F372757

General Info

Members Datasets Scaffolds Average Seq Length
264 136 528 65

Family's Representative Sequence

Representative Sequence 3300037466|Ga0395898_0894887|Ga0395898_0894887_252_455
Length 67
Sequence VIVLITFTVGLVWWLVAWSLLGIKAFDAFLLTIALTVGAAAYTMTKPYIDQLLGREAAPSEERGAGF

Samples

Sample ID Description Type Environment
1 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
17 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
18 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
28 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
49 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
70 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
72 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
73 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
74 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
75 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
76 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
77 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
78 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
79 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
80 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
81 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
82 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
83 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
84 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
85 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
86 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
87 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
88 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
89 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
90 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
91 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
92 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
93 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
94 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
95 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
96 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
97 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
98 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
99 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
100 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
101 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
102 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
113 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
114 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
115 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
116 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
117 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
118 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
119 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
120 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
121 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
122 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
123 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
126 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
127 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
128 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
129 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
130 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
131 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
132 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
133 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
134 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
135 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
136 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.89
Nodule 0
Rhizoplane 0
Rhizosphere 98.11
Stem 0
Stem Tuber 0
Unclassified 10.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395898_0894887 3300037466 Unclassified 826
2 JGI25407J50210_10000516 3300003373 Bacteria 7772
3 JGI25407J50210_10002640 3300003373 Bacteria 4249
4 JGI25407J50210_10012354 3300003373 Bacteria 2189
5 JGI25407J50210_10028030 3300003373 Bacteria 1461
6 Ga0070683_101702764 3300005329 Bacteria 606
7 Ga0070660_100311373 3300005339 Bacteria 1292
8 Ga0070691_10575568 3300005341 Unclassified 661
9 Ga0070692_10238032 3300005345 Bacteria 1084
10 Ga0070668_100016783 3300005347 Bacteria 5475
11 Ga0070659_100280544 3300005366 Bacteria 1386
12 Ga0070659_101615499 3300005366 Bacteria 579
13 Ga0070703_10607358 3300005406 Bacteria 505
14 Ga0070700_100523886 3300005441 Bacteria 916
15 Ga0070700_100549606 3300005441 Bacteria 897
16 Ga0070700_100891570 3300005441 Unclassified 723
17 Ga0070694_100515102 3300005444 Bacteria 954
18 Ga0070694_100836560 3300005444 Bacteria 757
19 Ga0070663_100583454 3300005455 Bacteria 938
20 Ga0070678_100753303 3300005456 Bacteria 881
21 Ga0070662_100000228 3300005457 Bacteria 33120
22 Ga0070662_100700220 3300005457 Bacteria 857
23 Ga0070662_101865854 3300005457 Bacteria 519
24 Ga0068867_100765282 3300005459 Bacteria 858
25 Ga0070672_100932664 3300005543 Bacteria 768
26 Ga0070695_100107504 3300005545 Bacteria 1888
27 Ga0070695_101149326 3300005545 Bacteria 637
28 Ga0070693_101037804 3300005547 Unclassified 622
29 Ga0070664_100520776 3300005564 Bacteria 1097
30 Ga0070702_100775182 3300005615 Bacteria 739
31 Ga0068852_100303566 3300005616 Bacteria 1546
32 Ga0068866_10636604 3300005718 Bacteria 724
33 Ga0068861_100025449 3300005719 Bacteria 4293
34 Ga0068870_10361114 3300005840 Bacteria 935
35 Ga0068862_100508183 3300005844 Bacteria 1145
36 Ga0068862_101511802 3300005844 Bacteria 677
37 Ga0081455_10014804 3300005937 Bacteria 7611
38 Ga0081455_10116930 3300005937 Bacteria 2108
39 Ga0081455_10264313 3300005937 Bacteria 1252
40 Ga0081538_10000009 3300005981 Bacteria 172017
41 Ga0081538_10000024 3300005981 Bacteria 130974
42 Ga0081538_10000360 3300005981 Bacteria 51870
43 Ga0081538_10000910 3300005981 Bacteria 31938
44 Ga0081538_10002463 3300005981 Bacteria 18087
45 Ga0081538_10021608 3300005981 Bacteria 4687
46 Ga0081538_10028554 3300005981 Bacteria 3833
47 Ga0081538_10038670 3300005981 Bacteria 3074
48 Ga0081538_10046574 3300005981 Bacteria 2672
49 Ga0081538_10049199 3300005981 Bacteria 2559
50 Ga0081538_10087530 3300005981 Bacteria 1625
51 Ga0081538_10240804 3300005981 Bacteria 698
52 Ga0081540_1054365 3300005983 Bacteria 1957
53 Ga0075365_10429530 3300006038 Unclassified 933
54 Ga0075365_10434665 3300006038 Bacteria 927
55 Ga0075363_100772750 3300006048 Bacteria 583
56 Ga0075363_100803986 3300006048 Bacteria 572
57 Ga0075428_100036638 3300006844 Bacteria 5402
58 Ga0075428_100111207 3300006844 Bacteria 2985
59 Ga0075428_100236301 3300006844 Bacteria 1972
60 Ga0075428_100583848 3300006844 Unclassified 1194
61 Ga0075428_100927979 3300006844 Bacteria 923
62 Ga0075428_102500635 3300006844 Bacteria 529
63 Ga0075430_100574681 3300006846 Bacteria 930
64 Ga0075431_100064287 3300006847 Bacteria 3788
65 Ga0075431_101646015 3300006847 Bacteria 599
66 Ga0075431_101770858 3300006847 Bacteria 574
67 Ga0075431_101997304 3300006847 Bacteria 535
68 Ga0075433_10095245 3300006852 Bacteria 2634
69 Ga0075434_100888554 3300006871 Bacteria 906
70 Ga0075429_100481361 3300006880 Bacteria 1088
71 Ga0075429_100529049 3300006880 Bacteria 1033
72 Ga0075429_101972133 3300006880 Bacteria 505
73 Ga0068865_102159317 3300006881 Unclassified 507
74 Ga0111539_10016997 3300009094 Bacteria 9003
75 Ga0111539_10173502 3300009094 Bacteria 2519
76 Ga0111539_10453966 3300009094 Bacteria 1492
77 Ga0111539_11317708 3300009094 Bacteria 838
78 Ga0111539_12192898 3300009094 Bacteria 641
79 Ga0111539_12261287 3300009094 Unclassified 631
80 Ga0111539_13153030 3300009094 Bacteria 532
81 Ga0105245_10003111 3300009098 Bacteria 14844
82 Ga0105245_10688357 3300009098 Bacteria 1055
83 Ga0114129_10002456 3300009147 Bacteria 25728
84 Ga0114129_10097228 3300009147 Bacteria 4076
85 Ga0114129_10261565 3300009147 Bacteria 2319
86 Ga0114129_10470752 3300009147 Bacteria 1645
87 Ga0114129_10721172 3300009147 Bacteria 1279
88 Ga0114129_10968882 3300009147 Bacteria 1073
89 Ga0114129_11225349 3300009147 Bacteria 933
90 Ga0105243_11720940 3300009148 Bacteria 656
91 Ga0105243_12395785 3300009148 Unclassified 566
92 Ga0105249_10008979 3300009553 Bacteria 8732
93 Ga0105239_10032238 3300010375 Bacteria 5759
94 Ga0105246_11457413 3300011119 Bacteria 641
95 Ga0163162_10029669 3300013306 Bacteria 5415
96 Ga0157372_11664233 3300013307 Bacteria 734
97 Ga0157380_10367959 3300014326 Bacteria 1352
98 Ga0163161_10862403 3300017792 Unclassified 765
99 Ga0207653_10419042 3300025885 Bacteria 525
100 Ga0207688_10056705 3300025901 Bacteria 2201
101 Ga0207643_10435531 3300025908 Bacteria 832
102 Ga0207662_10361982 3300025918 Bacteria 976
103 Ga0207657_10745834 3300025919 Unclassified 759
104 Ga0207657_11278701 3300025919 Bacteria 555
105 Ga0207687_10022101 3300025927 Bacteria 4232
106 Ga0207690_10104691 3300025932 Bacteria 2028
107 Ga0207706_10001621 3300025933 Bacteria 22314
108 Ga0207706_10924574 3300025933 Bacteria 736
109 Ga0207706_11598953 3300025933 Bacteria 528
110 Ga0207709_10984256 3300025935 Bacteria 689
111 Ga0207669_11017717 3300025937 Unclassified 697
112 Ga0207679_10469274 3300025945 Bacteria 1119
113 Ga0207712_10074348 3300025961 Bacteria 2454
114 Ga0207668_10056375 3300025972 Bacteria 2736
115 Ga0207668_10978164 3300025972 Bacteria 756
116 Ga0207640_10595262 3300025981 Unclassified 935
117 Ga0207678_11661326 3300026067 Bacteria 561
118 Ga0207708_10033133 3300026075 Bacteria 3924
119 Ga0207708_10414416 3300026075 Bacteria 1116
120 Ga0207708_10533037 3300026075 Bacteria 988
121 Ga0207708_10534100 3300026075 Bacteria 987
122 Ga0207708_11847521 3300026075 Unclassified 530
123 Ga0207648_10670459 3300026089 Bacteria 959
124 Ga0207675_100007181 3300026118 Bacteria 10525
125 Ga0207675_100245935 3300026118 Bacteria 1730
126 Ga0207683_10866125 3300026121 Bacteria 839
127 Ga0207698_10366312 3300026142 Bacteria 1366
128 Ga0207428_10015071 3300027907 Bacteria 6696
129 Ga0207428_10194562 3300027907 Bacteria 1528
130 Ga0207428_10658855 3300027907 Bacteria 751
131 Ga0207428_10987213 3300027907 Bacteria 592
132 Ga0268265_10509746 3300028380 Bacteria 1135
133 Ga0268265_10926670 3300028380 Bacteria 857
134 Ga0307408_100368574 3300031548 Bacteria 1224
135 Ga0307408_100886994 3300031548 Bacteria 815
136 Ga0307405_10054106 3300031731 Bacteria 2504
137 Ga0307405_10069785 3300031731 Bacteria 2254
138 Ga0307405_11692751 3300031731 Bacteria 560
139 Ga0307413_10179069 3300031824 Bacteria 1509
140 Ga0307413_11213367 3300031824 Unclassified 656
141 Ga0307410_10028425 3300031852 Bacteria 3547
142 Ga0307410_10328525 3300031852 Bacteria 1215
143 Ga0307410_11229391 3300031852 Unclassified 653
144 Ga0307410_11816969 3300031852 Unclassified 542
145 Ga0307410_12002615 3300031852 Bacteria 517
146 Ga0307406_10047603 3300031901 Bacteria 2703
147 Ga0307406_10137731 3300031901 Bacteria 1723
148 Ga0307406_10472911 3300031901 Bacteria 1010
149 Ga0307407_10008598 3300031903 Bacteria 4699
150 Ga0307407_10288435 3300031903 Bacteria 1140
151 Ga0307407_10436196 3300031903 Bacteria 947
152 Ga0307412_10396277 3300031911 Unclassified 1122
153 Ga0307409_100129198 3300031995 Bacteria 2155
154 Ga0307409_100262951 3300031995 Bacteria 1584
155 Ga0307409_100399734 3300031995 Bacteria 1312
156 Ga0307409_100691221 3300031995 Bacteria 1018
157 Ga0307409_101107285 3300031995 Bacteria 813
158 Ga0307409_101263679 3300031995 Bacteria 763
159 Ga0307416_100041354 3300032002 Bacteria 3589
160 Ga0307416_100295793 3300032002 Bacteria 1606
161 Ga0307416_100508471 3300032002 Bacteria 1270
162 Ga0307416_100554664 3300032002 Bacteria 1223
163 Ga0307416_101697077 3300032002 Bacteria 736
164 Ga0307414_10155178 3300032004 Bacteria 1811
165 Ga0307411_10228996 3300032005 Bacteria 1447
166 Ga0307411_12194714 3300032005 Bacteria 518
167 Ga0307415_100060827 3300032126 Bacteria 2612
168 Ga0307415_100198224 3300032126 Bacteria 1590
169 Ga0307415_100481858 3300032126 Bacteria 1080
170 Ga0373958_0151990 3300034819 Bacteria 580
171 Ga0373959_0161174 3300034820 Bacteria 573
172 Ga0373929_0236366 3300035085 Bacteria 525
173 Ga0373940_0237076 3300035088 Bacteria 611
174 Ga0373941_0031306 3300035115 Bacteria 1584
175 Ga0373960_0052428 3300035121 Bacteria 1214
176 Ga0373961_0085772 3300035241 Bacteria 998
177 Ga0373931_0102454 3300035691 Bacteria 1612
178 Ga0395898_0202192 3300037466 Bacteria 1896
179 Ga0395905_1090699 3300037471 Bacteria 702
180 Ga0395905_1318788 3300037471 Bacteria 626
181 Ga0395901_1080578 3300038443 Bacteria 774
182 Ga0439448_0221092 3300042005 Bacteria 666
183 Ga0439463_053263 3300042016 Bacteria 1033
184 Ga0439460_0082971 3300042461 Bacteria 1008
185 Ga0495584_0306343 3300046491 Bacteria 807
186 Ga0495584_0658589 3300046491 Bacteria 534
187 Ga0495596_0310357 3300046500 Bacteria 613
188 Ga0495668_0213779 3300046616 Bacteria 1056
189 Ga0495669_0264078 3300046684 Bacteria 827
190 Ga0495589_0050459 3300046794 Bacteria 2058
191 Ga0495672_0068903 3300047320 Bacteria 2010
192 Ga0501031_0064547 3300049568 Bacteria 2385
193 Ga0501031_0454047 3300049568 Bacteria 828
194 Ga0501036_0077270 3300049572 Bacteria 2817
195 Ga0501036_0999499 3300049572 Bacteria 685
196 Ga0501036_1430579 3300049572 Unclassified 560
197 Ga0501038_0248550 3300049574 Bacteria 1410
198 Ga0501038_0256614 3300049574 Bacteria 1383
199 Ga0501039_1290579 3300049575 Bacteria 563
200 Ga0501040_0027457 3300049576 Bacteria 3833
201 Ga0501041_0335476 3300049577 Bacteria 955
202 Ga0501041_0457991 3300049577 Bacteria 810
203 Ga0501042_0012001 3300049578 Bacteria 5858
204 Ga0501042_0567198 3300049578 Bacteria 825
205 Ga0501042_1075627 3300049578 Bacteria 586
206 Ga0501043_0369911 3300049579 Unclassified 1087
207 Ga0501046_0825553 3300049580 Bacteria 649
208 Ga0501048_0133876 3300049582 Bacteria 1751
209 Ga0501048_0235816 3300049582 Bacteria 1298
210 Ga0501048_0849789 3300049582 Bacteria 656
211 Ga0501048_0923610 3300049582 Bacteria 628
212 Ga0501067_0462527 3300049583 Bacteria 709
213 Ga0501068_0587957 3300049584 Bacteria 725
214 Ga0501069_0668463 3300049585 Unclassified 626
215 Ga0501071_0081565 3300049587 Bacteria 2367
216 Ga0501071_1228104 3300049587 Unclassified 579
217 Ga0501072_0027826 3300049588 Bacteria 4411
218 Ga0501072_0046036 3300049588 Bacteria 3432
219 Ga0501072_0675618 3300049588 Unclassified 812
220 Ga0501075_0124774 3300049591 Bacteria 1960
221 Ga0501075_0203281 3300049591 Bacteria 1511
222 Ga0501075_0794782 3300049591 Unclassified 720
223 Ga0501076_0058291 3300049592 Bacteria 3069
224 Ga0501076_0084553 3300049592 Bacteria 2549
225 Ga0501076_0236344 3300049592 Bacteria 1494
226 Ga0501077_0134974 3300049593 Bacteria 1565
227 Ga0501077_0793808 3300049593 Unclassified 609
228 Ga0501079_0216798 3300049741 Bacteria 1495
229 Ga0501079_0373434 3300049741 Bacteria 1118
230 Ga0501079_0499710 3300049741 Bacteria 956
231 Ga0501081_0039077 3300049743 Bacteria 3246
232 Ga0501081_1132862 3300049743 Bacteria 592
233 Ga0501083_0509003 3300049744 Bacteria 784
234 Ga0501035_0270701 3300049822 Bacteria 1438
235 Ga0501044_0470449 3300049823 Bacteria 1161
236 Ga0501045_0189536 3300049824 Bacteria 1533
237 Ga0501045_0242746 3300049824 Bacteria 1341
238 Ga0501045_0289954 3300049824 Bacteria 1218
239 Ga0501045_0923423 3300049824 Bacteria 641
240 nmdc:mga0yw44_543504_c1 3300050492 Unclassified 789
241 nmdc:mga05p37_153443_c1 3300050507 Bacteria 2816
242 nmdc:mga05p37_1582966_c1 3300050507 Bacteria 647
243 nmdc:mga05p37_526736_c1 3300050507 Bacteria 1350
244 nmdc:mga05p37_53276_c1 3300050507 Bacteria 4975
245 nmdc:mga05p37_667986_c1 3300050507 Bacteria 1160
246 nmdc:mga09592_396515_c1 3300050508 Bacteria 1193
247 nmdc:mga09592_492746_c1 3300050508 Bacteria 1055
248 nmdc:mga0qj67_24709_c1 3300050509 Bacteria 4635
249 nmdc:mga06r32_2077039_c1 3300050510 Bacteria 501
250 nmdc:mga06r32_357905_c1 3300050510 Unclassified 1444
251 nmdc:mga08y16_10225_c1 3300050511 Bacteria 9848
252 nmdc:mga08y16_163322_c1 3300050511 Bacteria 2314
253 nmdc:mga08y16_2114081_c1 3300050511 Bacteria 510
254 nmdc:mga08y16_454805_c1 3300050511 Bacteria 1305
255 nmdc:mga08y16_874788_c1 3300050511 Bacteria 886
256 nmdc:mga0n895_1063282_c1 3300050512 Bacteria 788
257 nmdc:mga0n895_520855_c1 3300050512 Bacteria 1196
258 nmdc:mga0a205_42933_c1 3300050515 Bacteria 4358
259 Ga0501084_0383522 3300054114 Bacteria 1188
260 Ga0501084_1146555 3300054114 Bacteria 652
261 Ga0501084_1880418 3300054114 Bacteria 500
262 Ga0501082_0205766 3300060353 Bacteria 1712
263 Ga0530510_0032757 3300061734 Bacteria 3741
264 Ga0530510_0184421 3300061734 Bacteria 1548
265 Ga0395898_0894887
266 JGI25407J50210_10000516
267 JGI25407J50210_10002640
268 JGI25407J50210_10012354
269 JGI25407J50210_10028030
270 Ga0070683_101702764
271 Ga0070660_100311373
272 Ga0070691_10575568
273 Ga0070692_10238032
274 Ga0070668_100016783
275 Ga0070659_100280544
276 Ga0070659_101615499
277 Ga0070703_10607358
278 Ga0070700_100523886
279 Ga0070700_100549606
280 Ga0070700_100891570
281 Ga0070694_100515102
282 Ga0070694_100836560
283 Ga0070663_100583454
284 Ga0070678_100753303
285 Ga0070662_100000228
286 Ga0070662_100700220
287 Ga0070662_101865854
288 Ga0068867_100765282
289 Ga0070672_100932664
290 Ga0070695_100107504
291 Ga0070695_101149326
292 Ga0070693_101037804
293 Ga0070664_100520776
294 Ga0070702_100775182
295 Ga0068852_100303566
296 Ga0068866_10636604
297 Ga0068861_100025449
298 Ga0068870_10361114
299 Ga0068862_100508183
300 Ga0068862_101511802
301 Ga0081455_10014804
302 Ga0081455_10116930
303 Ga0081455_10264313
304 Ga0081538_10000009
305 Ga0081538_10000024
306 Ga0081538_10000360
307 Ga0081538_10000910
308 Ga0081538_10002463
309 Ga0081538_10021608
310 Ga0081538_10028554
311 Ga0081538_10038670
312 Ga0081538_10046574
313 Ga0081538_10049199
314 Ga0081538_10087530
315 Ga0081538_10240804
316 Ga0081540_1054365
317 Ga0075365_10429530
318 Ga0075365_10434665
319 Ga0075363_100772750
320 Ga0075363_100803986
321 Ga0075428_100036638
322 Ga0075428_100111207
323 Ga0075428_100236301
324 Ga0075428_100583848
325 Ga0075428_100927979
326 Ga0075428_102500635
327 Ga0075430_100574681
328 Ga0075431_100064287
329 Ga0075431_101646015
330 Ga0075431_101770858
331 Ga0075431_101997304
332 Ga0075433_10095245
333 Ga0075434_100888554
334 Ga0075429_100481361
335 Ga0075429_100529049
336 Ga0075429_101972133
337 Ga0068865_102159317
338 Ga0111539_10016997
339 Ga0111539_10173502
340 Ga0111539_10453966
341 Ga0111539_11317708
342 Ga0111539_12192898
343 Ga0111539_12261287
344 Ga0111539_13153030
345 Ga0105245_10003111
346 Ga0105245_10688357
347 Ga0114129_10002456
348 Ga0114129_10097228
349 Ga0114129_10261565
350 Ga0114129_10470752
351 Ga0114129_10721172
352 Ga0114129_10968882
353 Ga0114129_11225349
354 Ga0105243_11720940
355 Ga0105243_12395785
356 Ga0105249_10008979
357 Ga0105239_10032238
358 Ga0105246_11457413
359 Ga0163162_10029669
360 Ga0157372_11664233
361 Ga0157380_10367959
362 Ga0163161_10862403
363 Ga0207653_10419042
364 Ga0207688_10056705
365 Ga0207643_10435531
366 Ga0207662_10361982
367 Ga0207657_10745834
368 Ga0207657_11278701
369 Ga0207687_10022101
370 Ga0207690_10104691
371 Ga0207706_10001621
372 Ga0207706_10924574
373 Ga0207706_11598953
374 Ga0207709_10984256
375 Ga0207669_11017717
376 Ga0207679_10469274
377 Ga0207712_10074348
378 Ga0207668_10056375
379 Ga0207668_10978164
380 Ga0207640_10595262
381 Ga0207678_11661326
382 Ga0207708_10033133
383 Ga0207708_10414416
384 Ga0207708_10533037
385 Ga0207708_10534100
386 Ga0207708_11847521
387 Ga0207648_10670459
388 Ga0207675_100007181
389 Ga0207675_100245935
390 Ga0207683_10866125
391 Ga0207698_10366312
392 Ga0207428_10015071
393 Ga0207428_10194562
394 Ga0207428_10658855
395 Ga0207428_10987213
396 Ga0268265_10509746
397 Ga0268265_10926670
398 Ga0307408_100368574
399 Ga0307408_100886994
400 Ga0307405_10054106
401 Ga0307405_10069785
402 Ga0307405_11692751
403 Ga0307413_10179069
404 Ga0307413_11213367
405 Ga0307410_10028425
406 Ga0307410_10328525
407 Ga0307410_11229391
408 Ga0307410_11816969
409 Ga0307410_12002615
410 Ga0307406_10047603
411 Ga0307406_10137731
412 Ga0307406_10472911
413 Ga0307407_10008598
414 Ga0307407_10288435
415 Ga0307407_10436196
416 Ga0307412_10396277
417 Ga0307409_100129198
418 Ga0307409_100262951
419 Ga0307409_100399734
420 Ga0307409_100691221
421 Ga0307409_101107285
422 Ga0307409_101263679
423 Ga0307416_100041354
424 Ga0307416_100295793
425 Ga0307416_100508471
426 Ga0307416_100554664
427 Ga0307416_101697077
428 Ga0307414_10155178
429 Ga0307411_10228996
430 Ga0307411_12194714
431 Ga0307415_100060827
432 Ga0307415_100198224
433 Ga0307415_100481858
434 Ga0373958_0151990
435 Ga0373959_0161174
436 Ga0373929_0236366
437 Ga0373940_0237076
438 Ga0373941_0031306
439 Ga0373960_0052428
440 Ga0373961_0085772
441 Ga0373931_0102454
442 Ga0395898_0202192
443 Ga0395905_1090699
444 Ga0395905_1318788
445 Ga0395901_1080578
446 Ga0439448_0221092
447 Ga0439463_053263
448 Ga0439460_0082971
449 Ga0495584_0306343
450 Ga0495584_0658589
451 Ga0495596_0310357
452 Ga0495668_0213779
453 Ga0495669_0264078
454 Ga0495589_0050459
455 Ga0495672_0068903
456 Ga0501031_0064547
457 Ga0501031_0454047
458 Ga0501036_0077270
459 Ga0501036_0999499
460 Ga0501036_1430579
461 Ga0501038_0248550
462 Ga0501038_0256614
463 Ga0501039_1290579
464 Ga0501040_0027457
465 Ga0501041_0335476
466 Ga0501041_0457991
467 Ga0501042_0012001
468 Ga0501042_0567198
469 Ga0501042_1075627
470 Ga0501043_0369911
471 Ga0501046_0825553
472 Ga0501048_0133876
473 Ga0501048_0235816
474 Ga0501048_0849789
475 Ga0501048_0923610
476 Ga0501067_0462527
477 Ga0501068_0587957
478 Ga0501069_0668463
479 Ga0501071_0081565
480 Ga0501071_1228104
481 Ga0501072_0027826
482 Ga0501072_0046036
483 Ga0501072_0675618
484 Ga0501075_0124774
485 Ga0501075_0203281
486 Ga0501075_0794782
487 Ga0501076_0058291
488 Ga0501076_0084553
489 Ga0501076_0236344
490 Ga0501077_0134974
491 Ga0501077_0793808
492 Ga0501079_0216798
493 Ga0501079_0373434
494 Ga0501079_0499710
495 Ga0501081_0039077
496 Ga0501081_1132862
497 Ga0501083_0509003
498 Ga0501035_0270701
499 Ga0501044_0470449
500 Ga0501045_0189536
501 Ga0501045_0242746
502 Ga0501045_0289954
503 Ga0501045_0923423
504 nmdc:mga0yw44_543504_c1
505 nmdc:mga05p37_153443_c1
506 nmdc:mga05p37_1582966_c1
507 nmdc:mga05p37_526736_c1
508 nmdc:mga05p37_53276_c1
509 nmdc:mga05p37_667986_c1
510 nmdc:mga09592_396515_c1
511 nmdc:mga09592_492746_c1
512 nmdc:mga0qj67_24709_c1
513 nmdc:mga06r32_2077039_c1
514 nmdc:mga06r32_357905_c1
515 nmdc:mga08y16_10225_c1
516 nmdc:mga08y16_163322_c1
517 nmdc:mga08y16_2114081_c1
518 nmdc:mga08y16_454805_c1
519 nmdc:mga08y16_874788_c1
520 nmdc:mga0n895_1063282_c1
521 nmdc:mga0n895_520855_c1
522 nmdc:mga0a205_42933_c1
523 Ga0501084_0383522
524 Ga0501084_1146555
525 Ga0501084_1880418
526 Ga0501082_0205766
527 Ga0530510_0032757
528 Ga0530510_0184421

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map