F372892

General Info

Members Datasets Scaffolds Average Seq Length
264 196 528 366

Family's Representative Sequence

Representative Sequence 3300049576|Ga0501040_0001571|Ga0501040_0001571_6486_7754
Length 422
Sequence MDLIGSCGIYSLIKGRCNHYIVFISHEEICDSFKLSVYGGKEMNEKHEPVKLENESNLDVGRRNFLKLTGAAVAALGLMSVANMPFAVAQDMSHGANNFYVSDKVTMRKVTFKNQYQMNVAGNLFMPDSVNPNTKSPAIIVGHPMGAVKEQSANLYATKMAEQGFVAMSIDLPFWGESDGQPRNAVSPDIYAEAFSAGVDFLGTQPFVDRNRIGAIGICGSGSFVISAAKIDPRMKAIATVSMHDMGAANRNGLRHSQTVEERKQIIAAAAEQRDVEFTGGETKYTSGTVHASSTPIEREFYDFYRTPRGEYTPKGQSPQLTTHPTLTSNVKFMNFYPLTDIETISPRPMLFITGDSAHSCEFSEDAYRLAAEPKELHIVPGAGHVDLYDRVNLIPFDKLVSFFSRHLAQVRVARPDLVPAR

Samples

Sample ID Description Type Environment
1 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
7 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
8 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
9 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
20 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
22 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
24 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
25 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
27 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
28 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
29 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
30 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
31 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
32 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
33 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
34 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
35 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
36 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
37 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
38 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
40 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
55 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
57 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
58 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
59 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
60 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
61 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
62 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
63 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
64 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
65 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
66 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
67 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
68 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
69 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
70 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
71 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
72 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
73 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
74 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
75 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
76 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
77 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
78 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
79 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
80 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
81 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
82 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
83 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
84 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
85 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
86 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
87 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
88 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
89 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
90 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
91 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
92 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
93 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
94 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
95 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
96 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
97 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
98 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
99 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
100 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
101 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
102 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
103 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
104 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
105 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
106 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
107 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
108 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
109 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
110 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
111 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
112 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
113 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
114 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
115 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
116 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
117 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
118 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
119 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
120 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
121 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
122 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
123 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
124 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
125 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
126 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
127 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
128 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
129 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
130 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
134 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
135 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
136 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
137 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
138 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
139 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
140 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
141 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
142 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
143 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
144 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
145 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
146 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
147 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
148 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
149 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
150 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
151 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
152 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
153 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
154 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
155 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
156 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
157 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
158 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
159 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
160 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
161 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
162 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
163 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
164 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
165 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
166 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
167 2643221570 Acidovorax sp. Root568 Isolate Unclassified
168 2643221584 Caulobacter sp. Root656 Isolate Unclassified
169 2643221609 Acidovorax sp. Root217 Isolate Unclassified
170 2643221611 Acidovorax sp. Root219 Isolate Unclassified
171 2643221652 Acidovorax sp. Root402 Isolate Unclassified
172 2643221668 Ensifer sp. Root423 Isolate Unclassified
173 2643221683 Variovorax sp. Root473 Isolate Unclassified
174 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
175 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
176 2738541293 Rhizobium sp. GV031 Isolate Unclassified
177 2738543019 Variovorax sp. GV040 Isolate Unclassified
178 2773857925 Microvirga vignae BR3299 Isolate Unclassified
179 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
180 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
181 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
182 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
183 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
184 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
185 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
186 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
187 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
188 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
189 2904424332 Duganella sp. 1411 Isolate Rhizosphere
190 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
191 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
192 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
193 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
194 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
195 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
196 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 85.98
Metatranscriptomes 0
Isolates 14.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.26
Nodule 4.55
Rhizoplane 2.27
Rhizosphere 61.74
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501040_0001571 3300049576 Bacteria 14537
2 JGI24739J22299_10015358 3300001989 Bacteria 2780
3 JGI24739J22299_10022050 3300001989 Bacteria 2262
4 JGI24737J22298_10008752 3300001990 Bacteria 3379
5 JGI24738J21930_10011987 3300002075 Bacteria 1898
6 JGI25406J46586_10005359 3300003203 Bacteria 5951
7 Ga0055537_1000010 3300003773 Bacteria 138059
8 Ga0055534_1000015 3300003784 Bacteria 148531
9 Ga0055528_1000311 3300003790 Bacteria 41165
10 Ga0055540_1000003 3300003792 Bacteria 428375
11 Ga0055540_1004838 3300003792 Bacteria 5911
12 Ga0065714_10003452 3300005288 Bacteria 7205
13 Ga0070666_10003035 3300005335 Bacteria 10189
14 Ga0070660_100021185 3300005339 Bacteria 4790
15 Ga0070661_100015412 3300005344 Bacteria 5395
16 Ga0070659_100009795 3300005366 Bacteria 7042
17 Ga0070659_100045977 3300005366 Bacteria 3421
18 Ga0070667_100255772 3300005367 Bacteria 1567
19 Ga0070662_100008354 3300005457 Bacteria 6747
20 Ga0070662_100129709 3300005457 Bacteria 1942
21 Ga0070665_100196210 3300005548 Bacteria 2020
22 Ga0068857_100340949 3300005577 Bacteria 1386
23 Ga0068862_100085258 3300005844 Bacteria 2745
24 Ga0081455_10006294 3300005937 Bacteria 12763
25 Ga0081455_10068465 3300005937 Bacteria 2954
26 Ga0081540_1045470 3300005983 Bacteria 2229
27 Ga0081539_10000665 3300005985 Bacteria 68920
28 Ga0075370_10003509 3300006353 Bacteria 7475
29 Ga0075370_10105100 3300006353 Bacteria 1637
30 Ga0099826_10001107 3300006948 Bacteria 15391
31 Ga0099826_10071134 3300006948 Bacteria 2208
32 Ga0111539_10042032 3300009094 Bacteria 5492
33 Ga0157371_10000092 3300013102 Bacteria 141282
34 Ga0157371_10023660 3300013102 Bacteria 4492
35 Ga0157370_10079318 3300013104 Bacteria 3092
36 Ga0157369_10040595 3300013105 Bacteria 5079
37 Ga0182008_10001692 3300014497 Bacteria 14492
38 Ga0182006_1000014 3300015261 Bacteria 340159
39 Ga0182006_1000832 3300015261 Bacteria 20700
40 Ga0182007_10000096 3300015262 Bacteria 62363
41 Ga0182005_1000014 3300015265 Bacteria 389763
42 Ga0163161_10000162 3300017792 Bacteria 61742
43 Ga0163161_10007281 3300017792 Bacteria 7637
44 Ga0163161_10009459 3300017792 Bacteria 6747
45 Ga0163161_10015588 3300017792 Bacteria 5301
46 Ga0163161_10028560 3300017792 Bacteria 3962
47 Ga0209565_1000025 3300025263 Bacteria 377969
48 Ga0209673_1000149 3300025273 Bacteria 148659
49 Ga0209130_1009990 3300025284 Bacteria 2650
50 Ga0209675_1000017 3300025291 Bacteria 378002
51 Ga0209676_1002163 3300025292 Bacteria 14848
52 Ga0209025_1030318 3300025294 Bacteria 2592
53 Ga0209050_1008507 3300025298 Bacteria 5464
54 Ga0209051_1000011 3300025303 Bacteria 610828
55 Ga0209051_1000413 3300025303 Bacteria 59027
56 Ga0207680_10023980 3300025903 Bacteria 3340
57 Ga0207647_10017887 3300025904 Bacteria 4810
58 Ga0207647_10128694 3300025904 Bacteria 1489
59 Ga0207705_10118153 3300025909 Bacteria 1965
60 Ga0207657_10027172 3300025919 Bacteria 5245
61 Ga0207649_10140243 3300025920 Bacteria 1653
62 Ga0207650_10039507 3300025925 Bacteria 3448
63 Ga0207690_10006181 3300025932 Bacteria 7091
64 Ga0207706_10028235 3300025933 Bacteria 5012
65 Ga0207706_10056181 3300025933 Bacteria 3471
66 Ga0207706_10083657 3300025933 Bacteria 2805
67 Ga0207679_10054196 3300025945 Bacteria 2951
68 Ga0207658_10071732 3300025986 Bacteria 2623
69 Ga0207708_10050273 3300026075 Bacteria 3174
70 Ga0207674_10020707 3300026116 Bacteria 7098
71 Ga0209282_1013767 3300027666 Bacteria 5150
72 Ga0209282_1057319 3300027666 Bacteria 2191
73 Ga0209974_10000504 3300027876 Bacteria 13015
74 Ga0307515_10000420 3300028794 Bacteria 102216
75 Ga0307515_10021957 3300028794 Bacteria 11282
76 Ga0307513_10023364 3300031456 Bacteria 7223
77 Ga0307509_10105877 3300031507 Bacteria 2833
78 Ga0307516_10000227 3300031730 Bacteria 72508
79 Ga0307516_10008319 3300031730 Bacteria 11759
80 Ga0307406_10133262 3300031901 Bacteria 1747
81 Ga0307407_10261716 3300031903 Bacteria 1190
82 Ga0307412_10083834 3300031911 Bacteria 2211
83 Ga0307409_100045702 3300031995 Bacteria 3308
84 Ga0307414_10392813 3300032004 Bacteria 1202
85 Ga0307411_10092558 3300032005 Bacteria 2115
86 Ga0373939_0000058 3300035114 Bacteria 39198
87 Ga0373960_0002559 3300035121 Bacteria 4103
88 Ga0373931_0009424 3300035691 Bacteria 4670
89 Ga0395905_0080800 3300037471 Bacteria 3047
90 Ga0395905_0569262 3300037471 Bacteria 1034
91 Ga0439447_017775 3300041407 Bacteria 1932
92 Ga0439442_004748 3300042002 Bacteria 2703
93 Ga0439432_001588 3300042006 Bacteria 8502
94 Ga0450911_000102 3300042115 Bacteria 34778
95 Ga0450911_011128 3300042115 Bacteria 1235
96 Ga0439446_0026987 3300042156 Bacteria 1648
97 Ga0451576_0004280 3300045051 Bacteria 18694
98 Ga0495617_004350 3300046452 Bacteria 5163
99 Ga0495617_006835 3300046452 Bacteria 3985
100 Ga0495627_003953 3300046453 Bacteria 6332
101 Ga0495591_008068 3300046458 Bacteria 4361
102 Ga0495638_0001927 3300046460 Bacteria 17854
103 Ga0495605_0001897 3300046474 Bacteria 13344
104 Ga0495584_0011298 3300046491 Bacteria 4573
105 Ga0495585_0000001 3300046492 Bacteria 609804
106 Ga0495585_0007824 3300046492 Bacteria 6503
107 Ga0495607_0006967 3300046501 Bacteria 7873
108 Ga0495607_0027589 3300046501 Bacteria 3508
109 Ga0495607_0056813 3300046501 Bacteria 2245
110 Ga0495607_0190615 3300046501 Bacteria 1021
111 Ga0495583_0000035 3300046506 Bacteria 246849
112 Ga0495583_0012713 3300046506 Bacteria 4742
113 Ga0495606_0000062 3300046507 Bacteria 184841
114 Ga0495606_0010957 3300046507 Bacteria 7452
115 Ga0495606_0062709 3300046507 Eukaryota 2372
116 Ga0495610_0000181 3300046512 Bacteria 70215
117 Ga0495610_0003999 3300046512 Bacteria 11126
118 Ga0495616_0010532 3300046513 Bacteria 5349
119 Ga0495620_0015614 3300046515 Eukaryota 3829
120 Ga0495620_0048124 3300046515 Bacteria 1832
121 Ga0495631_0000115 3300046518 Bacteria 53939
122 Ga0495632_0018554 3300046519 Bacteria 3816
123 Ga0495637_0007638 3300046520 Bacteria 5349
124 Ga0495637_0027487 3300046520 Bacteria 2544
125 Ga0495644_0000352 3300046523 Bacteria 20839
126 Ga0495648_0000400 3300046524 Bacteria 47684
127 Ga0495648_0000625 3300046524 Bacteria 37878
128 Ga0495648_0010166 3300046524 Bacteria 7196
129 Ga0495654_0005553 3300046530 Bacteria 7308
130 Ga0495609_0004081 3300046538 Bacteria 8133
131 Ga0495609_0005143 3300046538 Bacteria 6967
132 Ga0495609_0007892 3300046538 Bacteria 5260
133 Ga0495633_0001449 3300046558 Bacteria 18433
134 Ga0495633_0003086 3300046558 Bacteria 11325
135 Ga0495633_0010579 3300046558 Bacteria 5027
136 Ga0495633_0012816 3300046558 Bacteria 4442
137 Ga0495656_0000686 3300046615 Bacteria 10912
138 Ga0495668_0002945 3300046616 Bacteria 13432
139 Ga0495668_0028983 3300046616 Bacteria 3128
140 Ga0495668_0095063 3300046616 Bacteria 1631
141 Ga0495611_0002413 3300046648 Bacteria 8568
142 Ga0495625_0003251 3300046660 Bacteria 16439
143 Ga0495625_0005161 3300046660 Bacteria 12051
144 Ga0495659_0000793 3300046664 Bacteria 11330
145 Ga0495661_0000424 3300046665 Bacteria 44598
146 Ga0495661_0017410 3300046665 Bacteria 4748
147 Ga0495588_0003534 3300046674 Bacteria 6820
148 Ga0495670_0004125 3300046691 Bacteria 7122
149 Ga0495649_0000324 3300046694 Bacteria 41534
150 Ga0495649_0000701 3300046694 Bacteria 27333
151 Ga0495589_0007443 3300046794 Bacteria 5736
152 Ga0495660_0001144 3300046810 Bacteria 18852
153 Ga0495636_0000433 3300047318 Bacteria 15533
154 Ga0495683_0000973 3300047323 Bacteria 20021
155 Ga0495687_001891 3300047443 Bacteria 18036
156 Ga0495677_0010386 3300047445 Bacteria 3420
157 Ga0495685_000302 3300047447 Bacteria 16149
158 Ga0495673_0000258 3300047469 Bacteria 73887
159 Ga0495681_0009591 3300047470 Bacteria 5946
160 Ga0495681_0025498 3300047470 Bacteria 3092
161 Ga0495686_0013917 3300047472 Bacteria 5565
162 Ga0496103_0010164 3300048906 Bacteria 5564
163 Ga0496106_0000038 3300048909 Bacteria 111983
164 Ga0496106_0116344 3300048909 Bacteria 2085
165 Ga0496111_0009124 3300048914 Bacteria 6602
166 Ga0496114_0045021 3300048917 Bacteria 3664
167 Ga0496116_0008786 3300048919 Bacteria 8715
168 Ga0496116_0044470 3300048919 Bacteria 3016
169 Ga0496117_0000001 3300048920 Bacteria 2526244
170 Ga0496117_0000437 3300048920 Bacteria 69398
171 Ga0496117_0048026 3300048920 Bacteria 3054
172 Ga0496118_0000008 3300048921 Bacteria 644537
173 Ga0496118_0000048 3300048921 Bacteria 253404
174 Ga0496118_0000430 3300048921 Bacteria 69608
175 Ga0496121_0000439 3300048924 Bacteria 82273
176 Ga0496121_0001199 3300048924 Bacteria 45399
177 Ga0496121_0002036 3300048924 Bacteria 31985
178 Ga0496122_0011568 3300048925 Bacteria 8911
179 Ga0496123_0003551 3300048926 Bacteria 17303
180 Ga0496123_0035245 3300048926 Bacteria 3569
181 Ga0496124_0003629 3300048927 Bacteria 18738
182 Ga0496124_0012943 3300048927 Bacteria 8182
183 Ga0496124_0116059 3300048927 Bacteria 2147
184 Ga0496124_0205343 3300048927 Bacteria 1495
185 Ga0496125_0013494 3300048928 Bacteria 8025
186 Ga0496125_0021222 3300048928 Bacteria 6066
187 Ga0496125_0283143 3300048928 Bacteria 1025
188 Ga0496126_0002493 3300048929 Bacteria 24761
189 Ga0496126_0016568 3300048929 Bacteria 7366
190 Ga0495678_001021 3300049459 Bacteria 23817
191 Ga0501033_0067839 3300049570 Bacteria 2623
192 Ga0501042_0000330 3300049578 Bacteria 23668
193 Ga0501048_0018029 3300049582 Bacteria 5195
194 Ga0501068_0067406 3300049584 Bacteria 2181
195 Ga0501070_0085125 3300049586 Bacteria 2617
196 Ga0501072_0005086 3300049588 Bacteria 10012
197 Ga0501073_0187023 3300049589 Bacteria 1433
198 Ga0501075_0021192 3300049591 Bacteria 4735
199 Ga0501077_0009127 3300049593 Bacteria 6156
200 Ga0501223_004199 3300049663 Bacteria 3105
201 Ga0501219_000601 3300049703 Bacteria 5231
202 Ga0501079_0016318 3300049741 Bacteria 5675
203 Ga0501080_0011749 3300049742 Bacteria 8025
204 Ga0501080_0049983 3300049742 Bacteria 3892
205 Ga0501081_0009460 3300049743 Bacteria 6352
206 Ga0501044_0443822 3300049823 Bacteria 1205
207 Ga0501284_00106 3300050005 Bacteria 17002
208 nmdc:mga03n38_36398_c1 3300050490 Bacteria 2116
209 nmdc:mga07m45_109081_c1 3300050496 Bacteria 1593
210 nmdc:mga07m45_5227_c2 3300050496 Bacteria 3528
211 nmdc:mga07m45_6875_c1 3300050496 Bacteria 5786
212 Ga0500560_005913 3300053107 Bacteria 2750
213 Ga0500618_001428 3300053125 Bacteria 10657
214 Ga0500618_026965 3300053125 Bacteria 1369
215 Ga0500652_006207 3300053131 Bacteria 3830
216 Ga0500658_0002057 3300053134 Bacteria 7836
217 Ga0500568_0003902 3300053139 Bacteria 8117
218 Ga0500616_0000390 3300053153 Bacteria 61067
219 Ga0500622_0005232 3300053156 Bacteria 7841
220 Ga0500633_0036079 3300053160 Bacteria 1632
221 Ga0500634_0004259 3300053161 Bacteria 6581
222 Ga0500634_0023202 3300053161 Bacteria 3371
223 Ga0500634_0034182 3300053161 Bacteria 2769
224 Ga0500636_0032100 3300053177 Bacteria 3107
225 Ga0500645_000069 3300053730 Bacteria 80827
226 Ga0500645_001145 3300053730 Bacteria 14366
227 Ga0530510_0007244 3300061734 Bacteria 7716
228 2509144222 2508501127 Bacteria 7037543
229 2511124633 2510917020 Bacteria 5657507
230 2530644257 2529292951 Bacteria 6916614
231 2585148311 2582581279 Bacteria 4980720
232 2585169885 2582581283 Bacteria 6030556
233 2585902532 2585427608 Bacteria 6544331
234 2643782329 2643221552 Bacteria 5708754
235 2643865564 2643221570 Bacteria 5103772
236 2643929247 2643221584 Bacteria 5511711
237 2644059062 2643221609 Bacteria 6756331
238 2644071285 2643221611 Bacteria 6820941
239 2644296265 2643221652 Bacteria 5140275
240 2644379179 2643221668 Bacteria 7306521
241 2644467177 2643221683 Bacteria 5749203
242 2644501506 2643221689 Bacteria 6042950
243 2671117205 2667528174 Bacteria 6435400
244 2738804409 2738541293 Bacteria 7065685
245 2739280396 2738543019 Bacteria 7459457
246 2774872653 2773857925 Bacteria 6472445
247 2819682511 2818991461 Bacteria 7026071
248 2838742300 2838736955 Bacteria 5760694
249 2841846156 2841840854 Bacteria 5761912
250 2842145860 2842140634 Bacteria 5759631
251 2842170380 2842163707 Bacteria 6916235
252 2842782331 2842780639 Bacteria 4337790
253 2856345264 2856342000 Bacteria 7176905
254 2857536359 2857531043 Bacteria 6754041
255 2874221768 2874220319 Bacteria 4594709
256 2898331529 2898329390 Bacteria 5168154
257 2904429361 2904424332 Bacteria 7633521
258 2919465528 2919462493 Bacteria 5817112
259 2928497242 2928496128 Bacteria 4631123
260 2937612620 2937610967 Bacteria 4618818
261 2946021535 2946019816 Bacteria 4621265
262 2961048535 2961047084 Bacteria 4594415
263 2998142419 2998139840 Bacteria 6073514
264 8055617769 8055617313 Bacteria 7548464
265 Ga0501040_0001571
266 JGI24739J22299_10015358
267 JGI24739J22299_10022050
268 JGI24737J22298_10008752
269 JGI24738J21930_10011987
270 JGI25406J46586_10005359
271 Ga0055537_1000010
272 Ga0055534_1000015
273 Ga0055528_1000311
274 Ga0055540_1000003
275 Ga0055540_1004838
276 Ga0065714_10003452
277 Ga0070666_10003035
278 Ga0070660_100021185
279 Ga0070661_100015412
280 Ga0070659_100009795
281 Ga0070659_100045977
282 Ga0070667_100255772
283 Ga0070662_100008354
284 Ga0070662_100129709
285 Ga0070665_100196210
286 Ga0068857_100340949
287 Ga0068862_100085258
288 Ga0081455_10006294
289 Ga0081455_10068465
290 Ga0081540_1045470
291 Ga0081539_10000665
292 Ga0075370_10003509
293 Ga0075370_10105100
294 Ga0099826_10001107
295 Ga0099826_10071134
296 Ga0111539_10042032
297 Ga0157371_10000092
298 Ga0157371_10023660
299 Ga0157370_10079318
300 Ga0157369_10040595
301 Ga0182008_10001692
302 Ga0182006_1000014
303 Ga0182006_1000832
304 Ga0182007_10000096
305 Ga0182005_1000014
306 Ga0163161_10000162
307 Ga0163161_10007281
308 Ga0163161_10009459
309 Ga0163161_10015588
310 Ga0163161_10028560
311 Ga0209565_1000025
312 Ga0209673_1000149
313 Ga0209130_1009990
314 Ga0209675_1000017
315 Ga0209676_1002163
316 Ga0209025_1030318
317 Ga0209050_1008507
318 Ga0209051_1000011
319 Ga0209051_1000413
320 Ga0207680_10023980
321 Ga0207647_10017887
322 Ga0207647_10128694
323 Ga0207705_10118153
324 Ga0207657_10027172
325 Ga0207649_10140243
326 Ga0207650_10039507
327 Ga0207690_10006181
328 Ga0207706_10028235
329 Ga0207706_10056181
330 Ga0207706_10083657
331 Ga0207679_10054196
332 Ga0207658_10071732
333 Ga0207708_10050273
334 Ga0207674_10020707
335 Ga0209282_1013767
336 Ga0209282_1057319
337 Ga0209974_10000504
338 Ga0307515_10000420
339 Ga0307515_10021957
340 Ga0307513_10023364
341 Ga0307509_10105877
342 Ga0307516_10000227
343 Ga0307516_10008319
344 Ga0307406_10133262
345 Ga0307407_10261716
346 Ga0307412_10083834
347 Ga0307409_100045702
348 Ga0307414_10392813
349 Ga0307411_10092558
350 Ga0373939_0000058
351 Ga0373960_0002559
352 Ga0373931_0009424
353 Ga0395905_0080800
354 Ga0395905_0569262
355 Ga0439447_017775
356 Ga0439442_004748
357 Ga0439432_001588
358 Ga0450911_000102
359 Ga0450911_011128
360 Ga0439446_0026987
361 Ga0451576_0004280
362 Ga0495617_004350
363 Ga0495617_006835
364 Ga0495627_003953
365 Ga0495591_008068
366 Ga0495638_0001927
367 Ga0495605_0001897
368 Ga0495584_0011298
369 Ga0495585_0000001
370 Ga0495585_0007824
371 Ga0495607_0006967
372 Ga0495607_0027589
373 Ga0495607_0056813
374 Ga0495607_0190615
375 Ga0495583_0000035
376 Ga0495583_0012713
377 Ga0495606_0000062
378 Ga0495606_0010957
379 Ga0495606_0062709
380 Ga0495610_0000181
381 Ga0495610_0003999
382 Ga0495616_0010532
383 Ga0495620_0015614
384 Ga0495620_0048124
385 Ga0495631_0000115
386 Ga0495632_0018554
387 Ga0495637_0007638
388 Ga0495637_0027487
389 Ga0495644_0000352
390 Ga0495648_0000400
391 Ga0495648_0000625
392 Ga0495648_0010166
393 Ga0495654_0005553
394 Ga0495609_0004081
395 Ga0495609_0005143
396 Ga0495609_0007892
397 Ga0495633_0001449
398 Ga0495633_0003086
399 Ga0495633_0010579
400 Ga0495633_0012816
401 Ga0495656_0000686
402 Ga0495668_0002945
403 Ga0495668_0028983
404 Ga0495668_0095063
405 Ga0495611_0002413
406 Ga0495625_0003251
407 Ga0495625_0005161
408 Ga0495659_0000793
409 Ga0495661_0000424
410 Ga0495661_0017410
411 Ga0495588_0003534
412 Ga0495670_0004125
413 Ga0495649_0000324
414 Ga0495649_0000701
415 Ga0495589_0007443
416 Ga0495660_0001144
417 Ga0495636_0000433
418 Ga0495683_0000973
419 Ga0495687_001891
420 Ga0495677_0010386
421 Ga0495685_000302
422 Ga0495673_0000258
423 Ga0495681_0009591
424 Ga0495681_0025498
425 Ga0495686_0013917
426 Ga0496103_0010164
427 Ga0496106_0000038
428 Ga0496106_0116344
429 Ga0496111_0009124
430 Ga0496114_0045021
431 Ga0496116_0008786
432 Ga0496116_0044470
433 Ga0496117_0000001
434 Ga0496117_0000437
435 Ga0496117_0048026
436 Ga0496118_0000008
437 Ga0496118_0000048
438 Ga0496118_0000430
439 Ga0496121_0000439
440 Ga0496121_0001199
441 Ga0496121_0002036
442 Ga0496122_0011568
443 Ga0496123_0003551
444 Ga0496123_0035245
445 Ga0496124_0003629
446 Ga0496124_0012943
447 Ga0496124_0116059
448 Ga0496124_0205343
449 Ga0496125_0013494
450 Ga0496125_0021222
451 Ga0496125_0283143
452 Ga0496126_0002493
453 Ga0496126_0016568
454 Ga0495678_001021
455 Ga0501033_0067839
456 Ga0501042_0000330
457 Ga0501048_0018029
458 Ga0501068_0067406
459 Ga0501070_0085125
460 Ga0501072_0005086
461 Ga0501073_0187023
462 Ga0501075_0021192
463 Ga0501077_0009127
464 Ga0501223_004199
465 Ga0501219_000601
466 Ga0501079_0016318
467 Ga0501080_0011749
468 Ga0501080_0049983
469 Ga0501081_0009460
470 Ga0501044_0443822
471 Ga0501284_00106
472 nmdc:mga03n38_36398_c1
473 nmdc:mga07m45_109081_c1
474 nmdc:mga07m45_5227_c2
475 nmdc:mga07m45_6875_c1
476 Ga0500560_005913
477 Ga0500618_001428
478 Ga0500618_026965
479 Ga0500652_006207
480 Ga0500658_0002057
481 Ga0500568_0003902
482 Ga0500616_0000390
483 Ga0500622_0005232
484 Ga0500633_0036079
485 Ga0500634_0004259
486 Ga0500634_0023202
487 Ga0500634_0034182
488 Ga0500636_0032100
489 Ga0500645_000069
490 Ga0500645_001145
491 Ga0530510_0007244
492 2509144222
493 2511124633
494 2530644257
495 2585148311
496 2585169885
497 2585902532
498 2643782329
499 2643865564
500 2643929247
501 2644059062
502 2644071285
503 2644296265
504 2644379179
505 2644467177
506 2644501506
507 2671117205
508 2738804409
509 2739280396
510 2774872653
511 2819682511
512 2838742300
513 2841846156
514 2842145860
515 2842170380
516 2842782331
517 2856345264
518 2857536359
519 2874221768
520 2898331529
521 2904429361
522 2919465528
523 2928497242
524 2937612620
525 2946021535
526 2961048535
527 2998142419
528 8055617769

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06500

FrsA-like

Esterase FrsA-like

70

256

0.81

PF01738

DLH

Dienelactone hydrolase family

120

312

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xb6-assembly1.cif.gz_B crystal structure of ycjy from e. coli 0.8704 57 353
2hdw-assembly1.cif.gz_A crystal structure of hypothetical protein pa2218 from pseudomonas aeruginosa 0.8591 38 353
2hdw-assembly1.cif.gz_A crystal structure of hypothetical protein pa2218 from pseudomonas aeruginosa 0.844 38 353
5xb6-assembly1.cif.gz_B crystal structure of ycjy from e. coli 0.8436 57 353
7qjm-assembly2.cif.gz_B crystal structure of an alpha/beta-hydrolase enzyme from chloroflexus sp. ms-g (202) 0.8309 57 351
ID Description Score Start End Superfamily
2hdwB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9579 49 353 3.40.50.1820
2hdwB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9124 49 353 3.40.50.1820
af_A0A1D6K8I4_16_172_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8678 58 193 3.40.50.1820
af_Q4DL65_1_217_2.115.10.20 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.849 55 78 2.115.10.20
af_Q9UT29_165_337_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8091 72 195 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A0M3C2I5-F1-model_v4 deleted 0.9745 49 186
AF-K1SX25-F1-model_v4 Alpha/beta superfamily hydrolase 0.9608 49 174 GO:0016787
AF-W1HPK3-F1-model_v4 deleted 0.9572 60 176
AF-A0A353KRF9-F1-model_v4 Alpha/beta hydrolase 0.9563 49 171 GO:0016787
AF-A0A7K2M7E6-F1-model_v4 Prolyl oligopeptidase family serine peptidase 0.9558 56 193

Map