F372925
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 264 | 190 | 264 | 278 |
Family's Representative Sequence
| Representative Sequence | 3300050513|nmdc:mga0rr50_60304_c1|nmdc:mga0rr50_60304_c1_1871_2827 |
| Length | 318 |
| Sequence | MRIDSPCVSATACAGRRAVRRGLKSTMNPQSVIRNPHWSRRALLAATGAALVSPWLRAQVTRVVKNARLKQSVSRWPYARIPLPEFCRALAEMGLPAIDLLEMNEWQTARDHGLVVSMGYAGGGSIPDALNVRANHDAIVRNFEQNIPKAAAAKVTNVITFFGNKRGMPDEEAIANCVAGLNRVKKVAEDHGVTICVELLNSKVNHKDYQGDRTSFGVQVMKAVDSPRVKLLYDIYHMQIMEGDVIRTIRDNHQYIAHYHTGGVPGRHELDDAQELNWRAIAKAVLDTGFTGYFAHEFVPTRDPLTSLSEAVALCDIS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 2 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 25 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 31 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 38 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 40 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 41 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 43 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 44 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 45 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 46 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 47 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 50 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 52 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 53 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 54 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 55 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 56 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 106 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 108 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 109 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 110 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 111 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 112 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 113 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 114 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 115 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 116 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 117 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 118 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 119 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 120 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 121 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 122 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 123 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 124 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 125 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 126 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 127 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 128 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 129 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 130 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 131 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 132 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 133 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 134 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 135 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 136 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 137 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 138 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 139 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 140 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 141 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 142 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 156 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 157 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 158 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 159 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 160 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 161 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 162 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 163 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 164 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 165 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 166 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 167 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 168 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 169 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 170 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 171 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 172 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 173 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 174 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 175 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 176 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 177 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 178 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 179 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 180 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 181 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 182 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 184 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 185 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 186 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 187 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 188 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 189 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 190 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.27 |
| Nodule | 0 |
| Rhizoplane | 2.65 |
| Rhizosphere | 93.18 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.89 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065712_10032295 | 3300005290 | Bacteria | 1165 |
| 2 | Ga0065715_10285083 | 3300005293 | Bacteria | 1077 |
| 3 | Ga0065707_10096148 | 3300005295 | Bacteria | 3300 |
| 4 | Ga0070676_10003723 | 3300005328 | Bacteria | 7993 |
| 5 | Ga0070683_100057601 | 3300005329 | Bacteria | 3610 |
| 6 | Ga0070690_100037497 | 3300005330 | Bacteria | 3055 |
| 7 | Ga0070690_100100034 | 3300005330 | Bacteria | 1921 |
| 8 | Ga0070677_10001945 | 3300005333 | Bacteria | 6552 |
| 9 | Ga0070677_10066251 | 3300005333 | Bacteria | 1505 |
| 10 | Ga0068869_100091140 | 3300005334 | Bacteria | 2292 |
| 11 | Ga0070680_100232642 | 3300005336 | Bacteria | 1557 |
| 12 | Ga0070680_100417731 | 3300005336 | Bacteria | 1144 |
| 13 | Ga0068868_100265940 | 3300005338 | Bacteria | 1448 |
| 14 | Ga0070660_100132696 | 3300005339 | Bacteria | 1994 |
| 15 | Ga0070689_100069155 | 3300005340 | Bacteria | 2755 |
| 16 | Ga0070689_100190948 | 3300005340 | Bacteria | 1668 |
| 17 | Ga0070687_100039057 | 3300005343 | Bacteria | 2383 |
| 18 | Ga0070669_100010710 | 3300005353 | Bacteria | 6506 |
| 19 | Ga0070669_100099704 | 3300005353 | Bacteria | 2189 |
| 20 | Ga0070674_100000193 | 3300005356 | Bacteria | 29122 |
| 21 | Ga0070674_100175400 | 3300005356 | Bacteria | 1637 |
| 22 | Ga0070673_100001348 | 3300005364 | Bacteria | 14331 |
| 23 | Ga0070673_100043964 | 3300005364 | Bacteria | 3456 |
| 24 | Ga0070688_100137472 | 3300005365 | Bacteria | 1656 |
| 25 | Ga0070659_100019117 | 3300005366 | Bacteria | 5183 |
| 26 | Ga0070714_100047317 | 3300005435 | Bacteria | 3653 |
| 27 | Ga0070713_100038694 | 3300005436 | Bacteria | 3866 |
| 28 | Ga0070705_100069236 | 3300005440 | Bacteria | 2127 |
| 29 | Ga0070700_100011053 | 3300005441 | Bacteria | 4993 |
| 30 | Ga0070700_100085284 | 3300005441 | Bacteria | 2049 |
| 31 | Ga0070681_10143948 | 3300005458 | Bacteria | 2313 |
| 32 | Ga0068867_100062693 | 3300005459 | Bacteria | 2762 |
| 33 | Ga0068867_100096733 | 3300005459 | Bacteria | 2248 |
| 34 | Ga0070685_10007760 | 3300005466 | Bacteria | 5493 |
| 35 | Ga0070685_10037139 | 3300005466 | Bacteria | 2757 |
| 36 | Ga0070698_100028739 | 3300005471 | Bacteria | 5772 |
| 37 | Ga0070698_100059927 | 3300005471 | Bacteria | 3842 |
| 38 | Ga0070699_100183568 | 3300005518 | Bacteria | 1857 |
| 39 | Ga0070679_100010708 | 3300005530 | Bacteria | 8707 |
| 40 | Ga0070684_100021371 | 3300005535 | Bacteria | 5384 |
| 41 | Ga0070684_100252502 | 3300005535 | Bacteria | 1612 |
| 42 | Ga0068853_100027962 | 3300005539 | Bacteria | 4742 |
| 43 | Ga0068853_100034936 | 3300005539 | Bacteria | 4268 |
| 44 | Ga0070672_100026368 | 3300005543 | Bacteria | 4323 |
| 45 | Ga0070686_100000793 | 3300005544 | Bacteria | 18295 |
| 46 | Ga0070695_100006679 | 3300005545 | Bacteria | 6822 |
| 47 | Ga0070696_100034570 | 3300005546 | Bacteria | 3478 |
| 48 | Ga0070696_100164091 | 3300005546 | Bacteria | 1638 |
| 49 | Ga0070665_100010168 | 3300005548 | Bacteria | 9515 |
| 50 | Ga0070704_100027467 | 3300005549 | Bacteria | 3776 |
| 51 | Ga0068855_100012469 | 3300005563 | Bacteria | 10259 |
| 52 | Ga0068855_100370671 | 3300005563 | Bacteria | 1574 |
| 53 | Ga0068855_100641230 | 3300005563 | Bacteria | 1142 |
| 54 | Ga0070664_100219157 | 3300005564 | Bacteria | 1702 |
| 55 | Ga0068854_100011629 | 3300005578 | Bacteria | 5740 |
| 56 | Ga0068854_100180861 | 3300005578 | Bacteria | 1647 |
| 57 | Ga0068856_100078606 | 3300005614 | Bacteria | 3271 |
| 58 | Ga0070702_100007010 | 3300005615 | Bacteria | 5372 |
| 59 | Ga0068861_100027001 | 3300005719 | Bacteria | 4179 |
| 60 | Ga0068861_100036371 | 3300005719 | Bacteria | 3653 |
| 61 | Ga0068861_100251218 | 3300005719 | Bacteria | 1509 |
| 62 | Ga0068851_10232497 | 3300005834 | Bacteria | 1040 |
| 63 | Ga0068870_10000445 | 3300005840 | Bacteria | 15676 |
| 64 | Ga0068858_100187492 | 3300005842 | Bacteria | 1954 |
| 65 | Ga0081455_10001998 | 3300005937 | Bacteria | 24355 |
| 66 | Ga0081455_10010021 | 3300005937 | Bacteria | 9683 |
| 67 | Ga0070717_10069471 | 3300006028 | Bacteria | 2934 |
| 68 | Ga0070712_100111326 | 3300006175 | Bacteria | 2044 |
| 69 | Ga0075366_10143704 | 3300006195 | Bacteria | 1443 |
| 70 | Ga0097621_100035151 | 3300006237 | Bacteria | 4002 |
| 71 | Ga0097621_100119349 | 3300006237 | Bacteria | 2235 |
| 72 | Ga0097621_100278988 | 3300006237 | Bacteria | 1471 |
| 73 | Ga0097621_100280334 | 3300006237 | Bacteria | 1467 |
| 74 | Ga0068871_100046518 | 3300006358 | Bacteria | 3495 |
| 75 | Ga0068871_100095981 | 3300006358 | Bacteria | 2476 |
| 76 | Ga0075431_100044928 | 3300006847 | Bacteria | 4555 |
| 77 | Ga0075431_100090190 | 3300006847 | Bacteria | 3163 |
| 78 | Ga0075431_100232280 | 3300006847 | Bacteria | 1879 |
| 79 | Ga0075434_100453465 | 3300006871 | Bacteria | 1304 |
| 80 | Ga0075429_100256945 | 3300006880 | Bacteria | 1530 |
| 81 | Ga0075435_100001203 | 3300007076 | Bacteria | 16551 |
| 82 | Ga0075435_100026526 | 3300007076 | Bacteria | 4522 |
| 83 | Ga0105240_10061299 | 3300009093 | Bacteria | 4688 |
| 84 | Ga0105240_10432981 | 3300009093 | Bacteria | 1475 |
| 85 | Ga0111539_10398838 | 3300009094 | Bacteria | 1602 |
| 86 | Ga0105245_10029556 | 3300009098 | Bacteria | 4843 |
| 87 | Ga0114129_10776407 | 3300009147 | Bacteria | 1224 |
| 88 | Ga0105243_10016462 | 3300009148 | Bacteria | 5591 |
| 89 | Ga0105243_10176945 | 3300009148 | Bacteria | 1852 |
| 90 | Ga0105241_10173423 | 3300009174 | Bacteria | 1783 |
| 91 | Ga0105248_10234265 | 3300009177 | Bacteria | 2067 |
| 92 | Ga0157373_10000188 | 3300013100 | Bacteria | 50875 |
| 93 | Ga0157373_10126660 | 3300013100 | Bacteria | 1796 |
| 94 | Ga0157370_10118150 | 3300013104 | Bacteria | 2477 |
| 95 | Ga0157369_10002131 | 3300013105 | Bacteria | 23862 |
| 96 | Ga0157369_10096507 | 3300013105 | Bacteria | 3154 |
| 97 | Ga0157369_10238786 | 3300013105 | Bacteria | 1898 |
| 98 | Ga0157374_10002312 | 3300013296 | Bacteria | 16060 |
| 99 | Ga0157374_10025630 | 3300013296 | Bacteria | 5297 |
| 100 | Ga0157374_10474876 | 3300013296 | Bacteria | 1253 |
| 101 | Ga0157372_10000458 | 3300013307 | Bacteria | 44772 |
| 102 | Ga0157372_10250082 | 3300013307 | Bacteria | 2058 |
| 103 | Ga0157372_10342527 | 3300013307 | Bacteria | 1741 |
| 104 | Ga0157372_10467483 | 3300013307 | Bacteria | 1470 |
| 105 | Ga0157375_10934640 | 3300013308 | Bacteria | 1010 |
| 106 | Ga0163163_10052467 | 3300014325 | Bacteria | 4023 |
| 107 | Ga0157380_10082121 | 3300014326 | Bacteria | 2637 |
| 108 | Ga0157380_10504005 | 3300014326 | Bacteria | 1177 |
| 109 | Ga0157376_10081651 | 3300014969 | Bacteria | 2776 |
| 110 | Ga0157376_10093692 | 3300014969 | Bacteria | 2608 |
| 111 | Ga0157376_10676088 | 3300014969 | Bacteria | 1035 |
| 112 | Ga0207682_10002519 | 3300025893 | Bacteria | 8185 |
| 113 | Ga0207688_10211336 | 3300025901 | Bacteria | 1166 |
| 114 | Ga0207680_10002825 | 3300025903 | Bacteria | 8138 |
| 115 | Ga0207699_10000014 | 3300025906 | Bacteria | 260521 |
| 116 | Ga0207645_10003081 | 3300025907 | Bacteria | 12793 |
| 117 | Ga0207645_10106801 | 3300025907 | Bacteria | 1810 |
| 118 | Ga0207643_10004606 | 3300025908 | Bacteria | 7405 |
| 119 | Ga0207643_10048370 | 3300025908 | Bacteria | 2409 |
| 120 | Ga0207707_10144685 | 3300025912 | Bacteria | 2078 |
| 121 | Ga0207663_10239663 | 3300025916 | Bacteria | 1330 |
| 122 | Ga0207662_10052562 | 3300025918 | Bacteria | 2425 |
| 123 | Ga0207662_10074476 | 3300025918 | Bacteria | 2061 |
| 124 | Ga0207657_10276553 | 3300025919 | Bacteria | 1334 |
| 125 | Ga0207652_10081767 | 3300025921 | Bacteria | 2826 |
| 126 | Ga0207652_10105155 | 3300025921 | Bacteria | 2498 |
| 127 | Ga0207681_10071500 | 3300025923 | Bacteria | 2420 |
| 128 | Ga0207659_10022721 | 3300025926 | Bacteria | 4178 |
| 129 | Ga0207700_10082486 | 3300025928 | Bacteria | 2514 |
| 130 | Ga0207700_10321178 | 3300025928 | Bacteria | 1342 |
| 131 | Ga0207700_10450243 | 3300025928 | Bacteria | 1135 |
| 132 | Ga0207700_10572445 | 3300025928 | Bacteria | 1004 |
| 133 | Ga0207644_10123588 | 3300025931 | Bacteria | 1973 |
| 134 | Ga0207706_10211184 | 3300025933 | Bacteria | 1701 |
| 135 | Ga0207709_10142946 | 3300025935 | Bacteria | 1647 |
| 136 | Ga0207670_10071847 | 3300025936 | Bacteria | 2394 |
| 137 | Ga0207670_10287121 | 3300025936 | Bacteria | 1284 |
| 138 | Ga0207669_10012221 | 3300025937 | Bacteria | 4215 |
| 139 | Ga0207669_10128369 | 3300025937 | Bacteria | 1737 |
| 140 | Ga0207704_10043910 | 3300025938 | Bacteria | 2644 |
| 141 | Ga0207691_10014638 | 3300025940 | Bacteria | 7479 |
| 142 | Ga0207711_10204194 | 3300025941 | Bacteria | 1804 |
| 143 | Ga0207711_10232974 | 3300025941 | Bacteria | 1687 |
| 144 | Ga0207689_10014256 | 3300025942 | Bacteria | 6763 |
| 145 | Ga0207689_10091286 | 3300025942 | Bacteria | 2502 |
| 146 | Ga0207667_10009779 | 3300025949 | Bacteria | 11279 |
| 147 | Ga0207667_10562149 | 3300025949 | Bacteria | 1153 |
| 148 | Ga0207651_10037404 | 3300025960 | Bacteria | 3179 |
| 149 | Ga0207640_10061819 | 3300025981 | Bacteria | 2482 |
| 150 | Ga0207639_10028845 | 3300026041 | Bacteria | 4057 |
| 151 | Ga0207678_10124099 | 3300026067 | Bacteria | 2203 |
| 152 | Ga0207708_10003249 | 3300026075 | Bacteria | 11978 |
| 153 | Ga0207708_10113239 | 3300026075 | Bacteria | 2108 |
| 154 | Ga0207648_10016897 | 3300026089 | Bacteria | 6650 |
| 155 | Ga0207676_10399701 | 3300026095 | Bacteria | 1284 |
| 156 | Ga0207675_100006468 | 3300026118 | Bacteria | 11095 |
| 157 | Ga0207675_100018178 | 3300026118 | Bacteria | 6555 |
| 158 | Ga0207675_100055874 | 3300026118 | Bacteria | 3683 |
| 159 | Ga0207675_100158951 | 3300026118 | Bacteria | 2155 |
| 160 | Ga0207675_100233292 | 3300026118 | Bacteria | 1776 |
| 161 | Ga0207675_100242339 | 3300026118 | Bacteria | 1743 |
| 162 | Ga0207683_10178935 | 3300026121 | Bacteria | 1923 |
| 163 | Ga0207428_10348068 | 3300027907 | Bacteria | 1091 |
| 164 | Ga0268266_10100446 | 3300028379 | Bacteria | 2549 |
| 165 | Ga0265325_10012521 | 3300031241 | Bacteria | 4848 |
| 166 | Ga0265339_10006580 | 3300031249 | Bacteria | 7612 |
| 167 | Ga0265316_10016587 | 3300031344 | Bacteria | 6384 |
| 168 | Ga0265316_10185101 | 3300031344 | Bacteria | 1549 |
| 169 | Ga0307513_10069165 | 3300031456 | Bacteria | 3695 |
| 170 | Ga0265314_10058479 | 3300031711 | Bacteria | 2641 |
| 171 | Ga0373930_0002265 | 3300034816 | Bacteria | 2966 |
| 172 | Ga0373950_0007845 | 3300034818 | Bacteria | 1666 |
| 173 | Ga0373958_0004127 | 3300034819 | Bacteria | 2135 |
| 174 | Ga0373928_0002962 | 3300035084 | Bacteria | 3275 |
| 175 | Ga0373940_0010113 | 3300035088 | Bacteria | 2210 |
| 176 | Ga0373949_0000434 | 3300035090 | Bacteria | 14445 |
| 177 | Ga0373952_0028994 | 3300035092 | Bacteria | 1217 |
| 178 | Ga0373923_0017191 | 3300035111 | Bacteria | 2762 |
| 179 | Ga0373932_0000660 | 3300035112 | Bacteria | 10480 |
| 180 | Ga0373939_0000386 | 3300035114 | Bacteria | 11121 |
| 181 | Ga0373941_0000231 | 3300035115 | Bacteria | 10777 |
| 182 | Ga0373953_0032135 | 3300035117 | Bacteria | 2045 |
| 183 | Ga0373956_0106134 | 3300035119 | Bacteria | 1306 |
| 184 | Ga0373960_0000033 | 3300035121 | Bacteria | 17581 |
| 185 | Ga0373942_0000540 | 3300035207 | Bacteria | 10623 |
| 186 | Ga0373961_0001107 | 3300035241 | Bacteria | 8516 |
| 187 | Ga0373962_0000943 | 3300035242 | Bacteria | 6697 |
| 188 | Ga0373931_0002743 | 3300035691 | Bacteria | 7835 |
| 189 | Ga0373927_0151633 | 3300035695 | Bacteria | 1518 |
| 190 | Ga0373937_0109452 | 3300036401 | Bacteria | 2569 |
| 191 | Ga0373925_0458331 | 3300037068 | Bacteria | 1045 |
| 192 | Ga0436364_0953641 | 3300037853 | Bacteria | 1069 |
| 193 | Ga0436364_1171789 | 3300037853 | Bacteria | 3385 |
| 194 | Ga0436365_1277893 | 3300039437 | Bacteria | 3173 |
| 195 | Ga0436365_1566341 | 3300039437 | Bacteria | 1515 |
| 196 | Ga0451797_0015765 | 3300041453 | Bacteria | 1472 |
| 197 | Ga0451807_1677723 | 3300041486 | Bacteria | 917 |
| 198 | Ga0439441_036929 | 3300042001 | Bacteria | 967 |
| 199 | Ga0439446_0024150 | 3300042156 | Bacteria | 1733 |
| 200 | Ga0439435_0031576 | 3300042436 | Bacteria | 1441 |
| 201 | Ga0439440_0024287 | 3300042993 | Bacteria | 1389 |
| 202 | Ga0453683_0103765 | 3300044673 | Bacteria | 1785 |
| 203 | Ga0495638_0065900 | 3300046460 | Bacteria | 2228 |
| 204 | Ga0495580_0079486 | 3300046472 | Bacteria | 2287 |
| 205 | Ga0495580_0086997 | 3300046472 | Bacteria | 2177 |
| 206 | Ga0495639_0110336 | 3300046475 | Bacteria | 1305 |
| 207 | Ga0495628_0168210 | 3300046516 | Bacteria | 1663 |
| 208 | Ga0495645_0028905 | 3300046543 | Bacteria | 4029 |
| 209 | Ga0495645_0173044 | 3300046543 | Bacteria | 1485 |
| 210 | Ga0495667_0105182 | 3300046559 | Bacteria | 1824 |
| 211 | Ga0495668_0042031 | 3300046616 | Bacteria | 2545 |
| 212 | Ga0495599_0297749 | 3300046678 | Bacteria | 974 |
| 213 | Ga0495649_0070941 | 3300046694 | Bacteria | 1867 |
| 214 | Ga0495674_0027903 | 3300047319 | Bacteria | 5155 |
| 215 | Ga0495672_0188830 | 3300047320 | Bacteria | 1038 |
| 216 | Ga0495675_0349498 | 3300047444 | Bacteria | 870 |
| 217 | Ga0495675_0371578 | 3300047444 | Bacteria | 838 |
| 218 | Ga0495684_0141567 | 3300047471 | Bacteria | 1803 |
| 219 | Ga0496105_0234446 | 3300048908 | Bacteria | 1491 |
| 220 | Ga0496109_0000116 | 3300048912 | Bacteria | 82404 |
| 221 | Ga0496112_0173398 | 3300048915 | Bacteria | 2122 |
| 222 | Ga0496113_0116756 | 3300048916 | Bacteria | 2083 |
| 223 | Ga0496115_0035850 | 3300048918 | Bacteria | 3927 |
| 224 | Ga0501036_0056440 | 3300049572 | Bacteria | 3328 |
| 225 | Ga0501042_0225017 | 3300049578 | Bacteria | 1353 |
| 226 | Ga0501042_0236580 | 3300049578 | Bacteria | 1318 |
| 227 | Ga0501048_0095283 | 3300049582 | Bacteria | 2099 |
| 228 | Ga0501048_0258603 | 3300049582 | Bacteria | 1237 |
| 229 | Ga0501068_0312422 | 3300049584 | Bacteria | 1007 |
| 230 | Ga0501071_0062206 | 3300049587 | Bacteria | 2704 |
| 231 | Ga0501072_0056821 | 3300049588 | Bacteria | 3083 |
| 232 | Ga0501074_0108587 | 3300049590 | Bacteria | 1986 |
| 233 | Ga0501076_0030556 | 3300049592 | Bacteria | 4196 |
| 234 | Ga0501076_0247772 | 3300049592 | Bacteria | 1458 |
| 235 | Ga0501081_0210772 | 3300049743 | Bacteria | 1411 |
| 236 | Ga0501083_0016739 | 3300049744 | Bacteria | 5122 |
| 237 | Ga0501045_0023386 | 3300049824 | Bacteria | 4429 |
| 238 | Ga0501045_0377876 | 3300049824 | Bacteria | 1055 |
| 239 | nmdc:mga0k408_133820_c1 | 3300050493 | Bacteria | 1472 |
| 240 | nmdc:mga07m45_87363_c1 | 3300050496 | Bacteria | 1784 |
| 241 | nmdc:mga05p37_132923_c1 | 3300050507 | Bacteria | 3052 |
| 242 | nmdc:mga09592_242903_c1 | 3300050508 | Bacteria | 1560 |
| 243 | nmdc:mga0qj67_277959_c1 | 3300050509 | Bacteria | 1357 |
| 244 | nmdc:mga06r32_560678_c1 | 3300050510 | Bacteria | 1115 |
| 245 | nmdc:mga08y16_268716_c1 | 3300050511 | Bacteria | 1761 |
| 246 | nmdc:mga08y16_83597_c1 | 3300050511 | Bacteria | 3327 |
| 247 | nmdc:mga0n895_126028_c1 | 3300050512 | Bacteria | 2584 |
| 248 | nmdc:mga0n895_303006_c1 | 3300050512 | Bacteria | 1620 |
| 249 | nmdc:mga0rr50_3740_c1 | 3300050513 | Bacteria | 8817 |
| 250 | nmdc:mga0rr50_60304_c1 | 3300050513 | Bacteria | 2853 |
| 251 | nmdc:mga08x19_228857_c1 | 3300050514 | Bacteria | 1279 |
| 252 | nmdc:mga08x19_51718_c1 | 3300050514 | Bacteria | 2640 |
| 253 | nmdc:mga0a205_444692_c1 | 3300050515 | Bacteria | 1157 |
| 254 | Ga0495595_0053665 | 3300053084 | Bacteria | 1873 |
| 255 | Ga0500641_0026418 | 3300053096 | Bacteria | 2254 |
| 256 | Ga0500555_007236 | 3300053103 | Bacteria | 3155 |
| 257 | Ga0500622_0087723 | 3300053156 | Bacteria | 1549 |
| 258 | Ga0501084_0026462 | 3300054114 | Bacteria | 4841 |
| 259 | Ga0501084_0448265 | 3300054114 | Bacteria | 1091 |
| 260 | Ga0590071_000663 | 3300059421 | Bacteria | 9747 |
| 261 | Ga0590075_000197 | 3300059424 | Bacteria | 16743 |
| 262 | Ga0590075_007444 | 3300059424 | Bacteria | 2603 |
| 263 | Ga0590077_001157 | 3300059426 | Bacteria | 6418 |
| 264 | Ga0501082_0185899 | 3300060353 | Bacteria | 1808 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046543 | Ga0495645_0173044 | Ga0495645_0173044_194_898 | 234 |
| 2 | 3300046559 | Ga0495667_0105182 | Ga0495667_0105182_402_1106 | 234 |
| 3 | 3300047319 | Ga0495674_0027903 | Ga0495674_0027903_613_1317 | 234 |
| 4 | 3300047444 | Ga0495675_0349498 | Ga0495675_0349498_35_739 | 234 |
| 5 | 3300047471 | Ga0495684_0141567 | Ga0495684_0141567_702_1406 | 234 |
| 6 | 3300005366 | Ga0070659_100019117 | Ga0070659_1000191172 | 236 |
| 7 | 3300005539 | Ga0068853_100034936 | Ga0068853_1000349361 | 236 |
| 8 | 3300005614 | Ga0068856_100078606 | Ga0068856_1000786062 | 236 |
| 9 | 3300006028 | Ga0070717_10069471 | Ga0070717_100694714 | 236 |
| 10 | 3300013105 | Ga0157369_10096507 | Ga0157369_100965075 | 236 |
| 11 | 3300013296 | Ga0157374_10025630 | Ga0157374_100256303 | 236 |
| 12 | 3300013307 | Ga0157372_10342527 | Ga0157372_103425271 | 236 |
| 13 | 3300013307 | Ga0157372_10467483 | Ga0157372_104674832 | 236 |
| 14 | 3300026041 | Ga0207639_10028845 | Ga0207639_100288455 | 236 |
| 15 | 3300037853 | Ga0436364_0953641 | Ga0436364_0953641_65_775 | 236 |
| 16 | 3300047444 | Ga0495675_0371578 | Ga0495675_0371578_49_759 | 236 |
| 17 | 3300048915 | Ga0496112_0173398 | Ga0496112_0173398_770_1480 | 236 |
| 18 | 3300048916 | Ga0496113_0116756 | Ga0496113_0116756_405_1115 | 236 |
| 19 | 3300050512 | nmdc:mga0n895_126028_c1 | nmdc:mga0n895_126028_c1_766_1626 | 249 |
| 20 | 3300053096 | Ga0500641_0026418 | Ga0500641_0026418_557_1468 | 251 |
| 21 | 3300053103 | Ga0500555_007236 | Ga0500555_007236_947_1858 | 251 |
| 22 | 3300005329 | Ga0070683_100057601 | Ga0070683_1000576013 | 253 |
| 23 | 3300005535 | Ga0070684_100021371 | Ga0070684_1000213712 | 253 |
| 24 | 3300006195 | Ga0075366_10143704 | Ga0075366_101437042 | 253 |
| 25 | 3300013100 | Ga0157373_10000188 | Ga0157373_1000018826 | 253 |
| 26 | 3300013307 | Ga0157372_10000458 | Ga0157372_1000045822 | 253 |
| 27 | 3300050493 | nmdc:mga0k408_133820_c1 | nmdc:mga0k408_133820_c1_607_1371 | 253 |
| 28 | 3300035092 | Ga0373952_0028994 | Ga0373952_0028994_26_793 | 255 |
| 29 | 3300046516 | Ga0495628_0168210 | Ga0495628_0168210_758_1528 | 256 |
| 30 | 3300046543 | Ga0495645_0028905 | Ga0495645_0028905_914_1684 | 256 |
| 31 | 3300046678 | Ga0495599_0297749 | Ga0495599_0297749_82_852 | 256 |
| 32 | 3300050510 | nmdc:mga06r32_560678_c1 | nmdc:mga06r32_560678_c1_255_1034 | 257 |
| 33 | 3300042436 | Ga0439435_0031576 | Ga0439435_0031576_376_1245 | 258 |
| 34 | 3300042993 | Ga0439440_0024287 | Ga0439440_0024287_418_1284 | 258 |
| 35 | 3300050496 | nmdc:mga07m45_87363_c1 | nmdc:mga07m45_87363_c1_979_1758 | 258 |
| 36 | 3300013308 | Ga0157375_10934640 | Ga0157375_109346401 | 259 |
| 37 | 3300049744 | Ga0501083_0016739 | Ga0501083_0016739_551_1333 | 260 |
| 38 | 3300005295 | Ga0065707_10096148 | Ga0065707_100961484 | 262 |
| 39 | 3300035111 | Ga0373923_0017191 | Ga0373923_0017191_1033_1836 | 263 |
| 40 | 3300035117 | Ga0373953_0032135 | Ga0373953_0032135_72_875 | 263 |
| 41 | 3300035119 | Ga0373956_0106134 | Ga0373956_0106134_190_993 | 263 |
| 42 | 3300035695 | Ga0373927_0151633 | Ga0373927_0151633_316_1119 | 263 |
| 43 | 3300036401 | Ga0373937_0109452 | Ga0373937_0109452_637_1440 | 263 |
| 44 | 3300037853 | Ga0436364_1171789 | Ga0436364_1171789_359_1156 | 264 |
| 45 | 3300005435 | Ga0070714_100047317 | Ga0070714_1000473174 | 265 |
| 46 | 3300005436 | Ga0070713_100038694 | Ga0070713_1000386944 | 265 |
| 47 | 3300006175 | Ga0070712_100111326 | Ga0070712_1001113262 | 265 |
| 48 | 3300025916 | Ga0207663_10239663 | Ga0207663_102396632 | 265 |
| 49 | 3300025928 | Ga0207700_10082486 | Ga0207700_100824862 | 265 |
| 50 | 3300031344 | Ga0265316_10185101 | Ga0265316_101851012 | 265 |
| 51 | 3300006847 | Ga0075431_100232280 | Ga0075431_1002322802 | 267 |
| 52 | 3300059421 | Ga0590071_000663 | Ga0590071_000663_1373_2224 | 268 |
| 53 | 3300059424 | Ga0590075_000197 | Ga0590075_000197_7150_8001 | 268 |
| 54 | 3300059426 | Ga0590077_001157 | Ga0590077_001157_5496_6347 | 268 |
| 55 | 3300005564 | Ga0070664_100219157 | Ga0070664_1002191572 | 270 |
| 56 | 3300014969 | Ga0157376_10093692 | Ga0157376_100936924 | 270 |
| 57 | 3300046472 | Ga0495580_0086997 | Ga0495580_0086997_153_968 | 270 |
| 58 | 3300046475 | Ga0495639_0110336 | Ga0495639_0110336_401_1216 | 270 |
| 59 | 3300005535 | Ga0070684_100252502 | Ga0070684_1002525022 | 271 |
| 60 | 3300005842 | Ga0068858_100187492 | Ga0068858_1001874922 | 271 |
| 61 | 3300025928 | Ga0207700_10572445 | Ga0207700_105724451 | 271 |
| 62 | 3300005336 | Ga0070680_100232642 | Ga0070680_1002326422 | 272 |
| 63 | 3300005339 | Ga0070660_100132696 | Ga0070660_1001326962 | 272 |
| 64 | 3300005364 | Ga0070673_100043964 | Ga0070673_1000439643 | 272 |
| 65 | 3300005458 | Ga0070681_10143948 | Ga0070681_101439483 | 272 |
| 66 | 3300005518 | Ga0070699_100183568 | Ga0070699_1001835683 | 272 |
| 67 | 3300005546 | Ga0070696_100034570 | Ga0070696_1000345703 | 272 |
| 68 | 3300005563 | Ga0068855_100012469 | Ga0068855_1000124693 | 272 |
| 69 | 3300005563 | Ga0068855_100370671 | Ga0068855_1003706712 | 272 |
| 70 | 3300005563 | Ga0068855_100641230 | Ga0068855_1006412301 | 272 |
| 71 | 3300006237 | Ga0097621_100280334 | Ga0097621_1002803341 | 272 |
| 72 | 3300007076 | Ga0075435_100026526 | Ga0075435_1000265264 | 272 |
| 73 | 3300013104 | Ga0157370_10118150 | Ga0157370_101181502 | 272 |
| 74 | 3300013105 | Ga0157369_10002131 | Ga0157369_1000213112 | 272 |
| 75 | 3300013296 | Ga0157374_10002312 | Ga0157374_1000231211 | 272 |
| 76 | 3300013307 | Ga0157372_10250082 | Ga0157372_102500823 | 272 |
| 77 | 3300014969 | Ga0157376_10676088 | Ga0157376_106760881 | 272 |
| 78 | 3300025912 | Ga0207707_10144685 | Ga0207707_101446852 | 272 |
| 79 | 3300025919 | Ga0207657_10276553 | Ga0207657_102765532 | 272 |
| 80 | 3300025921 | Ga0207652_10081767 | Ga0207652_100817672 | 272 |
| 81 | 3300025928 | Ga0207700_10450243 | Ga0207700_104502431 | 272 |
| 82 | 3300025931 | Ga0207644_10123588 | Ga0207644_101235881 | 272 |
| 83 | 3300025949 | Ga0207667_10009779 | Ga0207667_100097792 | 272 |
| 84 | 3300025949 | Ga0207667_10562149 | Ga0207667_105621492 | 272 |
| 85 | 3300025960 | Ga0207651_10037404 | Ga0207651_100374042 | 272 |
| 86 | 3300031241 | Ga0265325_10012521 | Ga0265325_100125214 | 272 |
| 87 | 3300041486 | Ga0451807_1677723 | Ga0451807_1677723_37_903 | 272 |
| 88 | 3300047320 | Ga0495672_0188830 | Ga0495672_0188830_84_950 | 272 |
| 89 | 3300048918 | Ga0496115_0035850 | Ga0496115_0035850_1942_2781 | 272 |
| 90 | 3300050513 | nmdc:mga0rr50_60304_c1 | nmdc:mga0rr50_60304_c1_1871_2827 | 272 |
| 91 | 3300050514 | nmdc:mga08x19_51718_c1 | nmdc:mga08x19_51718_c1_1546_2388 | 272 |
| 92 | 3300005543 | Ga0070672_100026368 | Ga0070672_1000263683 | 273 |
| 93 | 3300005834 | Ga0068851_10232497 | Ga0068851_102324971 | 273 |
| 94 | 3300006237 | Ga0097621_100119349 | Ga0097621_1001193492 | 273 |
| 95 | 3300006358 | Ga0068871_100095981 | Ga0068871_1000959813 | 273 |
| 96 | 3300009093 | Ga0105240_10432981 | Ga0105240_104329812 | 273 |
| 97 | 3300009174 | Ga0105241_10173423 | Ga0105241_101734233 | 273 |
| 98 | 3300013105 | Ga0157369_10238786 | Ga0157369_102387862 | 273 |
| 99 | 3300013296 | Ga0157374_10474876 | Ga0157374_104748762 | 273 |
| 100 | 3300014969 | Ga0157376_10081651 | Ga0157376_100816512 | 273 |
| 101 | 3300025908 | Ga0207643_10048370 | Ga0207643_100483703 | 273 |
| 102 | 3300025936 | Ga0207670_10287121 | Ga0207670_102871211 | 273 |
| 103 | 3300025941 | Ga0207711_10204194 | Ga0207711_102041942 | 273 |
| 104 | 3300026095 | Ga0207676_10399701 | Ga0207676_103997012 | 273 |
| 105 | 3300026121 | Ga0207683_10178935 | Ga0207683_101789352 | 273 |
| 106 | 3300031711 | Ga0265314_10058479 | Ga0265314_100584793 | 273 |
| 107 | 3300046472 | Ga0495580_0079486 | Ga0495580_0079486_562_1398 | 273 |
| 108 | 3300049743 | Ga0501081_0210772 | Ga0501081_0210772_156_1001 | 273 |
| 109 | 3300054114 | Ga0501084_0448265 | Ga0501084_0448265_163_1008 | 273 |
| 110 | 3300014326 | Ga0157380_10504005 | Ga0157380_105040051 | 274 |
| 111 | 3300005330 | Ga0070690_100037497 | Ga0070690_1000374974 | 275 |
| 112 | 3300005333 | Ga0070677_10066251 | Ga0070677_100662512 | 275 |
| 113 | 3300005356 | Ga0070674_100175400 | Ga0070674_1001754002 | 275 |
| 114 | 3300005471 | Ga0070698_100028739 | Ga0070698_1000287393 | 275 |
| 115 | 3300005719 | Ga0068861_100027001 | Ga0068861_1000270012 | 275 |
| 116 | 3300005937 | Ga0081455_10001998 | Ga0081455_1000199817 | 275 |
| 117 | 3300006871 | Ga0075434_100453465 | Ga0075434_1004534652 | 275 |
| 118 | 3300007076 | Ga0075435_100001203 | Ga0075435_10000120310 | 275 |
| 119 | 3300009093 | Ga0105240_10061299 | Ga0105240_100612995 | 275 |
| 120 | 3300009098 | Ga0105245_10029556 | Ga0105245_100295564 | 275 |
| 121 | 3300009147 | Ga0114129_10776407 | Ga0114129_107764072 | 275 |
| 122 | 3300009177 | Ga0105248_10234265 | Ga0105248_102342653 | 275 |
| 123 | 3300013100 | Ga0157373_10126660 | Ga0157373_101266602 | 275 |
| 124 | 3300025940 | Ga0207691_10014638 | Ga0207691_100146385 | 275 |
| 125 | 3300025941 | Ga0207711_10232974 | Ga0207711_102329742 | 275 |
| 126 | 3300026118 | Ga0207675_100018178 | Ga0207675_1000181782 | 275 |
| 127 | 3300034816 | Ga0373930_0002265 | Ga0373930_0002265_314_1159 | 275 |
| 128 | 3300034818 | Ga0373950_0007845 | Ga0373950_0007845_262_1107 | 275 |
| 129 | 3300034819 | Ga0373958_0004127 | Ga0373958_0004127_166_1011 | 275 |
| 130 | 3300035084 | Ga0373928_0002962 | Ga0373928_0002962_1285_2130 | 275 |
| 131 | 3300035088 | Ga0373940_0010113 | Ga0373940_0010113_1117_1962 | 275 |
| 132 | 3300035090 | Ga0373949_0000434 | Ga0373949_0000434_4703_5548 | 275 |
| 133 | 3300035112 | Ga0373932_0000660 | Ga0373932_0000660_4946_5791 | 275 |
| 134 | 3300035114 | Ga0373939_0000386 | Ga0373939_0000386_7192_8037 | 275 |
| 135 | 3300035115 | Ga0373941_0000231 | Ga0373941_0000231_4541_5386 | 275 |
| 136 | 3300035121 | Ga0373960_0000033 | Ga0373960_0000033_3405_4250 | 275 |
| 137 | 3300035207 | Ga0373942_0000540 | Ga0373942_0000540_4699_5544 | 275 |
| 138 | 3300035241 | Ga0373961_0001107 | Ga0373961_0001107_1469_2314 | 275 |
| 139 | 3300035242 | Ga0373962_0000943 | Ga0373962_0000943_4413_5258 | 275 |
| 140 | 3300035691 | Ga0373931_0002743 | Ga0373931_0002743_1110_1955 | 275 |
| 141 | 3300039437 | Ga0436365_1277893 | Ga0436365_1277893_2031_2876 | 275 |
| 142 | 3300048912 | Ga0496109_0000116 | Ga0496109_0000116_30051_30962 | 275 |
| 143 | 3300050507 | nmdc:mga05p37_132923_c1 | nmdc:mga05p37_132923_c1_1110_2018 | 275 |
| 144 | 3300050508 | nmdc:mga09592_242903_c1 | nmdc:mga09592_242903_c1_394_1260 | 275 |
| 145 | 3300050512 | nmdc:mga0n895_303006_c1 | nmdc:mga0n895_303006_c1_349_1257 | 275 |
| 146 | 3300050513 | nmdc:mga0rr50_3740_c1 | nmdc:mga0rr50_3740_c1_6627_7472 | 275 |
| 147 | 3300050515 | nmdc:mga0a205_444692_c1 | nmdc:mga0a205_444692_c1_193_1050 | 275 |
| 148 | 3300005328 | Ga0070676_10003723 | Ga0070676_100037231 | 276 |
| 149 | 3300005330 | Ga0070690_100100034 | Ga0070690_1001000342 | 276 |
| 150 | 3300005353 | Ga0070669_100010710 | Ga0070669_1000107105 | 276 |
| 151 | 3300005440 | Ga0070705_100069236 | Ga0070705_1000692362 | 276 |
| 152 | 3300005441 | Ga0070700_100011053 | Ga0070700_1000110534 | 276 |
| 153 | 3300005459 | Ga0068867_100062693 | Ga0068867_1000626933 | 276 |
| 154 | 3300005471 | Ga0070698_100059927 | Ga0070698_1000599272 | 276 |
| 155 | 3300005545 | Ga0070695_100006679 | Ga0070695_1000066793 | 276 |
| 156 | 3300005546 | Ga0070696_100164091 | Ga0070696_1001640911 | 276 |
| 157 | 3300005549 | Ga0070704_100027467 | Ga0070704_1000274674 | 276 |
| 158 | 3300005578 | Ga0068854_100180861 | Ga0068854_1001808612 | 276 |
| 159 | 3300005615 | Ga0070702_100007010 | Ga0070702_1000070105 | 276 |
| 160 | 3300009148 | Ga0105243_10016462 | Ga0105243_100164624 | 276 |
| 161 | 3300025907 | Ga0207645_10003081 | Ga0207645_100030819 | 276 |
| 162 | 3300025935 | Ga0207709_10142946 | Ga0207709_101429462 | 276 |
| 163 | 3300026075 | Ga0207708_10003249 | Ga0207708_100032493 | 276 |
| 164 | 3300026089 | Ga0207648_10016897 | Ga0207648_100168975 | 276 |
| 165 | 3300026118 | Ga0207675_100006468 | Ga0207675_1000064682 | 276 |
| 166 | 3300027907 | Ga0207428_10348068 | Ga0207428_103480681 | 276 |
| 167 | 3300031249 | Ga0265339_10006580 | Ga0265339_100065802 | 276 |
| 168 | 3300031344 | Ga0265316_10016587 | Ga0265316_100165873 | 276 |
| 169 | 3300042001 | Ga0439441_036929 | Ga0439441_036929_23_865 | 276 |
| 170 | 3300042156 | Ga0439446_0024150 | Ga0439446_0024150_360_1229 | 276 |
| 171 | 3300049584 | Ga0501068_0312422 | Ga0501068_0312422_73_915 | 276 |
| 172 | 3300050511 | nmdc:mga08y16_268716_c1 | nmdc:mga08y16_268716_c1_459_1310 | 276 |
| 173 | 3300039437 | Ga0436365_1566341 | Ga0436365_1566341_554_1408 | 277 |
| 174 | 3300049592 | Ga0501076_0247772 | Ga0501076_0247772_189_1070 | 277 |
| 175 | 3300005340 | Ga0070689_100069155 | Ga0070689_1000691552 | 278 |
| 176 | 3300005343 | Ga0070687_100039057 | Ga0070687_1000390573 | 278 |
| 177 | 3300005365 | Ga0070688_100137472 | Ga0070688_1001374721 | 278 |
| 178 | 3300005544 | Ga0070686_100000793 | Ga0070686_1000007935 | 278 |
| 179 | 3300005578 | Ga0068854_100011629 | Ga0068854_1000116292 | 278 |
| 180 | 3300005937 | Ga0081455_10010021 | Ga0081455_100100215 | 278 |
| 181 | 3300006880 | Ga0075429_100256945 | Ga0075429_1002569452 | 278 |
| 182 | 3300025903 | Ga0207680_10002825 | Ga0207680_100028257 | 278 |
| 183 | 3300025918 | Ga0207662_10052562 | Ga0207662_100525623 | 278 |
| 184 | 3300025936 | Ga0207670_10071847 | Ga0207670_100718472 | 278 |
| 185 | 3300025981 | Ga0207640_10061819 | Ga0207640_100618193 | 278 |
| 186 | 3300037068 | Ga0373925_0458331 | Ga0373925_0458331_81_947 | 278 |
| 187 | 3300050514 | nmdc:mga08x19_228857_c1 | nmdc:mga08x19_228857_c1_47_961 | 278 |
| 188 | 3300006847 | Ga0075431_100090190 | Ga0075431_1000901901 | 279 |
| 189 | 3300025937 | Ga0207669_10128369 | Ga0207669_101283692 | 279 |
| 190 | 3300025942 | Ga0207689_10091286 | Ga0207689_100912863 | 279 |
| 191 | 3300046694 | Ga0495649_0070941 | Ga0495649_0070941_47_904 | 279 |
| 192 | 3300050509 | nmdc:mga0qj67_277959_c1 | nmdc:mga0qj67_277959_c1_269_1150 | 279 |
| 193 | 3300053084 | Ga0495595_0053665 | Ga0495595_0053665_626_1468 | 279 |
| 194 | 3300005336 | Ga0070680_100417731 | Ga0070680_1004177312 | 280 |
| 195 | 3300005530 | Ga0070679_100010708 | Ga0070679_1000107088 | 280 |
| 196 | 3300005548 | Ga0070665_100010168 | Ga0070665_1000101684 | 280 |
| 197 | 3300025921 | Ga0207652_10105155 | Ga0207652_101051554 | 280 |
| 198 | 3300026118 | Ga0207675_100158951 | Ga0207675_1001589511 | 280 |
| 199 | 3300048908 | Ga0496105_0234446 | Ga0496105_0234446_508_1389 | 281 |
| 200 | 3300049578 | Ga0501042_0236580 | Ga0501042_0236580_323_1174 | 281 |
| 201 | 3300049582 | Ga0501048_0258603 | Ga0501048_0258603_214_1077 | 281 |
| 202 | 3300049824 | Ga0501045_0377876 | Ga0501045_0377876_50_901 | 281 |
| 203 | 3300005333 | Ga0070677_10001945 | Ga0070677_100019453 | 282 |
| 204 | 3300005334 | Ga0068869_100091140 | Ga0068869_1000911402 | 282 |
| 205 | 3300005338 | Ga0068868_100265940 | Ga0068868_1002659402 | 282 |
| 206 | 3300005340 | Ga0070689_100190948 | Ga0070689_1001909482 | 282 |
| 207 | 3300005353 | Ga0070669_100099704 | Ga0070669_1000997042 | 282 |
| 208 | 3300005356 | Ga0070674_100000193 | Ga0070674_10000019327 | 282 |
| 209 | 3300005364 | Ga0070673_100001348 | Ga0070673_1000013485 | 282 |
| 210 | 3300005441 | Ga0070700_100085284 | Ga0070700_1000852841 | 282 |
| 211 | 3300005459 | Ga0068867_100096733 | Ga0068867_1000967332 | 282 |
| 212 | 3300005466 | Ga0070685_10007760 | Ga0070685_100077601 | 282 |
| 213 | 3300005466 | Ga0070685_10037139 | Ga0070685_100371393 | 282 |
| 214 | 3300005539 | Ga0068853_100027962 | Ga0068853_1000279622 | 282 |
| 215 | 3300005719 | Ga0068861_100036371 | Ga0068861_1000363713 | 282 |
| 216 | 3300005719 | Ga0068861_100251218 | Ga0068861_1002512182 | 282 |
| 217 | 3300005840 | Ga0068870_10000445 | Ga0068870_1000044515 | 282 |
| 218 | 3300006237 | Ga0097621_100035151 | Ga0097621_1000351514 | 282 |
| 219 | 3300006237 | Ga0097621_100278988 | Ga0097621_1002789882 | 282 |
| 220 | 3300006358 | Ga0068871_100046518 | Ga0068871_1000465182 | 282 |
| 221 | 3300006847 | Ga0075431_100044928 | Ga0075431_1000449285 | 282 |
| 222 | 3300009094 | Ga0111539_10398838 | Ga0111539_103988381 | 282 |
| 223 | 3300009148 | Ga0105243_10176945 | Ga0105243_101769452 | 282 |
| 224 | 3300014325 | Ga0163163_10052467 | Ga0163163_100524673 | 282 |
| 225 | 3300014326 | Ga0157380_10082121 | Ga0157380_100821212 | 282 |
| 226 | 3300025893 | Ga0207682_10002519 | Ga0207682_100025196 | 282 |
| 227 | 3300025901 | Ga0207688_10211336 | Ga0207688_102113362 | 282 |
| 228 | 3300025906 | Ga0207699_10000014 | Ga0207699_10000014149 | 282 |
| 229 | 3300025907 | Ga0207645_10106801 | Ga0207645_101068011 | 282 |
| 230 | 3300025908 | Ga0207643_10004606 | Ga0207643_100046064 | 282 |
| 231 | 3300025918 | Ga0207662_10074476 | Ga0207662_100744761 | 282 |
| 232 | 3300025923 | Ga0207681_10071500 | Ga0207681_100715002 | 282 |
| 233 | 3300025926 | Ga0207659_10022721 | Ga0207659_100227213 | 282 |
| 234 | 3300025928 | Ga0207700_10321178 | Ga0207700_103211782 | 282 |
| 235 | 3300025933 | Ga0207706_10211184 | Ga0207706_102111842 | 282 |
| 236 | 3300025937 | Ga0207669_10012221 | Ga0207669_100122213 | 282 |
| 237 | 3300025938 | Ga0207704_10043910 | Ga0207704_100439102 | 282 |
| 238 | 3300025942 | Ga0207689_10014256 | Ga0207689_100142562 | 282 |
| 239 | 3300026067 | Ga0207678_10124099 | Ga0207678_101240992 | 282 |
| 240 | 3300026075 | Ga0207708_10113239 | Ga0207708_101132392 | 282 |
| 241 | 3300026118 | Ga0207675_100055874 | Ga0207675_1000558741 | 282 |
| 242 | 3300026118 | Ga0207675_100233292 | Ga0207675_1002332922 | 282 |
| 243 | 3300026118 | Ga0207675_100242339 | Ga0207675_1002423392 | 282 |
| 244 | 3300028379 | Ga0268266_10100446 | Ga0268266_101004462 | 282 |
| 245 | 3300031456 | Ga0307513_10069165 | Ga0307513_100691652 | 282 |
| 246 | 3300041453 | Ga0451797_0015765 | Ga0451797_0015765_550_1416 | 282 |
| 247 | 3300044673 | Ga0453683_0103765 | Ga0453683_0103765_578_1450 | 282 |
| 248 | 3300046460 | Ga0495638_0065900 | Ga0495638_0065900_891_1757 | 282 |
| 249 | 3300046616 | Ga0495668_0042031 | Ga0495668_0042031_242_1108 | 282 |
| 250 | 3300050511 | nmdc:mga08y16_83597_c1 | nmdc:mga08y16_83597_c1_867_1733 | 282 |
| 251 | 3300053156 | Ga0500622_0087723 | Ga0500622_0087723_204_1094 | 282 |
| 252 | 3300049572 | Ga0501036_0056440 | Ga0501036_0056440_1843_2697 | 283 |
| 253 | 3300049578 | Ga0501042_0225017 | Ga0501042_0225017_314_1168 | 283 |
| 254 | 3300049582 | Ga0501048_0095283 | Ga0501048_0095283_1024_1878 | 283 |
| 255 | 3300049587 | Ga0501071_0062206 | Ga0501071_0062206_1733_2587 | 283 |
| 256 | 3300049588 | Ga0501072_0056821 | Ga0501072_0056821_24_878 | 283 |
| 257 | 3300049590 | Ga0501074_0108587 | Ga0501074_0108587_37_891 | 283 |
| 258 | 3300049592 | Ga0501076_0030556 | Ga0501076_0030556_184_1038 | 283 |
| 259 | 3300049824 | Ga0501045_0023386 | Ga0501045_0023386_1716_2570 | 283 |
| 260 | 3300054114 | Ga0501084_0026462 | Ga0501084_0026462_3181_4035 | 283 |
| 261 | 3300060353 | Ga0501082_0185899 | Ga0501082_0185899_204_1058 | 283 |
| 262 | 3300059424 | Ga0590075_007444 | Ga0590075_007444_677_1531 | 284 |
| 263 | 3300005290 | Ga0065712_10032295 | Ga0065712_100322951 | 286 |
| 264 | 3300005293 | Ga0065715_10285083 | Ga0065715_102850832 | 286 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ngf-assembly1.cif.gz_A | crystal structure of ap endonuclease, family 2 from brucella melitensis | 0.8709 | 38 | 282 |
| 1k77-assembly1.cif.gz_A | crystal structure of ec1530, a putative oxygenase from escherichia coli | 0.8543 | 38 | 279 |
| 3kws-assembly1.cif.gz_B | crystal structure of putative sugar isomerase (yp_001305149.1) from parabacteroides distasonis atcc 8503 at 1.68 a resolution | 0.8415 | 38 | 283 |
| 3ngf-assembly1.cif.gz_A | crystal structure of ap endonuclease, family 2 from brucella melitensis | 0.8271 | 38 | 282 |
| 6wn6-assembly1.cif.gz_A | crystal structure of 3-keto-d-glucoside 4-epimerase, ycjr, from e. coli, apo form | 0.8195 | 38 | 284 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q7T3H9_4_269_3.20.20.150 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.876 | 38 | 282 | 3.20.20.150 |
| af_P30147_1_258_3.20.20.150 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.8598 | 38 | 277 | 3.20.20.150 |
| 1k77A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.8543 | 40 | 279 | 3.20.20.150 |
| af_P36951_1_261_3.20.20.150 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.8542 | 38 | 283 | 3.20.20.150 |
| af_P76044_1_262_3.20.20.150 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.8325 | 38 | 284 | 3.20.20.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A520W8Q5-F1-model_v4 | Hydroxypyruvate isomerase | 0.9848 | 38 | 286 |
GO:0016853
|
| AF-A0A520HS35-F1-model_v4 | Hydroxypyruvate isomerase | 0.9825 | 38 | 286 |
GO:0016853
|
| AF-A0A2V7GEV8-F1-model_v4 | Xylose isomerase-like TIM barrel domain-containing protein | 0.9816 | 95 | 286 |
GO:0016853
|
| AF-A0A2V9FSA9-F1-model_v4 | Hydroxypyruvate isomerase | 0.9812 | 36 | 286 |
GO:0016853
|
| AF-A0A6L8JFB5-F1-model_v4 | deleted | 0.9811 | 63 | 286 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar