F372925

General Info

Members Datasets Scaffolds Average Seq Length
264 190 264 278

Family's Representative Sequence

Representative Sequence 3300050513|nmdc:mga0rr50_60304_c1|nmdc:mga0rr50_60304_c1_1871_2827
Length 318
Sequence MRIDSPCVSATACAGRRAVRRGLKSTMNPQSVIRNPHWSRRALLAATGAALVSPWLRAQVTRVVKNARLKQSVSRWPYARIPLPEFCRALAEMGLPAIDLLEMNEWQTARDHGLVVSMGYAGGGSIPDALNVRANHDAIVRNFEQNIPKAAAAKVTNVITFFGNKRGMPDEEAIANCVAGLNRVKKVAEDHGVTICVELLNSKVNHKDYQGDRTSFGVQVMKAVDSPRVKLLYDIYHMQIMEGDVIRTIRDNHQYIAHYHTGGVPGRHELDDAQELNWRAIAKAVLDTGFTGYFAHEFVPTRDPLTSLSEAVALCDIS

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
108 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
109 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
110 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
111 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
112 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
113 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
114 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
115 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
116 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
117 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
118 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
119 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
120 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
121 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
122 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
123 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
124 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
125 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
126 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
127 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
128 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
129 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
130 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
133 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
134 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
135 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
136 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
137 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
138 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
139 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
140 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
141 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
142 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
143 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
144 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
145 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
146 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
147 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
148 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
149 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
150 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
151 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
152 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
153 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
154 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
155 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
156 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
157 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
158 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
159 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
160 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
164 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
165 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
166 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
167 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
168 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
169 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
170 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
171 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
172 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
173 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
174 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
175 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
176 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
177 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
178 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
179 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
180 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
181 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
182 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
183 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
184 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
185 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
186 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
187 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
188 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
189 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
190 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.27
Nodule 0
Rhizoplane 2.65
Rhizosphere 93.18
Stem 0
Stem Tuber 0
Unclassified 1.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10032295 3300005290 Bacteria 1165
2 Ga0065715_10285083 3300005293 Bacteria 1077
3 Ga0065707_10096148 3300005295 Bacteria 3300
4 Ga0070676_10003723 3300005328 Bacteria 7993
5 Ga0070683_100057601 3300005329 Bacteria 3610
6 Ga0070690_100037497 3300005330 Bacteria 3055
7 Ga0070690_100100034 3300005330 Bacteria 1921
8 Ga0070677_10001945 3300005333 Bacteria 6552
9 Ga0070677_10066251 3300005333 Bacteria 1505
10 Ga0068869_100091140 3300005334 Bacteria 2292
11 Ga0070680_100232642 3300005336 Bacteria 1557
12 Ga0070680_100417731 3300005336 Bacteria 1144
13 Ga0068868_100265940 3300005338 Bacteria 1448
14 Ga0070660_100132696 3300005339 Bacteria 1994
15 Ga0070689_100069155 3300005340 Bacteria 2755
16 Ga0070689_100190948 3300005340 Bacteria 1668
17 Ga0070687_100039057 3300005343 Bacteria 2383
18 Ga0070669_100010710 3300005353 Bacteria 6506
19 Ga0070669_100099704 3300005353 Bacteria 2189
20 Ga0070674_100000193 3300005356 Bacteria 29122
21 Ga0070674_100175400 3300005356 Bacteria 1637
22 Ga0070673_100001348 3300005364 Bacteria 14331
23 Ga0070673_100043964 3300005364 Bacteria 3456
24 Ga0070688_100137472 3300005365 Bacteria 1656
25 Ga0070659_100019117 3300005366 Bacteria 5183
26 Ga0070714_100047317 3300005435 Bacteria 3653
27 Ga0070713_100038694 3300005436 Bacteria 3866
28 Ga0070705_100069236 3300005440 Bacteria 2127
29 Ga0070700_100011053 3300005441 Bacteria 4993
30 Ga0070700_100085284 3300005441 Bacteria 2049
31 Ga0070681_10143948 3300005458 Bacteria 2313
32 Ga0068867_100062693 3300005459 Bacteria 2762
33 Ga0068867_100096733 3300005459 Bacteria 2248
34 Ga0070685_10007760 3300005466 Bacteria 5493
35 Ga0070685_10037139 3300005466 Bacteria 2757
36 Ga0070698_100028739 3300005471 Bacteria 5772
37 Ga0070698_100059927 3300005471 Bacteria 3842
38 Ga0070699_100183568 3300005518 Bacteria 1857
39 Ga0070679_100010708 3300005530 Bacteria 8707
40 Ga0070684_100021371 3300005535 Bacteria 5384
41 Ga0070684_100252502 3300005535 Bacteria 1612
42 Ga0068853_100027962 3300005539 Bacteria 4742
43 Ga0068853_100034936 3300005539 Bacteria 4268
44 Ga0070672_100026368 3300005543 Bacteria 4323
45 Ga0070686_100000793 3300005544 Bacteria 18295
46 Ga0070695_100006679 3300005545 Bacteria 6822
47 Ga0070696_100034570 3300005546 Bacteria 3478
48 Ga0070696_100164091 3300005546 Bacteria 1638
49 Ga0070665_100010168 3300005548 Bacteria 9515
50 Ga0070704_100027467 3300005549 Bacteria 3776
51 Ga0068855_100012469 3300005563 Bacteria 10259
52 Ga0068855_100370671 3300005563 Bacteria 1574
53 Ga0068855_100641230 3300005563 Bacteria 1142
54 Ga0070664_100219157 3300005564 Bacteria 1702
55 Ga0068854_100011629 3300005578 Bacteria 5740
56 Ga0068854_100180861 3300005578 Bacteria 1647
57 Ga0068856_100078606 3300005614 Bacteria 3271
58 Ga0070702_100007010 3300005615 Bacteria 5372
59 Ga0068861_100027001 3300005719 Bacteria 4179
60 Ga0068861_100036371 3300005719 Bacteria 3653
61 Ga0068861_100251218 3300005719 Bacteria 1509
62 Ga0068851_10232497 3300005834 Bacteria 1040
63 Ga0068870_10000445 3300005840 Bacteria 15676
64 Ga0068858_100187492 3300005842 Bacteria 1954
65 Ga0081455_10001998 3300005937 Bacteria 24355
66 Ga0081455_10010021 3300005937 Bacteria 9683
67 Ga0070717_10069471 3300006028 Bacteria 2934
68 Ga0070712_100111326 3300006175 Bacteria 2044
69 Ga0075366_10143704 3300006195 Bacteria 1443
70 Ga0097621_100035151 3300006237 Bacteria 4002
71 Ga0097621_100119349 3300006237 Bacteria 2235
72 Ga0097621_100278988 3300006237 Bacteria 1471
73 Ga0097621_100280334 3300006237 Bacteria 1467
74 Ga0068871_100046518 3300006358 Bacteria 3495
75 Ga0068871_100095981 3300006358 Bacteria 2476
76 Ga0075431_100044928 3300006847 Bacteria 4555
77 Ga0075431_100090190 3300006847 Bacteria 3163
78 Ga0075431_100232280 3300006847 Bacteria 1879
79 Ga0075434_100453465 3300006871 Bacteria 1304
80 Ga0075429_100256945 3300006880 Bacteria 1530
81 Ga0075435_100001203 3300007076 Bacteria 16551
82 Ga0075435_100026526 3300007076 Bacteria 4522
83 Ga0105240_10061299 3300009093 Bacteria 4688
84 Ga0105240_10432981 3300009093 Bacteria 1475
85 Ga0111539_10398838 3300009094 Bacteria 1602
86 Ga0105245_10029556 3300009098 Bacteria 4843
87 Ga0114129_10776407 3300009147 Bacteria 1224
88 Ga0105243_10016462 3300009148 Bacteria 5591
89 Ga0105243_10176945 3300009148 Bacteria 1852
90 Ga0105241_10173423 3300009174 Bacteria 1783
91 Ga0105248_10234265 3300009177 Bacteria 2067
92 Ga0157373_10000188 3300013100 Bacteria 50875
93 Ga0157373_10126660 3300013100 Bacteria 1796
94 Ga0157370_10118150 3300013104 Bacteria 2477
95 Ga0157369_10002131 3300013105 Bacteria 23862
96 Ga0157369_10096507 3300013105 Bacteria 3154
97 Ga0157369_10238786 3300013105 Bacteria 1898
98 Ga0157374_10002312 3300013296 Bacteria 16060
99 Ga0157374_10025630 3300013296 Bacteria 5297
100 Ga0157374_10474876 3300013296 Bacteria 1253
101 Ga0157372_10000458 3300013307 Bacteria 44772
102 Ga0157372_10250082 3300013307 Bacteria 2058
103 Ga0157372_10342527 3300013307 Bacteria 1741
104 Ga0157372_10467483 3300013307 Bacteria 1470
105 Ga0157375_10934640 3300013308 Bacteria 1010
106 Ga0163163_10052467 3300014325 Bacteria 4023
107 Ga0157380_10082121 3300014326 Bacteria 2637
108 Ga0157380_10504005 3300014326 Bacteria 1177
109 Ga0157376_10081651 3300014969 Bacteria 2776
110 Ga0157376_10093692 3300014969 Bacteria 2608
111 Ga0157376_10676088 3300014969 Bacteria 1035
112 Ga0207682_10002519 3300025893 Bacteria 8185
113 Ga0207688_10211336 3300025901 Bacteria 1166
114 Ga0207680_10002825 3300025903 Bacteria 8138
115 Ga0207699_10000014 3300025906 Bacteria 260521
116 Ga0207645_10003081 3300025907 Bacteria 12793
117 Ga0207645_10106801 3300025907 Bacteria 1810
118 Ga0207643_10004606 3300025908 Bacteria 7405
119 Ga0207643_10048370 3300025908 Bacteria 2409
120 Ga0207707_10144685 3300025912 Bacteria 2078
121 Ga0207663_10239663 3300025916 Bacteria 1330
122 Ga0207662_10052562 3300025918 Bacteria 2425
123 Ga0207662_10074476 3300025918 Bacteria 2061
124 Ga0207657_10276553 3300025919 Bacteria 1334
125 Ga0207652_10081767 3300025921 Bacteria 2826
126 Ga0207652_10105155 3300025921 Bacteria 2498
127 Ga0207681_10071500 3300025923 Bacteria 2420
128 Ga0207659_10022721 3300025926 Bacteria 4178
129 Ga0207700_10082486 3300025928 Bacteria 2514
130 Ga0207700_10321178 3300025928 Bacteria 1342
131 Ga0207700_10450243 3300025928 Bacteria 1135
132 Ga0207700_10572445 3300025928 Bacteria 1004
133 Ga0207644_10123588 3300025931 Bacteria 1973
134 Ga0207706_10211184 3300025933 Bacteria 1701
135 Ga0207709_10142946 3300025935 Bacteria 1647
136 Ga0207670_10071847 3300025936 Bacteria 2394
137 Ga0207670_10287121 3300025936 Bacteria 1284
138 Ga0207669_10012221 3300025937 Bacteria 4215
139 Ga0207669_10128369 3300025937 Bacteria 1737
140 Ga0207704_10043910 3300025938 Bacteria 2644
141 Ga0207691_10014638 3300025940 Bacteria 7479
142 Ga0207711_10204194 3300025941 Bacteria 1804
143 Ga0207711_10232974 3300025941 Bacteria 1687
144 Ga0207689_10014256 3300025942 Bacteria 6763
145 Ga0207689_10091286 3300025942 Bacteria 2502
146 Ga0207667_10009779 3300025949 Bacteria 11279
147 Ga0207667_10562149 3300025949 Bacteria 1153
148 Ga0207651_10037404 3300025960 Bacteria 3179
149 Ga0207640_10061819 3300025981 Bacteria 2482
150 Ga0207639_10028845 3300026041 Bacteria 4057
151 Ga0207678_10124099 3300026067 Bacteria 2203
152 Ga0207708_10003249 3300026075 Bacteria 11978
153 Ga0207708_10113239 3300026075 Bacteria 2108
154 Ga0207648_10016897 3300026089 Bacteria 6650
155 Ga0207676_10399701 3300026095 Bacteria 1284
156 Ga0207675_100006468 3300026118 Bacteria 11095
157 Ga0207675_100018178 3300026118 Bacteria 6555
158 Ga0207675_100055874 3300026118 Bacteria 3683
159 Ga0207675_100158951 3300026118 Bacteria 2155
160 Ga0207675_100233292 3300026118 Bacteria 1776
161 Ga0207675_100242339 3300026118 Bacteria 1743
162 Ga0207683_10178935 3300026121 Bacteria 1923
163 Ga0207428_10348068 3300027907 Bacteria 1091
164 Ga0268266_10100446 3300028379 Bacteria 2549
165 Ga0265325_10012521 3300031241 Bacteria 4848
166 Ga0265339_10006580 3300031249 Bacteria 7612
167 Ga0265316_10016587 3300031344 Bacteria 6384
168 Ga0265316_10185101 3300031344 Bacteria 1549
169 Ga0307513_10069165 3300031456 Bacteria 3695
170 Ga0265314_10058479 3300031711 Bacteria 2641
171 Ga0373930_0002265 3300034816 Bacteria 2966
172 Ga0373950_0007845 3300034818 Bacteria 1666
173 Ga0373958_0004127 3300034819 Bacteria 2135
174 Ga0373928_0002962 3300035084 Bacteria 3275
175 Ga0373940_0010113 3300035088 Bacteria 2210
176 Ga0373949_0000434 3300035090 Bacteria 14445
177 Ga0373952_0028994 3300035092 Bacteria 1217
178 Ga0373923_0017191 3300035111 Bacteria 2762
179 Ga0373932_0000660 3300035112 Bacteria 10480
180 Ga0373939_0000386 3300035114 Bacteria 11121
181 Ga0373941_0000231 3300035115 Bacteria 10777
182 Ga0373953_0032135 3300035117 Bacteria 2045
183 Ga0373956_0106134 3300035119 Bacteria 1306
184 Ga0373960_0000033 3300035121 Bacteria 17581
185 Ga0373942_0000540 3300035207 Bacteria 10623
186 Ga0373961_0001107 3300035241 Bacteria 8516
187 Ga0373962_0000943 3300035242 Bacteria 6697
188 Ga0373931_0002743 3300035691 Bacteria 7835
189 Ga0373927_0151633 3300035695 Bacteria 1518
190 Ga0373937_0109452 3300036401 Bacteria 2569
191 Ga0373925_0458331 3300037068 Bacteria 1045
192 Ga0436364_0953641 3300037853 Bacteria 1069
193 Ga0436364_1171789 3300037853 Bacteria 3385
194 Ga0436365_1277893 3300039437 Bacteria 3173
195 Ga0436365_1566341 3300039437 Bacteria 1515
196 Ga0451797_0015765 3300041453 Bacteria 1472
197 Ga0451807_1677723 3300041486 Bacteria 917
198 Ga0439441_036929 3300042001 Bacteria 967
199 Ga0439446_0024150 3300042156 Bacteria 1733
200 Ga0439435_0031576 3300042436 Bacteria 1441
201 Ga0439440_0024287 3300042993 Bacteria 1389
202 Ga0453683_0103765 3300044673 Bacteria 1785
203 Ga0495638_0065900 3300046460 Bacteria 2228
204 Ga0495580_0079486 3300046472 Bacteria 2287
205 Ga0495580_0086997 3300046472 Bacteria 2177
206 Ga0495639_0110336 3300046475 Bacteria 1305
207 Ga0495628_0168210 3300046516 Bacteria 1663
208 Ga0495645_0028905 3300046543 Bacteria 4029
209 Ga0495645_0173044 3300046543 Bacteria 1485
210 Ga0495667_0105182 3300046559 Bacteria 1824
211 Ga0495668_0042031 3300046616 Bacteria 2545
212 Ga0495599_0297749 3300046678 Bacteria 974
213 Ga0495649_0070941 3300046694 Bacteria 1867
214 Ga0495674_0027903 3300047319 Bacteria 5155
215 Ga0495672_0188830 3300047320 Bacteria 1038
216 Ga0495675_0349498 3300047444 Bacteria 870
217 Ga0495675_0371578 3300047444 Bacteria 838
218 Ga0495684_0141567 3300047471 Bacteria 1803
219 Ga0496105_0234446 3300048908 Bacteria 1491
220 Ga0496109_0000116 3300048912 Bacteria 82404
221 Ga0496112_0173398 3300048915 Bacteria 2122
222 Ga0496113_0116756 3300048916 Bacteria 2083
223 Ga0496115_0035850 3300048918 Bacteria 3927
224 Ga0501036_0056440 3300049572 Bacteria 3328
225 Ga0501042_0225017 3300049578 Bacteria 1353
226 Ga0501042_0236580 3300049578 Bacteria 1318
227 Ga0501048_0095283 3300049582 Bacteria 2099
228 Ga0501048_0258603 3300049582 Bacteria 1237
229 Ga0501068_0312422 3300049584 Bacteria 1007
230 Ga0501071_0062206 3300049587 Bacteria 2704
231 Ga0501072_0056821 3300049588 Bacteria 3083
232 Ga0501074_0108587 3300049590 Bacteria 1986
233 Ga0501076_0030556 3300049592 Bacteria 4196
234 Ga0501076_0247772 3300049592 Bacteria 1458
235 Ga0501081_0210772 3300049743 Bacteria 1411
236 Ga0501083_0016739 3300049744 Bacteria 5122
237 Ga0501045_0023386 3300049824 Bacteria 4429
238 Ga0501045_0377876 3300049824 Bacteria 1055
239 nmdc:mga0k408_133820_c1 3300050493 Bacteria 1472
240 nmdc:mga07m45_87363_c1 3300050496 Bacteria 1784
241 nmdc:mga05p37_132923_c1 3300050507 Bacteria 3052
242 nmdc:mga09592_242903_c1 3300050508 Bacteria 1560
243 nmdc:mga0qj67_277959_c1 3300050509 Bacteria 1357
244 nmdc:mga06r32_560678_c1 3300050510 Bacteria 1115
245 nmdc:mga08y16_268716_c1 3300050511 Bacteria 1761
246 nmdc:mga08y16_83597_c1 3300050511 Bacteria 3327
247 nmdc:mga0n895_126028_c1 3300050512 Bacteria 2584
248 nmdc:mga0n895_303006_c1 3300050512 Bacteria 1620
249 nmdc:mga0rr50_3740_c1 3300050513 Bacteria 8817
250 nmdc:mga0rr50_60304_c1 3300050513 Bacteria 2853
251 nmdc:mga08x19_228857_c1 3300050514 Bacteria 1279
252 nmdc:mga08x19_51718_c1 3300050514 Bacteria 2640
253 nmdc:mga0a205_444692_c1 3300050515 Bacteria 1157
254 Ga0495595_0053665 3300053084 Bacteria 1873
255 Ga0500641_0026418 3300053096 Bacteria 2254
256 Ga0500555_007236 3300053103 Bacteria 3155
257 Ga0500622_0087723 3300053156 Bacteria 1549
258 Ga0501084_0026462 3300054114 Bacteria 4841
259 Ga0501084_0448265 3300054114 Bacteria 1091
260 Ga0590071_000663 3300059421 Bacteria 9747
261 Ga0590075_000197 3300059424 Bacteria 16743
262 Ga0590075_007444 3300059424 Bacteria 2603
263 Ga0590077_001157 3300059426 Bacteria 6418
264 Ga0501082_0185899 3300060353 Bacteria 1808

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046543 Ga0495645_0173044 Ga0495645_0173044_194_898 234
2 3300046559 Ga0495667_0105182 Ga0495667_0105182_402_1106 234
3 3300047319 Ga0495674_0027903 Ga0495674_0027903_613_1317 234
4 3300047444 Ga0495675_0349498 Ga0495675_0349498_35_739 234
5 3300047471 Ga0495684_0141567 Ga0495684_0141567_702_1406 234
6 3300005366 Ga0070659_100019117 Ga0070659_1000191172 236
7 3300005539 Ga0068853_100034936 Ga0068853_1000349361 236
8 3300005614 Ga0068856_100078606 Ga0068856_1000786062 236
9 3300006028 Ga0070717_10069471 Ga0070717_100694714 236
10 3300013105 Ga0157369_10096507 Ga0157369_100965075 236
11 3300013296 Ga0157374_10025630 Ga0157374_100256303 236
12 3300013307 Ga0157372_10342527 Ga0157372_103425271 236
13 3300013307 Ga0157372_10467483 Ga0157372_104674832 236
14 3300026041 Ga0207639_10028845 Ga0207639_100288455 236
15 3300037853 Ga0436364_0953641 Ga0436364_0953641_65_775 236
16 3300047444 Ga0495675_0371578 Ga0495675_0371578_49_759 236
17 3300048915 Ga0496112_0173398 Ga0496112_0173398_770_1480 236
18 3300048916 Ga0496113_0116756 Ga0496113_0116756_405_1115 236
19 3300050512 nmdc:mga0n895_126028_c1 nmdc:mga0n895_126028_c1_766_1626 249
20 3300053096 Ga0500641_0026418 Ga0500641_0026418_557_1468 251
21 3300053103 Ga0500555_007236 Ga0500555_007236_947_1858 251
22 3300005329 Ga0070683_100057601 Ga0070683_1000576013 253
23 3300005535 Ga0070684_100021371 Ga0070684_1000213712 253
24 3300006195 Ga0075366_10143704 Ga0075366_101437042 253
25 3300013100 Ga0157373_10000188 Ga0157373_1000018826 253
26 3300013307 Ga0157372_10000458 Ga0157372_1000045822 253
27 3300050493 nmdc:mga0k408_133820_c1 nmdc:mga0k408_133820_c1_607_1371 253
28 3300035092 Ga0373952_0028994 Ga0373952_0028994_26_793 255
29 3300046516 Ga0495628_0168210 Ga0495628_0168210_758_1528 256
30 3300046543 Ga0495645_0028905 Ga0495645_0028905_914_1684 256
31 3300046678 Ga0495599_0297749 Ga0495599_0297749_82_852 256
32 3300050510 nmdc:mga06r32_560678_c1 nmdc:mga06r32_560678_c1_255_1034 257
33 3300042436 Ga0439435_0031576 Ga0439435_0031576_376_1245 258
34 3300042993 Ga0439440_0024287 Ga0439440_0024287_418_1284 258
35 3300050496 nmdc:mga07m45_87363_c1 nmdc:mga07m45_87363_c1_979_1758 258
36 3300013308 Ga0157375_10934640 Ga0157375_109346401 259
37 3300049744 Ga0501083_0016739 Ga0501083_0016739_551_1333 260
38 3300005295 Ga0065707_10096148 Ga0065707_100961484 262
39 3300035111 Ga0373923_0017191 Ga0373923_0017191_1033_1836 263
40 3300035117 Ga0373953_0032135 Ga0373953_0032135_72_875 263
41 3300035119 Ga0373956_0106134 Ga0373956_0106134_190_993 263
42 3300035695 Ga0373927_0151633 Ga0373927_0151633_316_1119 263
43 3300036401 Ga0373937_0109452 Ga0373937_0109452_637_1440 263
44 3300037853 Ga0436364_1171789 Ga0436364_1171789_359_1156 264
45 3300005435 Ga0070714_100047317 Ga0070714_1000473174 265
46 3300005436 Ga0070713_100038694 Ga0070713_1000386944 265
47 3300006175 Ga0070712_100111326 Ga0070712_1001113262 265
48 3300025916 Ga0207663_10239663 Ga0207663_102396632 265
49 3300025928 Ga0207700_10082486 Ga0207700_100824862 265
50 3300031344 Ga0265316_10185101 Ga0265316_101851012 265
51 3300006847 Ga0075431_100232280 Ga0075431_1002322802 267
52 3300059421 Ga0590071_000663 Ga0590071_000663_1373_2224 268
53 3300059424 Ga0590075_000197 Ga0590075_000197_7150_8001 268
54 3300059426 Ga0590077_001157 Ga0590077_001157_5496_6347 268
55 3300005564 Ga0070664_100219157 Ga0070664_1002191572 270
56 3300014969 Ga0157376_10093692 Ga0157376_100936924 270
57 3300046472 Ga0495580_0086997 Ga0495580_0086997_153_968 270
58 3300046475 Ga0495639_0110336 Ga0495639_0110336_401_1216 270
59 3300005535 Ga0070684_100252502 Ga0070684_1002525022 271
60 3300005842 Ga0068858_100187492 Ga0068858_1001874922 271
61 3300025928 Ga0207700_10572445 Ga0207700_105724451 271
62 3300005336 Ga0070680_100232642 Ga0070680_1002326422 272
63 3300005339 Ga0070660_100132696 Ga0070660_1001326962 272
64 3300005364 Ga0070673_100043964 Ga0070673_1000439643 272
65 3300005458 Ga0070681_10143948 Ga0070681_101439483 272
66 3300005518 Ga0070699_100183568 Ga0070699_1001835683 272
67 3300005546 Ga0070696_100034570 Ga0070696_1000345703 272
68 3300005563 Ga0068855_100012469 Ga0068855_1000124693 272
69 3300005563 Ga0068855_100370671 Ga0068855_1003706712 272
70 3300005563 Ga0068855_100641230 Ga0068855_1006412301 272
71 3300006237 Ga0097621_100280334 Ga0097621_1002803341 272
72 3300007076 Ga0075435_100026526 Ga0075435_1000265264 272
73 3300013104 Ga0157370_10118150 Ga0157370_101181502 272
74 3300013105 Ga0157369_10002131 Ga0157369_1000213112 272
75 3300013296 Ga0157374_10002312 Ga0157374_1000231211 272
76 3300013307 Ga0157372_10250082 Ga0157372_102500823 272
77 3300014969 Ga0157376_10676088 Ga0157376_106760881 272
78 3300025912 Ga0207707_10144685 Ga0207707_101446852 272
79 3300025919 Ga0207657_10276553 Ga0207657_102765532 272
80 3300025921 Ga0207652_10081767 Ga0207652_100817672 272
81 3300025928 Ga0207700_10450243 Ga0207700_104502431 272
82 3300025931 Ga0207644_10123588 Ga0207644_101235881 272
83 3300025949 Ga0207667_10009779 Ga0207667_100097792 272
84 3300025949 Ga0207667_10562149 Ga0207667_105621492 272
85 3300025960 Ga0207651_10037404 Ga0207651_100374042 272
86 3300031241 Ga0265325_10012521 Ga0265325_100125214 272
87 3300041486 Ga0451807_1677723 Ga0451807_1677723_37_903 272
88 3300047320 Ga0495672_0188830 Ga0495672_0188830_84_950 272
89 3300048918 Ga0496115_0035850 Ga0496115_0035850_1942_2781 272
90 3300050513 nmdc:mga0rr50_60304_c1 nmdc:mga0rr50_60304_c1_1871_2827 272
91 3300050514 nmdc:mga08x19_51718_c1 nmdc:mga08x19_51718_c1_1546_2388 272
92 3300005543 Ga0070672_100026368 Ga0070672_1000263683 273
93 3300005834 Ga0068851_10232497 Ga0068851_102324971 273
94 3300006237 Ga0097621_100119349 Ga0097621_1001193492 273
95 3300006358 Ga0068871_100095981 Ga0068871_1000959813 273
96 3300009093 Ga0105240_10432981 Ga0105240_104329812 273
97 3300009174 Ga0105241_10173423 Ga0105241_101734233 273
98 3300013105 Ga0157369_10238786 Ga0157369_102387862 273
99 3300013296 Ga0157374_10474876 Ga0157374_104748762 273
100 3300014969 Ga0157376_10081651 Ga0157376_100816512 273
101 3300025908 Ga0207643_10048370 Ga0207643_100483703 273
102 3300025936 Ga0207670_10287121 Ga0207670_102871211 273
103 3300025941 Ga0207711_10204194 Ga0207711_102041942 273
104 3300026095 Ga0207676_10399701 Ga0207676_103997012 273
105 3300026121 Ga0207683_10178935 Ga0207683_101789352 273
106 3300031711 Ga0265314_10058479 Ga0265314_100584793 273
107 3300046472 Ga0495580_0079486 Ga0495580_0079486_562_1398 273
108 3300049743 Ga0501081_0210772 Ga0501081_0210772_156_1001 273
109 3300054114 Ga0501084_0448265 Ga0501084_0448265_163_1008 273
110 3300014326 Ga0157380_10504005 Ga0157380_105040051 274
111 3300005330 Ga0070690_100037497 Ga0070690_1000374974 275
112 3300005333 Ga0070677_10066251 Ga0070677_100662512 275
113 3300005356 Ga0070674_100175400 Ga0070674_1001754002 275
114 3300005471 Ga0070698_100028739 Ga0070698_1000287393 275
115 3300005719 Ga0068861_100027001 Ga0068861_1000270012 275
116 3300005937 Ga0081455_10001998 Ga0081455_1000199817 275
117 3300006871 Ga0075434_100453465 Ga0075434_1004534652 275
118 3300007076 Ga0075435_100001203 Ga0075435_10000120310 275
119 3300009093 Ga0105240_10061299 Ga0105240_100612995 275
120 3300009098 Ga0105245_10029556 Ga0105245_100295564 275
121 3300009147 Ga0114129_10776407 Ga0114129_107764072 275
122 3300009177 Ga0105248_10234265 Ga0105248_102342653 275
123 3300013100 Ga0157373_10126660 Ga0157373_101266602 275
124 3300025940 Ga0207691_10014638 Ga0207691_100146385 275
125 3300025941 Ga0207711_10232974 Ga0207711_102329742 275
126 3300026118 Ga0207675_100018178 Ga0207675_1000181782 275
127 3300034816 Ga0373930_0002265 Ga0373930_0002265_314_1159 275
128 3300034818 Ga0373950_0007845 Ga0373950_0007845_262_1107 275
129 3300034819 Ga0373958_0004127 Ga0373958_0004127_166_1011 275
130 3300035084 Ga0373928_0002962 Ga0373928_0002962_1285_2130 275
131 3300035088 Ga0373940_0010113 Ga0373940_0010113_1117_1962 275
132 3300035090 Ga0373949_0000434 Ga0373949_0000434_4703_5548 275
133 3300035112 Ga0373932_0000660 Ga0373932_0000660_4946_5791 275
134 3300035114 Ga0373939_0000386 Ga0373939_0000386_7192_8037 275
135 3300035115 Ga0373941_0000231 Ga0373941_0000231_4541_5386 275
136 3300035121 Ga0373960_0000033 Ga0373960_0000033_3405_4250 275
137 3300035207 Ga0373942_0000540 Ga0373942_0000540_4699_5544 275
138 3300035241 Ga0373961_0001107 Ga0373961_0001107_1469_2314 275
139 3300035242 Ga0373962_0000943 Ga0373962_0000943_4413_5258 275
140 3300035691 Ga0373931_0002743 Ga0373931_0002743_1110_1955 275
141 3300039437 Ga0436365_1277893 Ga0436365_1277893_2031_2876 275
142 3300048912 Ga0496109_0000116 Ga0496109_0000116_30051_30962 275
143 3300050507 nmdc:mga05p37_132923_c1 nmdc:mga05p37_132923_c1_1110_2018 275
144 3300050508 nmdc:mga09592_242903_c1 nmdc:mga09592_242903_c1_394_1260 275
145 3300050512 nmdc:mga0n895_303006_c1 nmdc:mga0n895_303006_c1_349_1257 275
146 3300050513 nmdc:mga0rr50_3740_c1 nmdc:mga0rr50_3740_c1_6627_7472 275
147 3300050515 nmdc:mga0a205_444692_c1 nmdc:mga0a205_444692_c1_193_1050 275
148 3300005328 Ga0070676_10003723 Ga0070676_100037231 276
149 3300005330 Ga0070690_100100034 Ga0070690_1001000342 276
150 3300005353 Ga0070669_100010710 Ga0070669_1000107105 276
151 3300005440 Ga0070705_100069236 Ga0070705_1000692362 276
152 3300005441 Ga0070700_100011053 Ga0070700_1000110534 276
153 3300005459 Ga0068867_100062693 Ga0068867_1000626933 276
154 3300005471 Ga0070698_100059927 Ga0070698_1000599272 276
155 3300005545 Ga0070695_100006679 Ga0070695_1000066793 276
156 3300005546 Ga0070696_100164091 Ga0070696_1001640911 276
157 3300005549 Ga0070704_100027467 Ga0070704_1000274674 276
158 3300005578 Ga0068854_100180861 Ga0068854_1001808612 276
159 3300005615 Ga0070702_100007010 Ga0070702_1000070105 276
160 3300009148 Ga0105243_10016462 Ga0105243_100164624 276
161 3300025907 Ga0207645_10003081 Ga0207645_100030819 276
162 3300025935 Ga0207709_10142946 Ga0207709_101429462 276
163 3300026075 Ga0207708_10003249 Ga0207708_100032493 276
164 3300026089 Ga0207648_10016897 Ga0207648_100168975 276
165 3300026118 Ga0207675_100006468 Ga0207675_1000064682 276
166 3300027907 Ga0207428_10348068 Ga0207428_103480681 276
167 3300031249 Ga0265339_10006580 Ga0265339_100065802 276
168 3300031344 Ga0265316_10016587 Ga0265316_100165873 276
169 3300042001 Ga0439441_036929 Ga0439441_036929_23_865 276
170 3300042156 Ga0439446_0024150 Ga0439446_0024150_360_1229 276
171 3300049584 Ga0501068_0312422 Ga0501068_0312422_73_915 276
172 3300050511 nmdc:mga08y16_268716_c1 nmdc:mga08y16_268716_c1_459_1310 276
173 3300039437 Ga0436365_1566341 Ga0436365_1566341_554_1408 277
174 3300049592 Ga0501076_0247772 Ga0501076_0247772_189_1070 277
175 3300005340 Ga0070689_100069155 Ga0070689_1000691552 278
176 3300005343 Ga0070687_100039057 Ga0070687_1000390573 278
177 3300005365 Ga0070688_100137472 Ga0070688_1001374721 278
178 3300005544 Ga0070686_100000793 Ga0070686_1000007935 278
179 3300005578 Ga0068854_100011629 Ga0068854_1000116292 278
180 3300005937 Ga0081455_10010021 Ga0081455_100100215 278
181 3300006880 Ga0075429_100256945 Ga0075429_1002569452 278
182 3300025903 Ga0207680_10002825 Ga0207680_100028257 278
183 3300025918 Ga0207662_10052562 Ga0207662_100525623 278
184 3300025936 Ga0207670_10071847 Ga0207670_100718472 278
185 3300025981 Ga0207640_10061819 Ga0207640_100618193 278
186 3300037068 Ga0373925_0458331 Ga0373925_0458331_81_947 278
187 3300050514 nmdc:mga08x19_228857_c1 nmdc:mga08x19_228857_c1_47_961 278
188 3300006847 Ga0075431_100090190 Ga0075431_1000901901 279
189 3300025937 Ga0207669_10128369 Ga0207669_101283692 279
190 3300025942 Ga0207689_10091286 Ga0207689_100912863 279
191 3300046694 Ga0495649_0070941 Ga0495649_0070941_47_904 279
192 3300050509 nmdc:mga0qj67_277959_c1 nmdc:mga0qj67_277959_c1_269_1150 279
193 3300053084 Ga0495595_0053665 Ga0495595_0053665_626_1468 279
194 3300005336 Ga0070680_100417731 Ga0070680_1004177312 280
195 3300005530 Ga0070679_100010708 Ga0070679_1000107088 280
196 3300005548 Ga0070665_100010168 Ga0070665_1000101684 280
197 3300025921 Ga0207652_10105155 Ga0207652_101051554 280
198 3300026118 Ga0207675_100158951 Ga0207675_1001589511 280
199 3300048908 Ga0496105_0234446 Ga0496105_0234446_508_1389 281
200 3300049578 Ga0501042_0236580 Ga0501042_0236580_323_1174 281
201 3300049582 Ga0501048_0258603 Ga0501048_0258603_214_1077 281
202 3300049824 Ga0501045_0377876 Ga0501045_0377876_50_901 281
203 3300005333 Ga0070677_10001945 Ga0070677_100019453 282
204 3300005334 Ga0068869_100091140 Ga0068869_1000911402 282
205 3300005338 Ga0068868_100265940 Ga0068868_1002659402 282
206 3300005340 Ga0070689_100190948 Ga0070689_1001909482 282
207 3300005353 Ga0070669_100099704 Ga0070669_1000997042 282
208 3300005356 Ga0070674_100000193 Ga0070674_10000019327 282
209 3300005364 Ga0070673_100001348 Ga0070673_1000013485 282
210 3300005441 Ga0070700_100085284 Ga0070700_1000852841 282
211 3300005459 Ga0068867_100096733 Ga0068867_1000967332 282
212 3300005466 Ga0070685_10007760 Ga0070685_100077601 282
213 3300005466 Ga0070685_10037139 Ga0070685_100371393 282
214 3300005539 Ga0068853_100027962 Ga0068853_1000279622 282
215 3300005719 Ga0068861_100036371 Ga0068861_1000363713 282
216 3300005719 Ga0068861_100251218 Ga0068861_1002512182 282
217 3300005840 Ga0068870_10000445 Ga0068870_1000044515 282
218 3300006237 Ga0097621_100035151 Ga0097621_1000351514 282
219 3300006237 Ga0097621_100278988 Ga0097621_1002789882 282
220 3300006358 Ga0068871_100046518 Ga0068871_1000465182 282
221 3300006847 Ga0075431_100044928 Ga0075431_1000449285 282
222 3300009094 Ga0111539_10398838 Ga0111539_103988381 282
223 3300009148 Ga0105243_10176945 Ga0105243_101769452 282
224 3300014325 Ga0163163_10052467 Ga0163163_100524673 282
225 3300014326 Ga0157380_10082121 Ga0157380_100821212 282
226 3300025893 Ga0207682_10002519 Ga0207682_100025196 282
227 3300025901 Ga0207688_10211336 Ga0207688_102113362 282
228 3300025906 Ga0207699_10000014 Ga0207699_10000014149 282
229 3300025907 Ga0207645_10106801 Ga0207645_101068011 282
230 3300025908 Ga0207643_10004606 Ga0207643_100046064 282
231 3300025918 Ga0207662_10074476 Ga0207662_100744761 282
232 3300025923 Ga0207681_10071500 Ga0207681_100715002 282
233 3300025926 Ga0207659_10022721 Ga0207659_100227213 282
234 3300025928 Ga0207700_10321178 Ga0207700_103211782 282
235 3300025933 Ga0207706_10211184 Ga0207706_102111842 282
236 3300025937 Ga0207669_10012221 Ga0207669_100122213 282
237 3300025938 Ga0207704_10043910 Ga0207704_100439102 282
238 3300025942 Ga0207689_10014256 Ga0207689_100142562 282
239 3300026067 Ga0207678_10124099 Ga0207678_101240992 282
240 3300026075 Ga0207708_10113239 Ga0207708_101132392 282
241 3300026118 Ga0207675_100055874 Ga0207675_1000558741 282
242 3300026118 Ga0207675_100233292 Ga0207675_1002332922 282
243 3300026118 Ga0207675_100242339 Ga0207675_1002423392 282
244 3300028379 Ga0268266_10100446 Ga0268266_101004462 282
245 3300031456 Ga0307513_10069165 Ga0307513_100691652 282
246 3300041453 Ga0451797_0015765 Ga0451797_0015765_550_1416 282
247 3300044673 Ga0453683_0103765 Ga0453683_0103765_578_1450 282
248 3300046460 Ga0495638_0065900 Ga0495638_0065900_891_1757 282
249 3300046616 Ga0495668_0042031 Ga0495668_0042031_242_1108 282
250 3300050511 nmdc:mga08y16_83597_c1 nmdc:mga08y16_83597_c1_867_1733 282
251 3300053156 Ga0500622_0087723 Ga0500622_0087723_204_1094 282
252 3300049572 Ga0501036_0056440 Ga0501036_0056440_1843_2697 283
253 3300049578 Ga0501042_0225017 Ga0501042_0225017_314_1168 283
254 3300049582 Ga0501048_0095283 Ga0501048_0095283_1024_1878 283
255 3300049587 Ga0501071_0062206 Ga0501071_0062206_1733_2587 283
256 3300049588 Ga0501072_0056821 Ga0501072_0056821_24_878 283
257 3300049590 Ga0501074_0108587 Ga0501074_0108587_37_891 283
258 3300049592 Ga0501076_0030556 Ga0501076_0030556_184_1038 283
259 3300049824 Ga0501045_0023386 Ga0501045_0023386_1716_2570 283
260 3300054114 Ga0501084_0026462 Ga0501084_0026462_3181_4035 283
261 3300060353 Ga0501082_0185899 Ga0501082_0185899_204_1058 283
262 3300059424 Ga0590075_007444 Ga0590075_007444_677_1531 284
263 3300005290 Ga0065712_10032295 Ga0065712_100322951 286
264 3300005293 Ga0065715_10285083 Ga0065715_102850832 286

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01261

AP_endonuc_2

Xylose isomerase-like TIM barrel

75

315

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ngf-assembly1.cif.gz_A crystal structure of ap endonuclease, family 2 from brucella melitensis 0.8709 38 282
1k77-assembly1.cif.gz_A crystal structure of ec1530, a putative oxygenase from escherichia coli 0.8543 38 279
3kws-assembly1.cif.gz_B crystal structure of putative sugar isomerase (yp_001305149.1) from parabacteroides distasonis atcc 8503 at 1.68 a resolution 0.8415 38 283
3ngf-assembly1.cif.gz_A crystal structure of ap endonuclease, family 2 from brucella melitensis 0.8271 38 282
6wn6-assembly1.cif.gz_A crystal structure of 3-keto-d-glucoside 4-epimerase, ycjr, from e. coli, apo form 0.8195 38 284
ID Description Score Start End Superfamily
af_Q7T3H9_4_269_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.876 38 282 3.20.20.150
af_P30147_1_258_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8598 38 277 3.20.20.150
1k77A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8543 40 279 3.20.20.150
af_P36951_1_261_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8542 38 283 3.20.20.150
af_P76044_1_262_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8325 38 284 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A520W8Q5-F1-model_v4 Hydroxypyruvate isomerase 0.9848 38 286 GO:0016853
AF-A0A520HS35-F1-model_v4 Hydroxypyruvate isomerase 0.9825 38 286 GO:0016853
AF-A0A2V7GEV8-F1-model_v4 Xylose isomerase-like TIM barrel domain-containing protein 0.9816 95 286 GO:0016853
AF-A0A2V9FSA9-F1-model_v4 Hydroxypyruvate isomerase 0.9812 36 286 GO:0016853
AF-A0A6L8JFB5-F1-model_v4 deleted 0.9811 63 286

Feature Viewer

pLDDT pTM Quality
89.39 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map