F372801

General Info

Members Datasets Scaffolds Average Seq Length
264 172 236 215

Family's Representative Sequence

Representative Sequence 3300046453|Ga0495627_008729|Ga0495627_008729_1777_2505
Length 242
Sequence LADDKTILTFPSSFLDATFVSLKIKKMAVQKLKNVAGITIPDSKIATEATELLLEHGTEFIYNHSLRVFLFSSLNGKRQNMKYDEELLYVSSVFHDLGLVPHYSSPDLRFEVDGANAARDFLKSHGISNDKLQLVWDTIALHTTIGIAEHKENEVALMYSGVGLDVMGEGYEHLSEDNRNEIIKAFPRNDFKKNIIPTFFEGFKHKTETTFGNIKADVCAFMIPNFERKNFCNCILHSPWSE

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
3 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
4 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
5 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
6 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
7 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
8 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
9 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
10 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
11 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
12 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
13 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
14 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
15 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
16 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
17 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
18 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
19 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
20 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
21 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
22 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
23 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
24 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
25 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
26 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
27 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
28 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
29 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
30 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
31 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
32 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
33 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
34 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
35 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
36 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
37 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
38 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
39 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
40 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
41 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
42 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
43 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
44 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
45 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
46 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
47 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
48 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
49 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
50 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
51 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
52 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
53 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
54 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
55 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
56 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
80 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
85 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
87 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
99 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
100 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
101 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
102 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
103 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
104 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
107 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
108 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
109 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
110 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
111 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
112 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
113 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
114 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
115 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
116 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
117 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
118 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
119 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
120 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
121 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
122 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
123 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
124 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
125 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
126 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
127 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
128 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
129 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
130 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
131 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
132 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
133 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
134 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
135 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
136 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
137 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
138 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
139 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
140 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
141 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
142 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
143 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
144 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
145 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
146 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
147 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
148 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
149 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
150 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
151 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
152 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
153 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
154 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
155 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
156 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
157 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
158 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
161 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
162 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
163 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
164 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
165 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
166 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
167 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
168 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
169 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
170 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
171 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
172 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 88.26
Metatranscriptomes 0.38
Isolates 11.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.15
Nodule 0.38
Rhizoplane 1.52
Rhizosphere 65.53
Stem 0
Stem Tuber 0
Unclassified 17.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1013487 2162886007 Bacteria 49455
2 JGI24740J21852_10023398 3300001979 Bacteria 2111
3 JGI24737J22298_10005536 3300001990 Bacteria 4356
4 JGI24735J21928_10000001 3300002067 Bacteria 650042
5 JGI25162J39368_1000012 3300002737 Bacteria 373191
6 JGI25153J46596_10029006 3300003215 Bacteria 1907
7 JGI25153J46596_10031465 3300003215 Bacteria 1786
8 rootH1_10058628 3300003316 Bacteria 3742
9 rootH1_10058628 3300003323 Bacteria 18017
10 rootH2_10303886 3300003320 Bacteria 3061
11 rootL2_10003234 3300003322 Bacteria 5012
12 rootL2_10077778 3300003322 Bacteria 1297
13 rootL2_10109034 3300003322 Bacteria 3432
14 rootL2_10268332 3300003322 Bacteria 1986
15 rootH1_10055917 3300003316 Bacteria 2465
16 rootH1_10055917 3300003323 Bacteria 5337
17 rootH1_10078312 3300003323 Bacteria 15744
18 rootH1_10329708 3300003323 Bacteria 3350
19 JGI25160J50197_1000867 3300003354 Bacteria 16038
20 JGI25160J50197_1007189 3300003354 Bacteria 4386
21 Ga0055526_1016835 3300003771 Bacteria 2831
22 Ga0055536_1012978 3300003781 Bacteria 3042
23 Ga0055534_1023770 3300003784 Bacteria 1000
24 Ga0055528_1000122 3300003790 Bacteria 61910
25 Ga0055530_10000192 3300003791 Bacteria 54681
26 Ga0055531_10000102 3300003794 Bacteria 92703
27 Ga0055531_10062905 3300003794 Bacteria 895
28 Ga0055543_1011925 3300004625 Bacteria 1762
29 Ga0065165_1000066 3300005262 Bacteria 172490
30 Ga0065165_1003174 3300005262 Bacteria 12041
31 Ga0065714_10067106 3300005288 Bacteria 5881
32 Ga0065714_10068365 3300005288 Bacteria 4775
33 Ga0065714_10075329 3300005288 Unclassified 2914
34 Ga0065714_10075439 3300005288 Bacteria 2902
35 Ga0065704_10073131 3300005289 Bacteria 7552
36 Ga0070666_10042008 3300005335 Bacteria 3057
37 Ga0070682_100000245 3300005337 Bacteria 39270
38 Ga0068868_100427962 3300005338 Bacteria 1147
39 Ga0070660_100056018 3300005339 Bacteria 3049
40 Ga0070708_100018477 3300005445 Bacteria 5834
41 Ga0070698_100002069 3300005471 Bacteria 22295
42 Ga0070699_100007311 3300005518 Bacteria 9612
43 Ga0068853_100003792 3300005539 Bacteria 11582
44 Ga0068853_100369212 3300005539 Bacteria 1338
45 Ga0068855_100040541 3300005563 Bacteria 5527
46 Ga0068854_100660447 3300005578 Bacteria 899
47 Ga0070717_10025156 3300006028 Bacteria 4730
48 Ga0075366_10137840 3300006195 Bacteria 1474
49 Ga0105244_10000244 3300009036 Bacteria 55612
50 Ga0105240_10000059 3300009093 Bacteria 219860
51 Ga0105240_10000100 3300009093 Bacteria 176640
52 Ga0105240_10262633 3300009093 Bacteria 1991
53 Ga0105243_10000408 3300009148 Bacteria 45109
54 Ga0105243_10031291 3300009148 Bacteria 4102
55 Ga0105243_10055499 3300009148 Bacteria 3148
56 Ga0105241_10587531 3300009174 Bacteria 1004
57 Ga0105237_10008552 3300009545 Bacteria 11065
58 Ga0105237_10035395 3300009545 Bacteria 5053
59 Ga0105238_10145168 3300009551 Bacteria 2349
60 Ga0105239_10000117 3300010375 Bacteria 112291
61 Ga0105239_10074027 3300010375 Bacteria 3745
62 Ga0105239_10449104 3300010375 Bacteria 1462
63 Ga0105239_10831155 3300010375 Bacteria 1059
64 Ga0157373_10002593 3300013100 Bacteria 13729
65 Ga0157373_10057798 3300013100 Bacteria 2751
66 Ga0157373_10272111 3300013100 Bacteria 1199
67 Ga0157371_10456009 3300013102 Bacteria 940
68 Ga0157370_10000103 3300013104 Bacteria 97072
69 Ga0157370_10001172 3300013104 Bacteria 32684
70 Ga0157370_10001460 3300013104 Bacteria 29235
71 Ga0157370_10004370 3300013104 Bacteria 16227
72 Ga0157370_10038164 3300013104 Bacteria 4647
73 Ga0157370_10061465 3300013104 Bacteria 3565
74 Ga0157370_10089085 3300013104 Bacteria 2898
75 Ga0157370_10162238 3300013104 Bacteria 2079
76 Ga0157369_10038224 3300013105 Bacteria 5248
77 Ga0157369_10067260 3300013105 Plasmid 3853
78 Ga0163162_10015623 3300013306 Bacteria 7419
79 Ga0163162_10529847 3300013306 Unclassified 1307
80 Ga0157372_10170559 3300013307 Plasmid 2518
81 Ga0157375_10000218 3300013308 Bacteria 53847
82 Ga0157375_10066124 3300013308 Bacteria 3607
83 Ga0157375_10625933 3300013308 Bacteria 1234
84 Ga0163163_10041164 3300014325 Unclassified 4517
85 Ga0182006_1009666 3300015261 Bacteria 4315
86 Ga0163161_10001081 3300017792 Bacteria 20628
87 Ga0163161_10001325 3300017792 Bacteria 18423
88 Ga0163161_10098693 3300017792 Bacteria 2171
89 Ga0209437_100041 3300025233 Bacteria 444465
90 Ga0209673_1000049 3300025273 Bacteria 286207
91 Ga0209675_1000032 3300025291 Bacteria 273013
92 Ga0209675_1058263 3300025291 Bacteria 772
93 Ga0209676_1000579 3300025292 Bacteria 55137
94 Ga0209564_1007341 3300025295 Bacteria 5713
95 Ga0209758_1003047 3300025297 Bacteria 15952
96 Ga0209758_1006793 3300025297 Bacteria 8027
97 Ga0209758_1027268 3300025297 Bacteria 2445
98 Ga0209050_1000129 3300025298 Bacteria 186356
99 Ga0207426_1000782 3300025302 Bacteria 34779
100 Ga0207426_1001379 3300025302 Bacteria 20571
101 Ga0209051_1036275 3300025303 Bacteria 1823
102 Ga0209257_1000004 3300025304 Bacteria 1678347
103 Ga0209257_1001137 3300025304 Bacteria 34045
104 Ga0209257_1060412 3300025304 Bacteria 1031
105 Ga0207655_1000702 3300025728 Bacteria 38833
106 Ga0207680_10076486 3300025903 Bacteria 2090
107 Ga0207684_10572652 3300025910 Bacteria 965
108 Ga0207695_10000027 3300025913 Bacteria 612456
109 Ga0207695_10000039 3300025913 Bacteria 454801
110 Ga0207695_10777077 3300025913 Bacteria 838
111 Ga0207671_10004569 3300025914 Bacteria 13149
112 Ga0207671_10010114 3300025914 Bacteria 7818
113 Ga0207709_10000458 3300025935 Bacteria 37753
114 Ga0207667_10033642 3300025949 Bacteria 5510
115 Ga0207639_10019211 3300026041 Bacteria 4869
116 Ga0207674_10508288 3300026116 Bacteria 1164
117 Ga0265760_10144483 3300031090 Bacteria 776
118 Ga0265327_10000010 3300031251 Bacteria 566817
119 Ga0307513_10122427 3300031456 Bacteria 2565
120 Ga0307513_10409198 3300031456 Bacteria 1089
121 Ga0265314_10204820 3300031711 Bacteria 1163
122 Ga0307407_10000007 3300031903 Bacteria 210716
123 Ga0307412_10000029 3300031911 Bacteria 209074
124 Ga0307412_10431905 3300031911 Bacteria 1080
125 Ga0307409_100157523 3300031995 Bacteria 1981
126 Ga0307416_100000015 3300032002 Bacteria 210716
127 Ga0307414_10004023 3300032004 Bacteria 7936
128 Ga0307414_10008294 3300032004 Bacteria 5883
129 Ga0307414_10060925 3300032004 Unclassified 2671
130 Ga0307414_10253687 3300032004 Bacteria 1464
131 Ga0395900_0126747 3300037418 Bacteria 2619
132 Ga0395905_0141997 3300037471 Bacteria 2259
133 Ga0395905_0264645 3300037471 Unclassified 1605
134 Ga0439431_0020248 3300041997 Bacteria 1588
135 Ga0439445_0000563 3300042004 Bacteria 7572
136 Ga0466969_0040698 3300044656 Bacteria 2328
137 Ga0466969_0275470 3300044656 Unclassified 762
138 Ga0466972_0000002 3300044658 Bacteria 408005
139 Ga0466972_0000127 3300044658 Bacteria 63923
140 Ga0466982_0061445 3300044672 Bacteria 2313
141 Ga0466965_0733253 3300044683 Bacteria 569
142 Ga0466966_0019469 3300044684 Bacteria 4465
143 Ga0466961_0037724 3300044693 Bacteria 3100
144 Ga0466963_0229610 3300044694 Bacteria 1300
145 Ga0466971_0019169 3300044719 Bacteria 3037
146 Ga0466970_0000159 3300044765 Bacteria 32178
147 Ga0466970_0018412 3300044765 Unclassified 3614
148 Ga0466970_0062072 3300044765 Bacteria 2003
149 Ga0466957_0052482 3300044842 Bacteria 2483
150 Ga0466959_0115574 3300045049 Bacteria 1911
151 Ga0466958_0042369 3300045836 Plasmid 2741
152 Ga0466967_0086815 3300045976 Bacteria 2835
153 Ga0495627_008729 3300046453 Bacteria 3777
154 Ga0495638_0025508 3300046460 Bacteria 3841
155 Ga0495650_0000273 3300046471 Bacteria 98757
156 Ga0495650_0072384 3300046471 Bacteria 1349
157 Ga0495605_0033595 3300046474 Bacteria 2602
158 Ga0495596_0000771 3300046500 Bacteria 19541
159 Ga0495606_0000130 3300046507 Bacteria 127805
160 Ga0495606_0011386 3300046507 Bacteria 7259
161 Ga0495606_0012575 3300046507 Bacteria 6775
162 Ga0495606_0025032 3300046507 Bacteria 4284
163 Ga0495606_0030949 3300046507 Bacteria 3728
164 Ga0495610_0000460 3300046512 Bacteria 42065
165 Ga0495610_0012305 3300046512 Bacteria 5160
166 Ga0495616_0003212 3300046513 Bacteria 10534
167 Ga0495616_0013165 3300046513 Bacteria 4675
168 Ga0495637_0019017 3300046520 Unclassified 3181
169 Ga0495643_0069992 3300046522 Bacteria 1843
170 Ga0495663_0008495 3300046525 Bacteria 2846
171 Ga0495652_0308265 3300046529 Bacteria 1148
172 Ga0495633_0026872 3300046558 Bacteria 2818
173 Ga0495625_0001013 3300046660 Bacteria 37051
174 Ga0495625_0015722 3300046660 Bacteria 5979
175 Ga0495625_0040302 3300046660 Bacteria 3408
176 Ga0495625_0142914 3300046660 Bacteria 1613
177 Ga0495661_0002813 3300046665 Bacteria 13183
178 Ga0495661_0029948 3300046665 Bacteria 3469
179 Ga0495649_0000419 3300046694 Bacteria 36929
180 Ga0495660_0060301 3300046810 Unclassified 2038
181 Ga0495660_0124914 3300046810 Bacteria 1297
182 Ga0495683_0093703 3300047323 Bacteria 1452
183 Ga0495686_0000106 3300047472 Bacteria 175852
184 Ga0495686_0001353 3300047472 Bacteria 27388
185 Ga0495686_0025292 3300047472 Bacteria 3893
186 Ga0495686_0072415 3300047472 Bacteria 2119
187 Ga0495686_0237477 3300047472 Bacteria 1029
188 Ga0496101_0125473 3300048904 Bacteria 1945
189 Ga0496106_0015027 3300048909 Bacteria 5730
190 Ga0496115_0027666 3300048918 Bacteria 4437
191 Ga0496115_0036978 3300048918 Unclassified 3867
192 Ga0496116_0000012 3300048919 Bacteria 611365
193 Ga0496117_0000050 3300048920 Bacteria 292727
194 Ga0496117_0001128 3300048920 Bacteria 40283
195 Ga0496118_0000044 3300048921 Bacteria 283524
196 Ga0496118_0269523 3300048921 Bacteria 955
197 Ga0496119_0000002 3300048922 Bacteria 738385
198 Ga0496120_0081516 3300048923 Bacteria 1751
199 Ga0496121_0000026 3300048924 Bacteria 450157
200 Ga0496121_0027765 3300048924 Bacteria 5288
201 Ga0496122_0000090 3300048925 Bacteria 205886
202 Ga0496122_0000658 3300048925 Bacteria 69587
203 Ga0496122_0002758 3300048925 Bacteria 24241
204 Ga0496122_0018483 3300048925 Bacteria 6433
205 Ga0496123_0000856 3300048926 Bacteria 48564
206 Ga0496123_0005161 3300048926 Bacteria 13286
207 Ga0496123_0087525 3300048926 Bacteria 1863
208 Ga0496123_0091849 3300048926 Bacteria 1799
209 Ga0496124_0008955 3300048927 Bacteria 10368
210 Ga0496124_0104663 3300048927 Bacteria 2288
211 Ga0496125_0000349 3300048928 Bacteria 87610
212 Ga0496125_0000844 3300048928 Bacteria 49221
213 Ga0496125_0015935 3300048928 Bacteria 7240
214 Ga0496125_0046558 3300048928 Bacteria 3638
215 Ga0496126_0001903 3300048929 Bacteria 30010
216 Ga0496126_0025813 3300048929 Bacteria 5645
217 Ga0496126_0095326 3300048929 Bacteria 2610
218 Ga0495678_007087 3300049459 Bacteria 5863
219 Ga0495678_131055 3300049459 Unclassified 831
220 Ga0501043_0559205 3300049579 Bacteria 849
221 Ga0501047_0004089 3300049581 Bacteria 13726
222 Ga0501238_034353 3300049671 Unclassified 737
223 Ga0501261_003097 3300049690 Bacteria 2042
224 Ga0501225_0000165 3300049705 Bacteria 19966
225 Ga0501241_000440 3300049758 Bacteria 9077
226 Ga0501241_014253 3300049758 Bacteria 1444
227 Ga0501266_018899 3300049763 Bacteria 929
228 nmdc:mga0k408_45194_c1 3300050493 Bacteria 2540
229 Ga0500635_0000677 3300053080 Bacteria 8620
230 Ga0500578_0000029 3300053086 Bacteria 140078
231 Ga0500578_0034274 3300053086 Bacteria 3262
232 Ga0500568_0030278 3300053139 Bacteria 2242
233 Ga0500622_0000249 3300053156 Bacteria 54675
234 Ga0500622_0005725 3300053156 Bacteria 7383
235 Ga0500587_016833 3300053739 Bacteria 935
236 Ga0466962_0015574 3300061719 Bacteria 3667

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044683 Ga0466965_0733253 Ga0466965_0733253_19_558 177
2 3300046522 Ga0495643_0069992 Ga0495643_0069992_53_781 182
3 3300047472 Ga0495686_0001353 Ga0495686_0001353_24836_25564 196
4 3300037471 Ga0395905_0141997 Ga0395905_0141997_1522_2166 198
5 3300010375 Ga0105239_10449104 Ga0105239_104491042 201
6 3300013105 Ga0157369_10067260 Ga0157369_100672605 201
7 3300044656 Ga0466969_0275470 Ga0466969_0275470_39_695 203
8 3300046810 Ga0495660_0124914 Ga0495660_0124914_188_838 203
9 3300003323 rootH1_10329708 rootH1_103297085 204
10 3300031090 Ga0265760_10144483 Ga0265760_101444831 204
11 3300046512 Ga0495610_0012305 Ga0495610_0012305_4046_4696 204
12 3300046558 Ga0495633_0026872 Ga0495633_0026872_54_704 204
13 3300047323 Ga0495683_0093703 Ga0495683_0093703_32_682 204
14 3300009093 Ga0105240_10000100 Ga0105240_10000100149 205
15 3300026116 Ga0207674_10508288 Ga0207674_105082882 205
16 3300046507 Ga0495606_0000130 Ga0495606_0000130_79592_80242 205
17 3300047472 Ga0495686_0237477 Ga0495686_0237477_74_724 205
18 iso_pu_bacteria 2896109856 2896112210 209
19 3300003322 rootL2_10077778 rootL2_100777782 211
20 3300009036 Ga0105244_10000244 Ga0105244_1000024426 211
21 3300046500 Ga0495596_0000771 Ga0495596_0000771_5172_5807 211
22 3300048919 Ga0496116_0000012 Ga0496116_0000012_18941_19576 211
23 3300048920 Ga0496117_0000050 Ga0496117_0000050_100870_101505 211
24 3300048921 Ga0496118_0000044 Ga0496118_0000044_191250_191885 211
25 3300048922 Ga0496119_0000002 Ga0496119_0000002_193428_194063 211
26 3300048923 Ga0496120_0081516 Ga0496120_0081516_748_1383 211
27 3300048924 Ga0496121_0027765 Ga0496121_0027765_3515_4150 211
28 3300048925 Ga0496122_0000658 Ga0496122_0000658_40551_41186 211
29 3300048925 Ga0496122_0002758 Ga0496122_0002758_19661_20296 211
30 3300048926 Ga0496123_0000856 Ga0496123_0000856_22009_22644 211
31 3300048926 Ga0496123_0005161 Ga0496123_0005161_2972_3607 211
32 3300048927 Ga0496124_0008955 Ga0496124_0008955_6437_7072 211
33 3300048927 Ga0496124_0104663 Ga0496124_0104663_249_884 211
34 3300048928 Ga0496125_0000349 Ga0496125_0000349_27941_28576 211
35 3300048929 Ga0496126_0001903 Ga0496126_0001903_2320_2955 211
36 iso_pu_bacteria 2585428060 2587748722 211
37 iso_pu_bacteria 2588253712 2588447656 211
38 iso_pu_bacteria 2588254257 2590610300 211
39 3300005445 Ga0070708_100018477 Ga0070708_1000184775 212
40 3300005471 Ga0070698_100002069 Ga0070698_1000020695 212
41 3300005518 Ga0070699_100007311 Ga0070699_10000731110 212
42 3300006028 Ga0070717_10025156 Ga0070717_100251564 212
43 3300025910 Ga0207684_10572652 Ga0207684_105726522 212
44 3300044656 Ga0466969_0040698 Ga0466969_0040698_239_883 212
45 3300044684 Ga0466966_0019469 Ga0466966_0019469_3465_4109 212
46 3300044693 Ga0466961_0037724 Ga0466961_0037724_1284_1928 212
47 3300044694 Ga0466963_0229610 Ga0466963_0229610_340_984 212
48 3300044719 Ga0466971_0019169 Ga0466971_0019169_283_927 212
49 3300044765 Ga0466970_0062072 Ga0466970_0062072_392_1036 212
50 3300044842 Ga0466957_0052482 Ga0466957_0052482_452_1096 212
51 3300045049 Ga0466959_0115574 Ga0466959_0115574_209_853 212
52 3300045836 Ga0466958_0042369 Ga0466958_0042369_645_1289 212
53 3300045976 Ga0466967_0086815 Ga0466967_0086815_1184_1828 212
54 3300061719 Ga0466962_0015574 Ga0466962_0015574_1849_2493 212
55 iso_pu_bacteria 2522125168 2522550707 212
56 iso_pu_bacteria 2582581278 2585144836 212
57 iso_pu_bacteria 2585428045 2587679685 212
58 iso_pu_bacteria 2585428095 2587867350 212
59 iso_pu_bacteria 2585428182 2588208440 212
60 iso_pu_bacteria 2585428183 2588213059 212
61 iso_pu_bacteria 2585428184 2588219651 212
62 iso_pu_bacteria 2585428185 2588224038 212
63 iso_pu_bacteria 2588254255 2590600989 212
64 iso_pu_bacteria 2643221600 2644008986 212
65 iso_pu_bacteria 2721755487 2722728317 212
66 iso_pu_bacteria 2739367874 2740060748 212
67 iso_pu_bacteria 2765235839 2765572436 212
68 iso_pu_bacteria 2816332188 2816872720 212
69 iso_pu_bacteria 2871720351 2871721753 212
70 iso_pu_bacteria 2889290771 2889291927 212
71 iso_pu_bacteria 2904555929 2904556775 212
72 iso_pu_bacteria 2919191525 2919191573 212
73 iso_pu_bacteria 2919437846 2919441824 212
74 iso_pu_bacteria 2929239360 2929239536 212
75 iso_pu_bacteria 2929239360 2929244067 212
76 iso_pu_bacteria 2929921140 2929923807 212
77 iso_pu_bacteria 2932082852 2932085843 212
78 iso_pu_bacteria 2945924605 2945927413 212
79 iso_pu_bacteria 2954016120 2954019586 212
80 iso_pu_bacteria 8003151029 8003153514 212
81 3300031251 Ga0265327_10000010 Ga0265327_1000001094 214
82 3300013307 Ga0157372_10170559 Ga0157372_101705592 215
83 3300037471 Ga0395905_0264645 Ga0395905_0264645_105_752 215
84 3300048909 Ga0496106_0015027 Ga0496106_0015027_4799_5446 215
85 3300053086 Ga0500578_0034274 Ga0500578_0034274_1144_1791 215
86 3300053739 Ga0500587_016833 Ga0500587_016833_124_771 215
87 2162886007 SwRhRL2b_contig_1013487 SwRhRL2b_0660.00007120 216
88 3300001979 JGI24740J21852_10023398 JGI24740J21852_100233983 216
89 3300001990 JGI24737J22298_10005536 JGI24737J22298_100055363 216
90 3300002067 JGI24735J21928_10000001 JGI24735J21928_10000001463 216
91 3300002737 JGI25162J39368_1000012 JGI25162J39368_1000012114 216
92 3300003215 JGI25153J46596_10029006 JGI25153J46596_100290062 216
93 3300003215 JGI25153J46596_10031465 JGI25153J46596_100314652 216
94 3300003316 rootH1_10058628 rootH1_100586285 216
95 3300003320 rootH2_10303886 rootH2_103038863 216
96 3300003322 rootL2_10003234 rootL2_100032346 216
97 3300003322 rootL2_10109034 rootL2_101090343 216
98 3300003322 rootL2_10268332 rootL2_102683322 216
99 3300003323 rootH1_10055917 rootH1_100559175 216
100 3300003323 rootH1_10078312 rootH1_1007831213 216
101 3300003354 JGI25160J50197_1000867 JGI25160J50197_100086713 216
102 3300003354 JGI25160J50197_1007189 JGI25160J50197_10071895 216
103 3300003771 Ga0055526_1016835 Ga0055526_10168352 216
104 3300003781 Ga0055536_1012978 Ga0055536_10129784 216
105 3300003784 Ga0055534_1023770 Ga0055534_10237702 216
106 3300003790 Ga0055528_1000122 Ga0055528_100012224 216
107 3300003791 Ga0055530_10000192 Ga0055530_1000019236 216
108 3300003794 Ga0055531_10000102 Ga0055531_100001026 216
109 3300003794 Ga0055531_10062905 Ga0055531_100629051 216
110 3300004625 Ga0055543_1011925 Ga0055543_10119252 216
111 3300005262 Ga0065165_1000066 Ga0065165_100006660 216
112 3300005262 Ga0065165_1003174 Ga0065165_10031743 216
113 3300005288 Ga0065714_10067106 Ga0065714_100671063 216
114 3300005288 Ga0065714_10068365 Ga0065714_100683652 216
115 3300005288 Ga0065714_10075329 Ga0065714_100753292 216
116 3300005288 Ga0065714_10075439 Ga0065714_100754392 216
117 3300005289 Ga0065704_10073131 Ga0065704_100731314 216
118 3300005335 Ga0070666_10042008 Ga0070666_100420082 216
119 3300005337 Ga0070682_100000245 Ga0070682_10000024520 216
120 3300005338 Ga0068868_100427962 Ga0068868_1004279621 216
121 3300005339 Ga0070660_100056018 Ga0070660_1000560183 216
122 3300005539 Ga0068853_100003792 Ga0068853_1000037928 216
123 3300005539 Ga0068853_100369212 Ga0068853_1003692122 216
124 3300005563 Ga0068855_100040541 Ga0068855_1000405412 216
125 3300005578 Ga0068854_100660447 Ga0068854_1006604472 216
126 3300006195 Ga0075366_10137840 Ga0075366_101378402 216
127 3300009093 Ga0105240_10000059 Ga0105240_1000005969 216
128 3300009093 Ga0105240_10262633 Ga0105240_102626333 216
129 3300009148 Ga0105243_10000408 Ga0105243_1000040825 216
130 3300009148 Ga0105243_10031291 Ga0105243_100312913 216
131 3300009148 Ga0105243_10055499 Ga0105243_100554993 216
132 3300009174 Ga0105241_10587531 Ga0105241_105875312 216
133 3300009545 Ga0105237_10008552 Ga0105237_100085523 216
134 3300009545 Ga0105237_10035395 Ga0105237_100353953 216
135 3300009551 Ga0105238_10145168 Ga0105238_101451682 216
136 3300010375 Ga0105239_10000117 Ga0105239_1000011724 216
137 3300010375 Ga0105239_10074027 Ga0105239_100740273 216
138 3300010375 Ga0105239_10831155 Ga0105239_108311551 216
139 3300013100 Ga0157373_10002593 Ga0157373_1000259311 216
140 3300013100 Ga0157373_10057798 Ga0157373_100577984 216
141 3300013100 Ga0157373_10272111 Ga0157373_102721112 216
142 3300013102 Ga0157371_10456009 Ga0157371_104560091 216
143 3300013104 Ga0157370_10000103 Ga0157370_1000010337 216
144 3300013104 Ga0157370_10001172 Ga0157370_1000117213 216
145 3300013104 Ga0157370_10001460 Ga0157370_1000146012 216
146 3300013104 Ga0157370_10004370 Ga0157370_100043703 216
147 3300013104 Ga0157370_10038164 Ga0157370_100381642 216
148 3300013104 Ga0157370_10061465 Ga0157370_100614652 216
149 3300013104 Ga0157370_10089085 Ga0157370_100890854 216
150 3300013104 Ga0157370_10162238 Ga0157370_101622383 216
151 3300013105 Ga0157369_10038224 Ga0157369_100382243 216
152 3300013306 Ga0163162_10015623 Ga0163162_100156237 216
153 3300013306 Ga0163162_10529847 Ga0163162_105298472 216
154 3300013308 Ga0157375_10000218 Ga0157375_1000021813 216
155 3300013308 Ga0157375_10066124 Ga0157375_100661244 216
156 3300013308 Ga0157375_10625933 Ga0157375_106259332 216
157 3300014325 Ga0163163_10041164 Ga0163163_100411643 216
158 3300015261 Ga0182006_1009666 Ga0182006_10096663 216
159 3300017792 Ga0163161_10001081 Ga0163161_100010813 216
160 3300017792 Ga0163161_10001325 Ga0163161_1000132511 216
161 3300017792 Ga0163161_10098693 Ga0163161_100986932 216
162 3300025233 Ga0209437_100041 Ga0209437_100041159 216
163 3300025273 Ga0209673_1000049 Ga0209673_1000049108 216
164 3300025291 Ga0209675_1000032 Ga0209675_1000032198 216
165 3300025291 Ga0209675_1058263 Ga0209675_10582631 216
166 3300025292 Ga0209676_1000579 Ga0209676_100057928 216
167 3300025295 Ga0209564_1007341 Ga0209564_10073414 216
168 3300025297 Ga0209758_1003047 Ga0209758_10030479 216
169 3300025297 Ga0209758_1006793 Ga0209758_10067936 216
170 3300025297 Ga0209758_1027268 Ga0209758_10272683 216
171 3300025298 Ga0209050_1000129 Ga0209050_100012924 216
172 3300025302 Ga0207426_1000782 Ga0207426_10007822 216
173 3300025302 Ga0207426_1001379 Ga0207426_100137914 216
174 3300025303 Ga0209051_1036275 Ga0209051_10362753 216
175 3300025304 Ga0209257_1000004 Ga0209257_10000041343 216
176 3300025304 Ga0209257_1001137 Ga0209257_100113719 216
177 3300025304 Ga0209257_1060412 Ga0209257_10604121 216
178 3300025728 Ga0207655_1000702 Ga0207655_100070210 216
179 3300025903 Ga0207680_10076486 Ga0207680_100764862 216
180 3300025913 Ga0207695_10000027 Ga0207695_10000027486 216
181 3300025913 Ga0207695_10000039 Ga0207695_10000039351 216
182 3300025913 Ga0207695_10777077 Ga0207695_107770771 216
183 3300025914 Ga0207671_10004569 Ga0207671_100045694 216
184 3300025914 Ga0207671_10010114 Ga0207671_100101147 216
185 3300025935 Ga0207709_10000458 Ga0207709_1000045820 216
186 3300025949 Ga0207667_10033642 Ga0207667_100336422 216
187 3300026041 Ga0207639_10019211 Ga0207639_100192111 216
188 3300031456 Ga0307513_10122427 Ga0307513_101224272 216
189 3300031456 Ga0307513_10409198 Ga0307513_104091982 216
190 3300031711 Ga0265314_10204820 Ga0265314_102048201 216
191 3300031903 Ga0307407_10000007 Ga0307407_100000075 216
192 3300031911 Ga0307412_10000029 Ga0307412_1000002971 216
193 3300031911 Ga0307412_10431905 Ga0307412_104319052 216
194 3300031995 Ga0307409_100157523 Ga0307409_1001575232 216
195 3300032002 Ga0307416_100000015 Ga0307416_100000015181 216
196 3300032004 Ga0307414_10004023 Ga0307414_100040236 216
197 3300032004 Ga0307414_10008294 Ga0307414_100082945 216
198 3300032004 Ga0307414_10060925 Ga0307414_100609253 216
199 3300032004 Ga0307414_10253687 Ga0307414_102536872 216
200 3300037418 Ga0395900_0126747 Ga0395900_0126747_213_863 216
201 3300041997 Ga0439431_0020248 Ga0439431_0020248_289_939 216
202 3300042004 Ga0439445_0000563 Ga0439445_0000563_5483_6133 216
203 3300044658 Ga0466972_0000002 Ga0466972_0000002_297790_298440 216
204 3300044658 Ga0466972_0000127 Ga0466972_0000127_31121_31771 216
205 3300044672 Ga0466982_0061445 Ga0466982_0061445_1402_2052 216
206 3300044765 Ga0466970_0000159 Ga0466970_0000159_3817_4467 216
207 3300044765 Ga0466970_0018412 Ga0466970_0018412_653_1303 216
208 3300046453 Ga0495627_008729 Ga0495627_008729_1777_2505 216
209 3300046460 Ga0495638_0025508 Ga0495638_0025508_2827_3555 216
210 3300046471 Ga0495650_0000273 Ga0495650_0000273_78005_78655 216
211 3300046471 Ga0495650_0072384 Ga0495650_0072384_589_1239 216
212 3300046474 Ga0495605_0033595 Ga0495605_0033595_1680_2339 216
213 3300046507 Ga0495606_0011386 Ga0495606_0011386_818_1468 216
214 3300046507 Ga0495606_0012575 Ga0495606_0012575_3352_4002 216
215 3300046507 Ga0495606_0025032 Ga0495606_0025032_3129_3779 216
216 3300046507 Ga0495606_0030949 Ga0495606_0030949_561_1211 216
217 3300046512 Ga0495610_0000460 Ga0495610_0000460_25587_26237 216
218 3300046513 Ga0495616_0003212 Ga0495616_0003212_3221_3871 216
219 3300046513 Ga0495616_0013165 Ga0495616_0013165_190_840 216
220 3300046520 Ga0495637_0019017 Ga0495637_0019017_658_1308 216
221 3300046525 Ga0495663_0008495 Ga0495663_0008495_1791_2441 216
222 3300046529 Ga0495652_0308265 Ga0495652_0308265_451_1101 216
223 3300046660 Ga0495625_0001013 Ga0495625_0001013_20152_20802 216
224 3300046660 Ga0495625_0015722 Ga0495625_0015722_2330_2980 216
225 3300046660 Ga0495625_0040302 Ga0495625_0040302_2287_2937 216
226 3300046660 Ga0495625_0142914 Ga0495625_0142914_53_703 216
227 3300046665 Ga0495661_0002813 Ga0495661_0002813_7079_7729 216
228 3300046665 Ga0495661_0029948 Ga0495661_0029948_1755_2405 216
229 3300046694 Ga0495649_0000419 Ga0495649_0000419_16160_16810 216
230 3300046810 Ga0495660_0060301 Ga0495660_0060301_944_1594 216
231 3300047472 Ga0495686_0000106 Ga0495686_0000106_122137_122787 216
232 3300047472 Ga0495686_0025292 Ga0495686_0025292_760_1410 216
233 3300047472 Ga0495686_0072415 Ga0495686_0072415_275_925 216
234 3300048904 Ga0496101_0125473 Ga0496101_0125473_454_1104 216
235 3300048918 Ga0496115_0027666 Ga0496115_0027666_1742_2392 216
236 3300048918 Ga0496115_0036978 Ga0496115_0036978_967_1617 216
237 3300048920 Ga0496117_0001128 Ga0496117_0001128_22766_23416 216
238 3300048921 Ga0496118_0269523 Ga0496118_0269523_264_914 216
239 3300048924 Ga0496121_0000026 Ga0496121_0000026_92806_93456 216
240 3300048925 Ga0496122_0000090 Ga0496122_0000090_22556_23206 216
241 3300048925 Ga0496122_0018483 Ga0496122_0018483_5148_5798 216
242 3300048926 Ga0496123_0087525 Ga0496123_0087525_1065_1715 216
243 3300048926 Ga0496123_0091849 Ga0496123_0091849_144_833 216
244 3300048928 Ga0496125_0000844 Ga0496125_0000844_24834_25484 216
245 3300048928 Ga0496125_0015935 Ga0496125_0015935_1212_1862 216
246 3300048928 Ga0496125_0046558 Ga0496125_0046558_2603_3253 216
247 3300048929 Ga0496126_0025813 Ga0496126_0025813_2789_3439 216
248 3300048929 Ga0496126_0095326 Ga0496126_0095326_1062_1712 216
249 3300049459 Ga0495678_007087 Ga0495678_007087_3649_4299 216
250 3300049459 Ga0495678_131055 Ga0495678_131055_86_736 216
251 3300049579 Ga0501043_0559205 Ga0501043_0559205_69_719 216
252 3300049581 Ga0501047_0004089 Ga0501047_0004089_2819_3469 216
253 3300049671 Ga0501238_034353 Ga0501238_034353_33_683 216
254 3300049690 Ga0501261_003097 Ga0501261_003097_70_720 216
255 3300049705 Ga0501225_0000165 Ga0501225_0000165_10703_11353 216
256 3300049758 Ga0501241_000440 Ga0501241_000440_4701_5351 216
257 3300049758 Ga0501241_014253 Ga0501241_014253_522_1172 216
258 3300049763 Ga0501266_018899 Ga0501266_018899_122_772 216
259 3300050493 nmdc:mga0k408_45194_c1 nmdc:mga0k408_45194_c1_610_1260 216
260 3300053080 Ga0500635_0000677 Ga0500635_0000677_1647_2297 216
261 3300053086 Ga0500578_0000029 Ga0500578_0000029_54844_55494 216
262 3300053139 Ga0500568_0030278 Ga0500568_0030278_931_1602 216
263 3300053156 Ga0500622_0000249 Ga0500622_0000249_52843_53493 216
264 3300053156 Ga0500622_0005725 Ga0500622_0005725_2046_2696 216

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01966

HD

HD domain

61

186

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
6dk9-assembly4.cif.gz_F yeast ddi2 cyanamide hydratase 0.8688 3 181
6dkd-assembly2.cif.gz_C yeast ddi2 cyanamide hydratase 0.8674 3 181
6dka-assembly4.cif.gz_F yeast ddi2 cyanamide hydratase 0.8662 3 181
6dk9-assembly4.cif.gz_F yeast ddi2 cyanamide hydratase 0.7249 3 181
6dkd-assembly2.cif.gz_C yeast ddi2 cyanamide hydratase 0.7242 3 181
ID Description Score Start End Superfamily
af_P0CH63_33_194_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.9071 16 172 1.10.3210.10
af_P0CH63_33_194_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.8756 16 172 1.10.3210.10
af_F4HZF4_333_543_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.6553 19 144 1.10.3210.10
af_Q54GY3_13_181_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.6031 19 182 1.10.3210.10
af_Q86JB3_16_237_1.10.3210.50 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432; 0.6025 19 179 1.10.3210.50
ID Description Score Start End GO Terms
AF-A0A7W5GAA3-F1-model_v4 HD superfamily phosphodiesterase 0.9952 8 216
AF-A0A1I5G940-F1-model_v4 HD domain-containing protein 0.9921 8 176
AF-A0A0H3KS96-F1-model_v4 Metal-dependent phosphohydrolase 0.9911 9 191
AF-A0A7W5GAA3-F1-model_v4 HD superfamily phosphodiesterase 0.9905 8 216
AF-A0A512JR07-F1-model_v4 HD domain-containing protein 0.9904 8 110

Feature Viewer

pLDDT pTM Quality
95.61 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map