169 3300049590 Bacteria 10323
245 Ga0501074_0068804 3300049590 Bacteria 2545
246 Ga0501075_0005142 3300049591 Bacteria 8948
247 Ga0501076_0005920 3300049592 Bacteria 8826
248 Ga0501077_0022973 3300049593 Bacteria 3953
249 Ga0501079_0007283 3300049741 Bacteria 8352
250 Ga0501080_0002060 3300049742 Bacteria 17417
251 Ga0501080_0040889 3300049742 Bacteria 4323
252 Ga0501081_0003028 3300049743 Bacteria 10660
253 Ga0501083_0024380 3300049744 Bacteria 4191
254 Ga0501035_0028459 3300049822 Bacteria 5099
255 Ga0501045_0002927 3300049824 Bacteria 11680
256 nmdc:mga05p37_930324_c1 3300050507 Bacteria 933
257 nmdc:mga09592_1710408_c1 3300050508 Bacteria 507
258 nmdc:mga0qj67_922680_c1 3300050509 Bacteria 687
259 nmdc:mga06r32_778244_c1 3300050510 Bacteria 919
260 Ga0501084_0004688 3300054114 Bacteria 11166
261 Ga0501084_0858404 3300054114 Bacteria 764
262 Ga0501082_0014218 3300060353 Bacteria 6850
263 Ga0466962_0018113 3300061719 Bacteria 3387
264 Ga0530510_0008216 3300061734 Bacteria 7280
265 Ga0530510_0012286 3300061734 Bacteria 6011
266 Ga0070698_100197436
267 Ga0070658_10121385
268 Ga0070658_10632747
269 Ga0070683_100042813
270 Ga0070683_100061693
271 Ga0070680_100010669
272 Ga0070680_100018009
273 Ga0070682_100013854
274 Ga0070682_100279969
275 Ga0068868_100173441
276 Ga0070660_100061123
277 Ga0070661_100005024
278 Ga0070661_100072246
279 Ga0070674_101963899
280 Ga0070659_100007250
281 Ga0070659_101885968
282 Ga0070714_100021404
283 Ga0070713_100043365
284 Ga0070663_100102067
285 Ga0070681_10000899
286 Ga0070681_10016603
287 Ga0070706_100472418
288 Ga0070706_100737037
289 Ga0070707_101289890
290 Ga0070698_100088905
291 Ga0070698_100273218
292 Ga0070699_100444952
293 Ga0070679_100016294
294 Ga0070679_100017668
295 Ga0070679_100023919
296 Ga0070684_100012022
297 Ga0070684_100015511
298 Ga0070697_101132963
299 Ga0068853_100017496
300 Ga0068853_100146823
301 Ga0068853_101220833
302 Ga0070696_100346907
303 Ga0070693_100190407
304 Ga0070704_100091722
305 Ga0068855_100173135
306 Ga0068855_100440490
307 Ga0068855_100827141
308 Ga0070664_100200852
309 Ga0068857_100710233
310 Ga0068854_100068729
311 Ga0068854_100227725
312 Ga0068856_100013327
313 Ga0068856_100028952
314 Ga0068856_102079267
315 Ga0068852_100011965
316 Ga0068866_10826032
317 Ga0068861_101390966
318 Ga0081538_10215306
319 Ga0070717_10008331
320 Ga0070717_10414699
321 Ga0070717_10457380
322 Ga0070717_11264365
323 Ga0068871_101977034
324 Ga0075428_101008392
325 Ga0075430_100442554
326 Ga0075431_100445417
327 Ga0075429_101963683
328 Ga0105240_10016373
329 Ga0105245_10417065
330 Ga0105247_11372302
331 Ga0114129_10079822
332 Ga0105243_11421264
333 Ga0105241_11670439
334 Ga0105241_12633787
335 Ga0105237_10019734
336 Ga0105238_10016732
337 Ga0105238_10479475
338 Ga0105239_10400852
339 Ga0105239_10429361
340 Ga0105246_10676029
341 Ga0157316_1032817
342 Ga0157373_10058382
343 Ga0157371_10047782
344 Ga0157370_10020193
345 Ga0157370_10999523
346 Ga0157370_11064104
347 Ga0157369_10007795
348 Ga0157369_10023318
349 Ga0157374_11287176
350 Ga0157372_10018828
351 Ga0157372_10038149
352 Ga0163163_10616320
353 Ga0157377_10061817
354 Ga0157379_11337469
355 Ga0182007_10204408
356 Ga0206356_11058509
357 Ga0213876_10035708
358 Ga0213876_10083940
359 Ga0207705_10111780
360 Ga0207705_10423638
361 Ga0207684_10268002
362 Ga0207684_10678624
363 Ga0207707_10007431
364 Ga0207707_10017618
365 Ga0207695_10058359
366 Ga0207671_10295170
367 Ga0207660_10007687
368 Ga0207660_10008579
369 Ga0207660_10225558
370 Ga0207657_10023200
371 Ga0207649_10097239
372 Ga0207649_10293396
373 Ga0207652_10013838
374 Ga0207652_10033699
375 Ga0207652_10334870
376 Ga0207694_10750823
377 Ga0207687_10544656
378 Ga0207664_10106833
379 Ga0207664_10620295
380 Ga0207664_10719669
381 Ga0207690_10032376
382 Ga0207690_10351465
383 Ga0207690_11287819
384 Ga0207661_10002546
385 Ga0207661_10020352
386 Ga0207679_10044242
387 Ga0207667_10385900
388 Ga0207640_12044848
389 Ga0207639_10022426
390 Ga0207639_10032618
391 Ga0207678_10136472
392 Ga0207702_10148264
393 Ga0207702_10386171
394 Ga0207674_10028459
395 Ga0207675_100477211
396 Ga0207698_10005877
397 Ga0307408_101179268
398 Ga0307406_10655230
399 Ga0307416_102880334
400 Ga0307415_100487976
401 Ga0373943_0888925
402 Ga0373927_0518604
403 Ga0373925_0405658
404 Ga0395899_0138084
405 Ga0395899_0180829
406 Ga0395900_0004399
407 Ga0395900_0034047
408 Ga0395900_0074792
409 Ga0395900_0789113
410 Ga0395900_1876078
411 Ga0395898_0031321
412 Ga0395898_0302554
413 Ga0395898_0389332
414 Ga0395898_1587747
415 Ga0395905_0004254
416 Ga0395905_0009937
417 Ga0395905_0880599
418 Ga0436364_1078181
419 Ga0395901_0030719
420 Ga0395901_0184143
421 Ga0436365_1327609
422 Ga0436365_1764924
423 Ga0436363_0942293
424 Ga0436362_0945398
425 Ga0466965_0352807
426 Ga0466965_0616012
427 Ga0466966_0073688
428 Ga0466966_0133040
429 Ga0466966_0756845
430 Ga0466961_0159880
431 Ga0466961_0486217
432 Ga0466961_0584417
433 Ga0466963_0035079
434 Ga0466964_0032758
435 Ga0466964_0527187
436 Ga0466971_0082857
437 Ga0466971_0212114
438 Ga0466968_0057809
439 Ga0466968_0065993
440 Ga0466968_0180331
441 Ga0466970_0032439
442 Ga0466957_0124514
443 Ga0466957_0313852
444 Ga0466960_0949785
445 Ga0466959_0085125
446 Ga0466959_0087010
447 Ga0466959_0229312
448 Ga0466959_0378821
449 Ga0466959_1164775
450 Ga0451576_1969926
451 Ga0466958_0072790
452 Ga0466958_0146294
453 Ga0466958_0306218
454 Ga0466958_0897587
455 Ga0466967_0015036
456 Ga0466967_0052851
457 Ga0466967_0067980
458 Ga0466967_0570605
459 Ga0495664_0053876
460 Ga0495652_0686322
461 Ga0495652_0867042
462 Ga0495609_0422081
463 Ga0495676_1042713
464 Ga0495593_0509853
465 Ga0496101_0225019
466 Ga0496101_0873440
467 Ga0496104_0249094
468 Ga0496105_0615486
469 Ga0496108_0012822
470 Ga0496108_1067429
471 Ga0496109_0037855
472 Ga0496110_0007321
473 Ga0496111_0022518
474 Ga0496111_1332214
475 Ga0496112_0059527
476 Ga0496112_0450793
477 Ga0496113_0210610
478 Ga0496113_0296652
479 Ga0496114_0114288
480 Ga0496114_0440421
481 Ga0496115_0395192
482 Ga0501031_0412767
483 Ga0501032_0096173
484 Ga0501032_0900605
485 Ga0501034_0032817
486 Ga0501034_1218747
487 Ga0501036_0006603
488 Ga0501038_0032658
489 Ga0501039_0003192
490 Ga0501040_0002485
491 Ga0501041_0003371
492 Ga0501041_0956259
493 Ga0501042_0002258
494 Ga0501043_0003886
495 Ga0501046_0007444
496 Ga0501047_0275292
497 Ga0501048_0005165
498 Ga0501067_0000359
499 Ga0501068_0019802
500 Ga0501068_0035994
501 Ga0501069_0003425
502 Ga0501069_0114733
503 Ga0501070_0021104
504 Ga0501070_0098250
505 Ga0501071_0002233
506 Ga0501072_0003116
507 Ga0501073_0012858
508 Ga0501073_0410626
509 Ga0501074_0004169
510 Ga0501074_0068804
511 Ga0501075_0005142
512 Ga0501076_0005920
513 Ga0501077_0022973
514 Ga0501079_0007283
515 Ga0501080_0002060
516 Ga0501080_0040889
517 Ga0501081_0003028
518 Ga0501083_0024380
519 Ga0501035_0028459
520 Ga0501045_0002927
521 nmdc:mga05p37_930324_c1
522 nmdc:mga09592_1710408_c1
523 nmdc:mga0qj67_922680_c1
524 nmdc:mga06r32_778244_c1
525 Ga0501084_0004688
526 Ga0501084_0858404
527 Ga0501082_0014218
528 Ga0466962_0018113
529 Ga0530510_0008216
530 Ga0530510_0012286

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02635

DsrE

DsrE/DsrF-like family

3

113

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
1jx7-assembly1.cif.gz_E crystal structure of ychn protein from e.coli 0.7888 1 118
1jx7-assembly1.cif.gz_E crystal structure of ychn protein from e.coli 0.783 1 118
4j33-assembly2.cif.gz_B crystal structure of kynurenine 3-monooxygenase (kmo-394) 0.7789 1 45
3pnx-assembly2.cif.gz_E crystal structure of a putative sulfurtransferase dsre (swol_2425) from syntrophomonas wolfei str. goettingen at 1.92 a resolution 0.7766 1 118
3mc3-assembly1.cif.gz_A crystal structure of dsre/dsrf-like family protein (np_342589.1) from sulfolobus solfataricus at 1.49 a resolution 0.776 2 118
ID Description Score Start End Superfamily
af_Q18081_1_278_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9097 2 39 3.40.50.2000
af_Q17399_1_268_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9063 2 39 3.40.50.2000
af_Q10941_1_278_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8845 2 39 3.40.50.2000
af_Q22181_1_272_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8478 2 38 3.40.50.2000
af_Q58170_143_270_3.40.1260.10 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like 0.8433 2 111 3.40.1260.10
ID Description Score Start End GO Terms
AF-A1SLX6-F1-model_v4 Peroxiredoxins-like protein 0.9822 1 120
AF-Q0RSC7-F1-model_v4 Uncharacterized protein 0.9815 2 120
AF-A0A1H5MH28-F1-model_v4 Predicted peroxiredoxin 0.9784 3 120
AF-A1SLX6-F1-model_v4 Peroxiredoxins-like protein 0.9742 1 120
AF-A0A6I3IN15-F1-model_v4 Peroxiredoxin 0.9721 1 120

Map