F373109

General Info

Members Datasets Scaffolds Average Seq Length
265 153 265 258

Family's Representative Sequence

Representative Sequence 3300005340|Ga0070689_100284746|Ga0070689_1002847462
Length 269
Sequence MTELVAANIGVSRGGRAILSDVSLRAGGGEFIAVIGPNGAGKSTLLSALAGLLPPSSGAIRLDGRRITSFGTSELARRRAYLPQDPRCEWPISVERLVGLGLTPVLPAFGGFSRAQQTRITQVLSDCDLLAQRYQSATTLSGGEFARAMLARALVGDPQILIVDEPMEGLDPRHRIEAASRLRTLSSEGKLVIASVHDLTLAMRYATRIVALYHGRVAADGPALETMNPDLLRRIFEVDAEIAGTEVRAYVDYLAPLPSRHAPDERISP

Samples

Sample ID Description Type Environment
1 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
28 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
59 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
60 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
96 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
97 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
98 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
99 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
100 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
101 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
102 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
103 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
104 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
105 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
106 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
107 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
108 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
109 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
110 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
111 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
112 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
113 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
114 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
115 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
116 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
117 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
118 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
119 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
120 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
121 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
122 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
123 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
137 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
138 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
139 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
140 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
141 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
142 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
145 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
146 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
147 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
148 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
149 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
150 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
151 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
152 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
153 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.91
Nodule 0
Rhizoplane 1.51
Rhizosphere 92.45
Stem 0
Stem Tuber 0
Unclassified 1.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1000003 3300003214 Bacteria 694080
2 rootH2_10032179 3300003320 Bacteria 4218
3 Ga0070658_10014407 3300005327 Bacteria 6344
4 Ga0070658_10098866 3300005327 Bacteria 2411
5 Ga0070670_100215087 3300005331 Bacteria 1671
6 Ga0070670_100680805 3300005331 Bacteria 924
7 Ga0068869_100011996 3300005334 Bacteria 5704
8 Ga0070666_10026431 3300005335 Bacteria 3792
9 Ga0068868_100264044 3300005338 Bacteria 1453
10 Ga0070660_100239256 3300005339 Bacteria 1478
11 Ga0070689_100284746 3300005340 Bacteria 1372
12 Ga0070671_100045925 3300005355 Bacteria 3632
13 Ga0070671_100197854 3300005355 Bacteria 1704
14 Ga0070674_100233743 3300005356 Bacteria 1436
15 Ga0070673_100077596 3300005364 Bacteria 2685
16 Ga0070673_100443924 3300005364 Bacteria 1166
17 Ga0070659_100025627 3300005366 Bacteria 4532
18 Ga0070667_100457156 3300005367 Bacteria 1167
19 Ga0070713_100186497 3300005436 Bacteria 1867
20 Ga0070678_100005418 3300005456 Bacteria 7368
21 Ga0070678_100141019 3300005456 Bacteria 1929
22 Ga0070678_100367135 3300005456 Bacteria 1242
23 Ga0070662_100291939 3300005457 Bacteria 1322
24 Ga0070681_10058482 3300005458 Bacteria 3835
25 Ga0070681_10070763 3300005458 Bacteria 3453
26 Ga0070681_10101268 3300005458 Bacteria 2826
27 Ga0070679_100007818 3300005530 Bacteria 10024
28 Ga0070679_100028476 3300005530 Bacteria 5508
29 Ga0070679_100066055 3300005530 Bacteria 3606
30 Ga0070679_100221055 3300005530 Bacteria 1855
31 Ga0070684_100049070 3300005535 Bacteria 3663
32 Ga0070684_100111297 3300005535 Bacteria 2456
33 Ga0068853_100435310 3300005539 Bacteria 1232
34 Ga0070665_100002501 3300005548 Bacteria 20214
35 Ga0070665_100024688 3300005548 Bacteria 6056
36 Ga0070665_100026386 3300005548 Bacteria 5851
37 Ga0068855_100062254 3300005563 Bacteria 4356
38 Ga0068855_100113358 3300005563 Bacteria 3110
39 Ga0068855_100442882 3300005563 Bacteria 1418
40 Ga0068857_100127173 3300005577 Bacteria 2297
41 Ga0068856_100100343 3300005614 Bacteria 2887
42 Ga0068856_100364477 3300005614 Bacteria 1464
43 Ga0068856_100714254 3300005614 Bacteria 1022
44 Ga0068864_100003148 3300005618 Bacteria 13637
45 Ga0068864_100631517 3300005618 Bacteria 1041
46 Ga0068866_10119863 3300005718 Bacteria 1481
47 Ga0068870_10048892 3300005840 Bacteria 2228
48 Ga0068863_100013190 3300005841 Bacteria 7970
49 Ga0068863_100224181 3300005841 Bacteria 1812
50 Ga0068858_100024348 3300005842 Bacteria 5641
51 Ga0068858_100029038 3300005842 Bacteria 5135
52 Ga0068858_100029459 3300005842 Bacteria 5098
53 Ga0068858_100657906 3300005842 Bacteria 1018
54 Ga0068860_100211251 3300005843 Bacteria 1882
55 Ga0097621_100046017 3300006237 Bacteria 3528
56 Ga0097621_100097335 3300006237 Bacteria 2470
57 Ga0068871_100000927 3300006358 Bacteria 19570
58 Ga0068871_100007188 3300006358 Bacteria 7942
59 Ga0068871_100562899 3300006358 Bacteria 1033
60 Ga0068865_100007071 3300006881 Bacteria 6892
61 Ga0105240_10193859 3300009093 Bacteria 2387
62 Ga0105240_10281066 3300009093 Bacteria 1912
63 Ga0105240_10717592 3300009093 Bacteria 1090
64 Ga0105240_10790412 3300009093 Bacteria 1029
65 Ga0105245_10139675 3300009098 Bacteria 2280
66 Ga0105247_10108326 3300009101 Bacteria 1785
67 Ga0105243_10004314 3300009148 Bacteria 11257
68 Ga0105241_10091374 3300009174 Bacteria 2402
69 Ga0105241_10201274 3300009174 Bacteria 1663
70 Ga0105241_10249845 3300009174 Bacteria 1503
71 Ga0105242_10022426 3300009176 Bacteria 4966
72 Ga0105242_10096866 3300009176 Bacteria 2493
73 Ga0105248_10026682 3300009177 Bacteria 6423
74 Ga0105248_10029271 3300009177 Bacteria 6143
75 Ga0105237_10097587 3300009545 Bacteria 2929
76 Ga0105237_10279302 3300009545 Bacteria 1673
77 Ga0105237_10300702 3300009545 Bacteria 1608
78 Ga0105237_10309775 3300009545 Bacteria 1582
79 Ga0105237_10777905 3300009545 Unclassified 964
80 Ga0105238_10021937 3300009551 Bacteria 6506
81 Ga0105238_10079466 3300009551 Bacteria 3270
82 Ga0105238_10144058 3300009551 Bacteria 2359
83 Ga0105238_10398897 3300009551 Bacteria 1368
84 Ga0105238_10468782 3300009551 Bacteria 1258
85 Ga0105238_10628255 3300009551 Bacteria 1083
86 Ga0105249_10195715 3300009553 Bacteria 1975
87 Ga0105249_10512189 3300009553 Bacteria 1246
88 Ga0105239_10097738 3300010375 Bacteria 3245
89 Ga0105239_10165074 3300010375 Bacteria 2476
90 Ga0105239_10399810 3300010375 Bacteria 1555
91 Ga0105246_10005608 3300011119 Bacteria 7655
92 Ga0157370_10020483 3300013104 Bacteria 6605
93 Ga0157370_10211220 3300013104 Bacteria 1799
94 Ga0157369_10140496 3300013105 Bacteria 2556
95 Ga0157369_10307211 3300013105 Bacteria 1649
96 Ga0157374_10094172 3300013296 Bacteria 2862
97 Ga0157374_10340340 3300013296 Bacteria 1489
98 Ga0157374_10577225 3300013296 Bacteria 1133
99 Ga0157378_10089318 3300013297 Bacteria 2798
100 Ga0157378_10291612 3300013297 Bacteria 1576
101 Ga0163162_10100423 3300013306 Bacteria 2985
102 Ga0163162_10198764 3300013306 Bacteria 2133
103 Ga0163162_10370242 3300013306 Bacteria 1566
104 Ga0163162_10545506 3300013306 Bacteria 1288
105 Ga0157372_10251970 3300013307 Bacteria 2050
106 Ga0157375_10037102 3300013308 Bacteria 4667
107 Ga0157375_10373626 3300013308 Bacteria 1592
108 Ga0157375_10894173 3300013308 Bacteria 1032
109 Ga0163163_10000236 3300014325 Bacteria 56198
110 Ga0163163_10238126 3300014325 Bacteria 1869
111 Ga0157380_10385264 3300014326 Bacteria 1324
112 Ga0157379_10002565 3300014968 Bacteria 15242
113 Ga0157379_10038945 3300014968 Bacteria 4240
114 Ga0163161_10006802 3300017792 Bacteria 7904
115 Ga0209233_1000015 3300025261 Bacteria 980563
116 Ga0209233_1010534 3300025261 Bacteria 2765
117 Ga0209758_1000013 3300025297 Bacteria 873003
118 Ga0207642_10226988 3300025899 Bacteria 1047
119 Ga0207710_10088595 3300025900 Bacteria 1445
120 Ga0207645_10009434 3300025907 Bacteria 6752
121 Ga0207705_10035470 3300025909 Bacteria 3568
122 Ga0207705_10035756 3300025909 Bacteria 3554
123 Ga0207705_10113704 3300025909 Bacteria 2002
124 Ga0207654_10006507 3300025911 Bacteria 5878
125 Ga0207654_10040045 3300025911 Bacteria 2639
126 Ga0207654_10162342 3300025911 Bacteria 1444
127 Ga0207707_10094314 3300025912 Bacteria 2615
128 Ga0207707_10129097 3300025912 Bacteria 2211
129 Ga0207695_10048720 3300025913 Bacteria 4473
130 Ga0207671_10146886 3300025914 Bacteria 1819
131 Ga0207660_10067808 3300025917 Bacteria 2586
132 Ga0207657_10222507 3300025919 Bacteria 1512
133 Ga0207652_10057476 3300025921 Bacteria 3350
134 Ga0207652_10088972 3300025921 Bacteria 2710
135 Ga0207652_10231464 3300025921 Bacteria 1665
136 Ga0207652_10236103 3300025921 Bacteria 1648
137 Ga0207694_10413210 3300025924 Bacteria 1123
138 Ga0207650_10134863 3300025925 Bacteria 1936
139 Ga0207687_10103524 3300025927 Bacteria 2099
140 Ga0207644_10161409 3300025931 Bacteria 1742
141 Ga0207706_10018332 3300025933 Bacteria 6299
142 Ga0207706_10160371 3300025933 Bacteria 1977
143 Ga0207686_10017099 3300025934 Bacteria 4080
144 Ga0207686_10057298 3300025934 Bacteria 2452
145 Ga0207670_10045227 3300025936 Bacteria 2917
146 Ga0207670_10119149 3300025936 Bacteria 1916
147 Ga0207704_10007945 3300025938 Bacteria 5044
148 Ga0207691_10167059 3300025940 Bacteria 1928
149 Ga0207691_10514183 3300025940 Bacteria 1016
150 Ga0207711_10234977 3300025941 Bacteria 1680
151 Ga0207661_10066766 3300025944 Bacteria 2923
152 Ga0207661_10395255 3300025944 Bacteria 1253
153 Ga0207667_10095738 3300025949 Bacteria 3064
154 Ga0207651_10002942 3300025960 Bacteria 8236
155 Ga0207651_10143078 3300025960 Bacteria 1850
156 Ga0207658_10045897 3300025986 Bacteria 3187
157 Ga0207658_10096291 3300025986 Bacteria 2308
158 Ga0207658_10137141 3300025986 Bacteria 1975
159 Ga0207677_10311062 3300026023 Bacteria 1305
160 Ga0207703_10003774 3300026035 Bacteria 12591
161 Ga0207703_10023199 3300026035 Bacteria 4874
162 Ga0207703_10143842 3300026035 Bacteria 2072
163 Ga0207678_10192558 3300026067 Bacteria 1743
164 Ga0207702_10065945 3300026078 Bacteria 3102
165 Ga0207702_10206525 3300026078 Bacteria 1824
166 Ga0207702_10408511 3300026078 Bacteria 1311
167 Ga0207641_10151562 3300026088 Bacteria 2100
168 Ga0207648_10044009 3300026089 Bacteria 3918
169 Ga0207676_10003920 3300026095 Bacteria 10504
170 Ga0207674_10217669 3300026116 Bacteria 1858
171 Ga0207683_10010569 3300026121 Bacteria 7875
172 Ga0207683_10014265 3300026121 Bacteria 6770
173 Ga0207683_10037815 3300026121 Bacteria 4205
174 Ga0207683_10269889 3300026121 Bacteria 1554
175 Ga0268266_10001126 3300028379 Bacteria 33313
176 Ga0268266_10132879 3300028379 Bacteria 2227
177 Ga0268266_10194380 3300028379 Bacteria 1853
178 Ga0268266_10361383 3300028379 Bacteria 1366
179 Ga0265337_1019388 3300028556 Bacteria 2144
180 Ga0265338_10019891 3300028800 Bacteria 7093
181 Ga0265332_10005130 3300031238 Bacteria 6071
182 Ga0265325_10022176 3300031241 Bacteria 3482
183 Ga0265325_10135177 3300031241 Bacteria 1177
184 Ga0265329_10047695 3300031242 Bacteria 1367
185 Ga0265340_10026326 3300031247 Bacteria 2941
186 Ga0265316_10130193 3300031344 Bacteria 1896
187 Ga0265313_10033271 3300031595 Bacteria 2622
188 Ga0307516_10063491 3300031730 Bacteria 3575
189 Ga0373936_0009401 3300035113 Bacteria 3685
190 Ga0395900_0128909 3300037418 Bacteria 2593
191 Ga0395901_0089061 3300038443 Bacteria 3229
192 Ga0436361_0537346 3300039447 Bacteria 1306
193 Ga0495606_0020873 3300046507 Bacteria 4813
194 Ga0495606_0263680 3300046507 Bacteria 950
195 Ga0495628_0255600 3300046516 Bacteria 1307
196 Ga0495622_0009366 3300046557 Bacteria 4530
197 Ga0495668_0158487 3300046616 Bacteria 1240
198 Ga0495625_0066030 3300046660 Bacteria 2549
199 Ga0495669_0180520 3300046684 Bacteria 1006
200 Ga0495670_0051642 3300046691 Bacteria 2058
201 Ga0495589_0074847 3300046794 Bacteria 1651
202 Ga0495672_0192217 3300047320 Bacteria 1026
203 Ga0495673_0065399 3300047469 Bacteria 1544
204 Ga0496101_0174012 3300048904 Bacteria 1655
205 Ga0496109_0002903 3300048912 Bacteria 14323
206 Ga0496113_0237409 3300048916 Bacteria 1454
207 Ga0496115_0002204 3300048918 Bacteria 13951
208 Ga0496121_0002303 3300048924 Bacteria 29622
209 Ga0501031_0089483 3300049568 Bacteria 2007
210 Ga0501032_0034130 3300049569 Bacteria 3483
211 Ga0501032_0365169 3300049569 Bacteria 929
212 Ga0501033_0031908 3300049570 Bacteria 3954
213 Ga0501033_0044856 3300049570 Bacteria 3291
214 Ga0501033_0123394 3300049570 Bacteria 1878
215 Ga0501034_0061560 3300049571 Bacteria 3769
216 Ga0501034_0164882 3300049571 Bacteria 2185
217 Ga0501036_0057123 3300049572 Bacteria 3306
218 Ga0501037_0067554 3300049573 Bacteria 2603
219 Ga0501037_0131803 3300049573 Bacteria 1792
220 Ga0501037_0225328 3300049573 Bacteria 1317
221 Ga0501038_0133547 3300049574 Bacteria 2035
222 Ga0501039_0074832 3300049575 Bacteria 2632
223 Ga0501042_0047227 3300049578 Bacteria 3070
224 Ga0501043_0067756 3300049579 Bacteria 2803
225 Ga0501043_0079009 3300049579 Bacteria 2585
226 Ga0501046_0002108 3300049580 Bacteria 18850
227 Ga0501046_0034406 3300049580 Bacteria 4089
228 Ga0501046_0066544 3300049580 Bacteria 2808
229 Ga0501046_0322566 3300049580 Bacteria 1125
230 Ga0501047_0008445 3300049581 Bacteria 9721
231 Ga0501047_0033098 3300049581 Bacteria 4991
232 Ga0501047_0079372 3300049581 Bacteria 3155
233 Ga0501047_0132621 3300049581 Bacteria 2371
234 Ga0501047_0133942 3300049581 Bacteria 2358
235 Ga0501047_0177865 3300049581 Bacteria 1995
236 Ga0501047_0229779 3300049581 Bacteria 1709
237 Ga0501048_0015591 3300049582 Bacteria 5611
238 Ga0501067_0000695 3300049583 Bacteria 18114
239 Ga0501069_0025068 3300049585 Bacteria 3257
240 Ga0501070_0030137 3300049586 Bacteria 4546
241 Ga0501074_0027763 3300049590 Bacteria 4103
242 Ga0501079_0030103 3300049741 Bacteria 4171
243 Ga0501080_0260665 3300049742 Bacteria 1579
244 Ga0501035_0005665 3300049822 Bacteria 11793
245 Ga0501035_0093699 3300049822 Bacteria 2642
246 Ga0501035_0182338 3300049822 Bacteria 1808
247 Ga0501035_0207988 3300049822 Bacteria 1675
248 Ga0501044_0010651 3300049823 Bacteria 9977
249 Ga0501044_0230588 3300049823 Bacteria 1799
250 Ga0501044_0280831 3300049823 Bacteria 1599
251 Ga0501044_0715040 3300049823 Bacteria 886
252 Ga0501045_0027751 3300049824 Bacteria 4082
253 Ga0500643_000003 3300053087 Bacteria 876659
254 Ga0500555_035292 3300053103 Bacteria 1405
255 Ga0500595_000512 3300053119 Bacteria 23404
256 Ga0500595_006856 3300053119 Bacteria 4790
257 Ga0500595_012109 3300053119 Bacteria 3345
258 Ga0500573_0000008 3300053140 Bacteria 237795
259 Ga0500616_0143426 3300053153 Bacteria 1113
260 Ga0500622_0002081 3300053156 Bacteria 14908
261 Ga0500639_028442 3300053163 Bacteria 2955
262 Ga0501084_0043367 3300054114 Bacteria 3763
263 Ga0501084_0209699 3300054114 Bacteria 1644
264 Ga0501082_0023669 3300060353 Bacteria 5296
265 Ga0501082_0052587 3300060353 Bacteria 3511

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028556 Ga0265337_1019388 Ga0265337_10193882 222
2 3300028800 Ga0265338_10019891 Ga0265338_100198915 222
3 3300031241 Ga0265325_10135177 Ga0265325_101351771 222
4 3300025986 Ga0207658_10096291 Ga0207658_100962912 224
5 3300005458 Ga0070681_10070763 Ga0070681_100707634 247
6 3300005530 Ga0070679_100066055 Ga0070679_1000660552 247
7 3300025921 Ga0207652_10231464 Ga0207652_102314642 247
8 3300005614 Ga0068856_100364477 Ga0068856_1003644772 251
9 3300005842 Ga0068858_100657906 Ga0068858_1006579061 251
10 3300013296 Ga0157374_10340340 Ga0157374_103403402 252
11 3300031241 Ga0265325_10022176 Ga0265325_100221762 252
12 3300031242 Ga0265329_10047695 Ga0265329_100476952 252
13 3300031344 Ga0265316_10130193 Ga0265316_101301932 252
14 3300031595 Ga0265313_10033271 Ga0265313_100332712 252
15 3300053153 Ga0500616_0143426 Ga0500616_0143426_32_802 253
16 3300005436 Ga0070713_100186497 Ga0070713_1001864971 254
17 3300048918 Ga0496115_0002204 Ga0496115_0002204_503_1276 254
18 3300053119 Ga0500595_012109 Ga0500595_012109_1071_1835 254
19 3300053156 Ga0500622_0002081 Ga0500622_0002081_2334_3107 254
20 3300005331 Ga0070670_100680805 Ga0070670_1006808051 255
21 3300005355 Ga0070671_100197854 Ga0070671_1001978542 255
22 3300005356 Ga0070674_100233743 Ga0070674_1002337432 255
23 3300005364 Ga0070673_100077596 Ga0070673_1000775962 255
24 3300005367 Ga0070667_100457156 Ga0070667_1004571562 255
25 3300005456 Ga0070678_100005418 Ga0070678_1000054185 255
26 3300005456 Ga0070678_100141019 Ga0070678_1001410192 255
27 3300005457 Ga0070662_100291939 Ga0070662_1002919391 255
28 3300005618 Ga0068864_100003148 Ga0068864_1000031487 255
29 3300005841 Ga0068863_100224181 Ga0068863_1002241812 255
30 3300009553 Ga0105249_10512189 Ga0105249_105121892 255
31 3300013306 Ga0163162_10198764 Ga0163162_101987642 255
32 3300025931 Ga0207644_10161409 Ga0207644_101614092 255
33 3300025933 Ga0207706_10018332 Ga0207706_100183324 255
34 3300025933 Ga0207706_10160371 Ga0207706_101603712 255
35 3300025960 Ga0207651_10002942 Ga0207651_100029429 255
36 3300026088 Ga0207641_10151562 Ga0207641_101515622 255
37 3300026095 Ga0207676_10003920 Ga0207676_100039209 255
38 3300026121 Ga0207683_10010569 Ga0207683_100105695 255
39 3300026121 Ga0207683_10037815 Ga0207683_100378152 255
40 3300028379 Ga0268266_10132879 Ga0268266_101328792 255
41 3300035113 Ga0373936_0009401 Ga0373936_0009401_297_1073 255
42 3300046660 Ga0495625_0066030 Ga0495625_0066030_337_1113 255
43 3300048904 Ga0496101_0174012 Ga0496101_0174012_339_1115 255
44 3300048912 Ga0496109_0002903 Ga0496109_0002903_3994_4770 255
45 3300048916 Ga0496113_0237409 Ga0496113_0237409_129_905 255
46 3300049823 Ga0501044_0280831 Ga0501044_0280831_811_1581 255
47 3300053163 Ga0500639_028442 Ga0500639_028442_655_1422 255
48 3300005327 Ga0070658_10014407 Ga0070658_100144076 256
49 3300005327 Ga0070658_10098866 Ga0070658_100988662 256
50 3300005331 Ga0070670_100215087 Ga0070670_1002150872 256
51 3300005335 Ga0070666_10026431 Ga0070666_100264312 256
52 3300005338 Ga0068868_100264044 Ga0068868_1002640442 256
53 3300005339 Ga0070660_100239256 Ga0070660_1002392562 256
54 3300005364 Ga0070673_100443924 Ga0070673_1004439242 256
55 3300005456 Ga0070678_100367135 Ga0070678_1003671351 256
56 3300005458 Ga0070681_10058482 Ga0070681_100584823 256
57 3300005530 Ga0070679_100007818 Ga0070679_10000781811 256
58 3300005530 Ga0070679_100028476 Ga0070679_1000284764 256
59 3300005535 Ga0070684_100111297 Ga0070684_1001112972 256
60 3300005539 Ga0068853_100435310 Ga0068853_1004353101 256
61 3300005548 Ga0070665_100002501 Ga0070665_10000250118 256
62 3300005548 Ga0070665_100024688 Ga0070665_1000246883 256
63 3300005548 Ga0070665_100026386 Ga0070665_1000263864 256
64 3300005563 Ga0068855_100062254 Ga0068855_1000622543 256
65 3300005563 Ga0068855_100113358 Ga0068855_1001133582 256
66 3300005563 Ga0068855_100442882 Ga0068855_1004428821 256
67 3300005614 Ga0068856_100100343 Ga0068856_1001003432 256
68 3300005614 Ga0068856_100714254 Ga0068856_1007142542 256
69 3300005841 Ga0068863_100013190 Ga0068863_1000131906 256
70 3300005842 Ga0068858_100029038 Ga0068858_1000290382 256
71 3300005842 Ga0068858_100029459 Ga0068858_1000294593 256
72 3300006237 Ga0097621_100046017 Ga0097621_1000460171 256
73 3300006237 Ga0097621_100097335 Ga0097621_1000973353 256
74 3300006358 Ga0068871_100000927 Ga0068871_10000092718 256
75 3300006358 Ga0068871_100562899 Ga0068871_1005628992 256
76 3300009093 Ga0105240_10281066 Ga0105240_102810663 256
77 3300009093 Ga0105240_10717592 Ga0105240_107175921 256
78 3300009093 Ga0105240_10790412 Ga0105240_107904121 256
79 3300009101 Ga0105247_10108326 Ga0105247_101083262 256
80 3300009174 Ga0105241_10201274 Ga0105241_102012742 256
81 3300009174 Ga0105241_10249845 Ga0105241_102498452 256
82 3300009176 Ga0105242_10096866 Ga0105242_100968662 256
83 3300009177 Ga0105248_10026682 Ga0105248_100266824 256
84 3300009545 Ga0105237_10097587 Ga0105237_100975872 256
85 3300009545 Ga0105237_10279302 Ga0105237_102793022 256
86 3300009545 Ga0105237_10300702 Ga0105237_103007022 256
87 3300009545 Ga0105237_10777905 Ga0105237_107779051 256
88 3300009551 Ga0105238_10144058 Ga0105238_101440582 256
89 3300009551 Ga0105238_10398897 Ga0105238_103988971 256
90 3300009551 Ga0105238_10468782 Ga0105238_104687821 256
91 3300009551 Ga0105238_10628255 Ga0105238_106282552 256
92 3300009553 Ga0105249_10195715 Ga0105249_101957152 256
93 3300010375 Ga0105239_10097738 Ga0105239_100977382 256
94 3300010375 Ga0105239_10165074 Ga0105239_101650742 256
95 3300010375 Ga0105239_10399810 Ga0105239_103998102 256
96 3300013104 Ga0157370_10211220 Ga0157370_102112202 256
97 3300013105 Ga0157369_10140496 Ga0157369_101404963 256
98 3300013296 Ga0157374_10577225 Ga0157374_105772252 256
99 3300013297 Ga0157378_10291612 Ga0157378_102916122 256
100 3300013306 Ga0163162_10370242 Ga0163162_103702422 256
101 3300013307 Ga0157372_10251970 Ga0157372_102519703 256
102 3300013308 Ga0157375_10894173 Ga0157375_108941731 256
103 3300014325 Ga0163163_10000236 Ga0163163_1000023620 256
104 3300014326 Ga0157380_10385264 Ga0157380_103852642 256
105 3300014968 Ga0157379_10002565 Ga0157379_100025659 256
106 3300014968 Ga0157379_10038945 Ga0157379_100389454 256
107 3300025899 Ga0207642_10226988 Ga0207642_102269882 256
108 3300025900 Ga0207710_10088595 Ga0207710_100885952 256
109 3300025909 Ga0207705_10035470 Ga0207705_100354702 256
110 3300025909 Ga0207705_10035756 Ga0207705_100357562 256
111 3300025909 Ga0207705_10113704 Ga0207705_101137042 256
112 3300025911 Ga0207654_10162342 Ga0207654_101623421 256
113 3300025912 Ga0207707_10094314 Ga0207707_100943142 256
114 3300025912 Ga0207707_10129097 Ga0207707_101290972 256
115 3300025913 Ga0207695_10048720 Ga0207695_100487204 256
116 3300025914 Ga0207671_10146886 Ga0207671_101468862 256
117 3300025917 Ga0207660_10067808 Ga0207660_100678081 256
118 3300025919 Ga0207657_10222507 Ga0207657_102225071 256
119 3300025921 Ga0207652_10057476 Ga0207652_100574764 256
120 3300025921 Ga0207652_10088972 Ga0207652_100889722 256
121 3300025924 Ga0207694_10413210 Ga0207694_104132102 256
122 3300025934 Ga0207686_10057298 Ga0207686_100572982 256
123 3300025940 Ga0207691_10167059 Ga0207691_101670592 256
124 3300025944 Ga0207661_10066766 Ga0207661_100667663 256
125 3300025944 Ga0207661_10395255 Ga0207661_103952552 256
126 3300025949 Ga0207667_10095738 Ga0207667_100957382 256
127 3300025986 Ga0207658_10137141 Ga0207658_101371411 256
128 3300026023 Ga0207677_10311062 Ga0207677_103110622 256
129 3300026035 Ga0207703_10023199 Ga0207703_100231992 256
130 3300026035 Ga0207703_10143842 Ga0207703_101438422 256
131 3300026078 Ga0207702_10065945 Ga0207702_100659453 256
132 3300026078 Ga0207702_10408511 Ga0207702_104085111 256
133 3300026116 Ga0207674_10217669 Ga0207674_102176692 256
134 3300026121 Ga0207683_10269889 Ga0207683_102698892 256
135 3300028379 Ga0268266_10001126 Ga0268266_1000112616 256
136 3300028379 Ga0268266_10194380 Ga0268266_101943802 256
137 3300031238 Ga0265332_10005130 Ga0265332_100051302 256
138 3300031247 Ga0265340_10026326 Ga0265340_100263262 256
139 3300031730 Ga0307516_10063491 Ga0307516_100634914 256
140 3300037418 Ga0395900_0128909 Ga0395900_0128909_1481_2251 256
141 3300038443 Ga0395901_0089061 Ga0395901_0089061_145_915 256
142 3300046507 Ga0495606_0020873 Ga0495606_0020873_3054_3824 256
143 3300046507 Ga0495606_0263680 Ga0495606_0263680_77_847 256
144 3300046516 Ga0495628_0255600 Ga0495628_0255600_118_888 256
145 3300046557 Ga0495622_0009366 Ga0495622_0009366_2801_3571 256
146 3300046616 Ga0495668_0158487 Ga0495668_0158487_108_878 256
147 3300046684 Ga0495669_0180520 Ga0495669_0180520_140_910 256
148 3300046691 Ga0495670_0051642 Ga0495670_0051642_966_1736 256
149 3300047320 Ga0495672_0192217 Ga0495672_0192217_150_920 256
150 3300048924 Ga0496121_0002303 Ga0496121_0002303_24638_25408 256
151 3300049570 Ga0501033_0123394 Ga0501033_0123394_105_890 256
152 3300049573 Ga0501037_0131803 Ga0501037_0131803_70_855 256
153 3300049574 Ga0501038_0133547 Ga0501038_0133547_181_966 256
154 3300049580 Ga0501046_0034406 Ga0501046_0034406_70_855 256
155 3300049580 Ga0501046_0066544 Ga0501046_0066544_295_1065 256
156 3300049581 Ga0501047_0008445 Ga0501047_0008445_7647_8432 256
157 3300049581 Ga0501047_0033098 Ga0501047_0033098_1879_2649 256
158 3300049581 Ga0501047_0177865 Ga0501047_0177865_113_883 256
159 3300049822 Ga0501035_0005665 Ga0501035_0005665_10659_11444 256
160 3300049822 Ga0501035_0207988 Ga0501035_0207988_702_1472 256
161 3300049823 Ga0501044_0010651 Ga0501044_0010651_1012_1797 256
162 3300049823 Ga0501044_0715040 Ga0501044_0715040_56_826 256
163 3300053087 Ga0500643_000003 Ga0500643_000003_472317_473087 256
164 3300053103 Ga0500555_035292 Ga0500555_035292_581_1351 256
165 3300053119 Ga0500595_000512 Ga0500595_000512_5128_5898 256
166 3300053119 Ga0500595_006856 Ga0500595_006856_1838_2608 256
167 3300053140 Ga0500573_0000008 Ga0500573_0000008_117680_118450 256
168 3300054114 Ga0501084_0209699 Ga0501084_0209699_487_1257 256
169 3300060353 Ga0501082_0052587 Ga0501082_0052587_2293_3063 256
170 3300005535 Ga0070684_100049070 Ga0070684_1000490702 257
171 3300025297 Ga0209758_1000013 Ga0209758_1000013421 257
172 3300049568 Ga0501031_0089483 Ga0501031_0089483_418_1194 258
173 3300049569 Ga0501032_0034130 Ga0501032_0034130_2519_3295 258
174 3300049569 Ga0501032_0365169 Ga0501032_0365169_32_808 258
175 3300049570 Ga0501033_0031908 Ga0501033_0031908_1152_1928 258
176 3300049571 Ga0501034_0061560 Ga0501034_0061560_1101_1877 258
177 3300049571 Ga0501034_0164882 Ga0501034_0164882_159_935 258
178 3300049572 Ga0501036_0057123 Ga0501036_0057123_929_1705 258
179 3300049573 Ga0501037_0067554 Ga0501037_0067554_81_857 258
180 3300049573 Ga0501037_0225328 Ga0501037_0225328_189_965 258
181 3300049575 Ga0501039_0074832 Ga0501039_0074832_1440_2216 258
182 3300049578 Ga0501042_0047227 Ga0501042_0047227_1902_2678 258
183 3300049579 Ga0501043_0067756 Ga0501043_0067756_1844_2620 258
184 3300049579 Ga0501043_0079009 Ga0501043_0079009_1765_2541 258
185 3300049580 Ga0501046_0002108 Ga0501046_0002108_8594_9370 258
186 3300049580 Ga0501046_0322566 Ga0501046_0322566_101_877 258
187 3300049581 Ga0501047_0079372 Ga0501047_0079372_1318_2094 258
188 3300049581 Ga0501047_0133942 Ga0501047_0133942_1278_2054 258
189 3300049581 Ga0501047_0229779 Ga0501047_0229779_121_897 258
190 3300049582 Ga0501048_0015591 Ga0501048_0015591_1318_2094 258
191 3300049583 Ga0501067_0000695 Ga0501067_0000695_17151_17927 258
192 3300049585 Ga0501069_0025068 Ga0501069_0025068_2271_3047 258
193 3300049586 Ga0501070_0030137 Ga0501070_0030137_934_1710 258
194 3300049590 Ga0501074_0027763 Ga0501074_0027763_1809_2585 258
195 3300049741 Ga0501079_0030103 Ga0501079_0030103_984_1760 258
196 3300049742 Ga0501080_0260665 Ga0501080_0260665_353_1129 258
197 3300049822 Ga0501035_0093699 Ga0501035_0093699_1725_2501 258
198 3300049823 Ga0501044_0230588 Ga0501044_0230588_208_984 258
199 3300049824 Ga0501045_0027751 Ga0501045_0027751_1403_2179 258
200 3300054114 Ga0501084_0043367 Ga0501084_0043367_266_1042 258
201 3300060353 Ga0501082_0023669 Ga0501082_0023669_1062_1838 258
202 3300003214 JGI25165J46597_1000003 JGI25165J46597_1000003101 259
203 3300003320 rootH2_10032179 rootH2_100321792 259
204 3300005334 Ga0068869_100011996 Ga0068869_1000119962 259
205 3300005340 Ga0070689_100284746 Ga0070689_1002847462 259
206 3300005355 Ga0070671_100045925 Ga0070671_1000459252 259
207 3300005366 Ga0070659_100025627 Ga0070659_1000256272 259
208 3300005458 Ga0070681_10101268 Ga0070681_101012682 259
209 3300005530 Ga0070679_100221055 Ga0070679_1002210552 259
210 3300005577 Ga0068857_100127173 Ga0068857_1001271732 259
211 3300005618 Ga0068864_100631517 Ga0068864_1006315171 259
212 3300005718 Ga0068866_10119863 Ga0068866_101198632 259
213 3300005840 Ga0068870_10048892 Ga0068870_100488922 259
214 3300005842 Ga0068858_100024348 Ga0068858_1000243483 259
215 3300005843 Ga0068860_100211251 Ga0068860_1002112512 259
216 3300006358 Ga0068871_100007188 Ga0068871_1000071883 259
217 3300006881 Ga0068865_100007071 Ga0068865_1000070712 259
218 3300009093 Ga0105240_10193859 Ga0105240_101938592 259
219 3300009098 Ga0105245_10139675 Ga0105245_101396752 259
220 3300009148 Ga0105243_10004314 Ga0105243_100043142 259
221 3300009174 Ga0105241_10091374 Ga0105241_100913742 259
222 3300009176 Ga0105242_10022426 Ga0105242_100224262 259
223 3300009177 Ga0105248_10029271 Ga0105248_100292714 259
224 3300009545 Ga0105237_10309775 Ga0105237_103097752 259
225 3300009551 Ga0105238_10021937 Ga0105238_100219375 259
226 3300009551 Ga0105238_10079466 Ga0105238_100794662 259
227 3300011119 Ga0105246_10005608 Ga0105246_100056084 259
228 3300013104 Ga0157370_10020483 Ga0157370_100204832 259
229 3300013105 Ga0157369_10307211 Ga0157369_103072112 259
230 3300013296 Ga0157374_10094172 Ga0157374_100941722 259
231 3300013297 Ga0157378_10089318 Ga0157378_100893182 259
232 3300013306 Ga0163162_10100423 Ga0163162_101004232 259
233 3300013306 Ga0163162_10545506 Ga0163162_105455062 259
234 3300013308 Ga0157375_10037102 Ga0157375_100371022 259
235 3300013308 Ga0157375_10373626 Ga0157375_103736262 259
236 3300014325 Ga0163163_10238126 Ga0163163_102381262 259
237 3300017792 Ga0163161_10006802 Ga0163161_100068022 259
238 3300025261 Ga0209233_1000015 Ga0209233_1000015678 259
239 3300025261 Ga0209233_1010534 Ga0209233_10105342 259
240 3300025907 Ga0207645_10009434 Ga0207645_100094345 259
241 3300025911 Ga0207654_10006507 Ga0207654_100065075 259
242 3300025911 Ga0207654_10040045 Ga0207654_100400452 259
243 3300025921 Ga0207652_10236103 Ga0207652_102361032 259
244 3300025925 Ga0207650_10134863 Ga0207650_101348632 259
245 3300025927 Ga0207687_10103524 Ga0207687_101035242 259
246 3300025934 Ga0207686_10017099 Ga0207686_100170993 259
247 3300025936 Ga0207670_10045227 Ga0207670_100452272 259
248 3300025936 Ga0207670_10119149 Ga0207670_101191493 259
249 3300025938 Ga0207704_10007945 Ga0207704_100079452 259
250 3300025940 Ga0207691_10514183 Ga0207691_105141832 259
251 3300025941 Ga0207711_10234977 Ga0207711_102349772 259
252 3300025960 Ga0207651_10143078 Ga0207651_101430782 259
253 3300025986 Ga0207658_10045897 Ga0207658_100458973 259
254 3300026035 Ga0207703_10003774 Ga0207703_100037743 259
255 3300026067 Ga0207678_10192558 Ga0207678_101925582 259
256 3300026078 Ga0207702_10206525 Ga0207702_102065252 259
257 3300026089 Ga0207648_10044009 Ga0207648_100440092 259
258 3300026121 Ga0207683_10014265 Ga0207683_100142657 259
259 3300028379 Ga0268266_10361383 Ga0268266_103613832 259
260 3300039447 Ga0436361_0537346 Ga0436361_0537346_467_1246 259
261 3300046794 Ga0495589_0074847 Ga0495589_0074847_755_1552 259
262 3300047469 Ga0495673_0065399 Ga0495673_0065399_576_1373 259
263 3300049570 Ga0501033_0044856 Ga0501033_0044856_1527_2306 259
264 3300049581 Ga0501047_0132621 Ga0501047_0132621_200_979 259
265 3300049822 Ga0501035_0182338 Ga0501035_0182338_978_1757 259

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

19

168

0.96

PF01078

Mg_chelatase

Magnesium chelatase, subunit ChlI

12

118

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rlf-assembly1.cif.gz_B crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp 0.9131 3 222
5b58-assembly1.cif.gz_C inward-facing conformation of abc heme importer bhuuv in complex with periplasmic heme binding protein bhut from burkholderia cenocepacia 0.9048 4 251
5b58-assembly1.cif.gz_D inward-facing conformation of abc heme importer bhuuv in complex with periplasmic heme binding protein bhut from burkholderia cenocepacia 0.9023 4 251
7e7q-assembly1.cif.gz_A cryo-em structure of human abca4 in atp-bound state 0.9016 1 221
5b57-assembly1.cif.gz_C inward-facing conformation of abc heme importer bhuuv from burkholderia cenocepacia 0.8995 4 248
ID Description Score Start End Superfamily
af_P15031_2_251_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9391 4 239 3.40.50.300
af_Q2G072_1_252_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9321 4 252 3.40.50.300
af_Q58429_1_224_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9219 4 222 3.40.50.300
af_Q2FVS3_1_233_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9184 4 222 3.40.50.300
af_Q2G072_1_252_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9178 4 252 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A097B6U0-F1-model_v4 deleted 0.9224 1 253
AF-A0A806GYM0-F1-model_v4 deleted 0.9186 4 254
AF-A0A3T0S4I1-F1-model_v4 deleted 0.9174 1 255
AF-A0A6L9LAC3-F1-model_v4 ABC transporter ATP-binding protein 0.9146 4 222 GO:0005524
GO:0005886
GO:0006826
GO:0016887
AF-A0A0D8HIP8-F1-model_v4 Putative ABC transporter ATP-binding protein YlmA (EC 3.6.3.-) 0.9145 4 252 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
92.63 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map