F372556

General Info

Members Datasets Scaffolds Average Seq Length
264 189 528 297

Family's Representative Sequence

Representative Sequence 3300006880|Ga0075429_100430506|Ga0075429_1004305061
Length 312
Sequence MAKEILCAYGIDVDAVAGWLGSYGGENSPDDISRGMFAGEVGTPRLLELFHHYEIRTTWFIPGHSIETFPKQTKLVVDAGHEIGIHGYSHENPIAMTREQEEAVLVKCIDLVKKVAGRRPTGYVAPWWEFSPVTNELLLKHGIKYDHSLMHDDFHPYYVRVGDSWTKIDYGAKSASAWMKPLRRGKVTPLIEIPASWYLDDLPPMMFIKASPNSHGFVNPRQLEQLWIDQFDWVYREYDYAVFGMTIHPDVSGKPQVLLMHERIIEHINKHAGVRWATFDEIANDFRKRNPRPSAAVKKPRDARGKGAAFWA

Samples

Sample ID Description Type Environment
1 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
27 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
28 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
55 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
56 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
70 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
72 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
73 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
74 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
75 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
76 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
77 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
78 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
79 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
80 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
81 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
82 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
83 3300036535 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU6 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
84 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
85 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
86 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
87 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
88 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
89 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
90 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
91 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
92 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
93 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
94 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
95 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
96 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
97 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
98 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
99 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
100 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
101 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
102 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
103 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
104 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
105 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
106 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
107 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
108 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
109 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
110 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
111 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
112 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
113 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
114 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
115 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
116 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
117 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
118 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
119 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
120 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
121 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
122 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
123 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
124 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
125 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
126 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
127 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
128 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
129 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
130 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
131 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
132 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
133 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
134 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
135 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
136 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
137 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
152 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
153 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
154 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
155 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
156 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
157 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
158 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
159 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
160 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
161 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
162 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
163 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
165 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
166 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
167 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
168 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
169 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
170 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
171 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
172 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
173 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
174 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
175 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
176 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
177 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
178 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
179 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
180 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
181 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
182 2643221679 Angustibacter sp. Root456 Isolate Unclassified
183 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
184 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
185 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
186 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
187 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
188 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
189 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.45
Metatranscriptomes 1.14
Isolates 3.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.17
Nodule 0.38
Rhizoplane 6.82
Rhizosphere 83.71
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075429_100430506 3300006880 Bacteria 1156
2 rootH1_10028958 3300003323 Bacteria 5865
3 Ga0058863_11571186 3300004799 Bacteria 1294
4 Ga0070676_10075722 3300005328 Bacteria 2030
5 Ga0070683_100007023 3300005329 Bacteria 9478
6 Ga0070682_100011144 3300005337 Bacteria 5131
7 Ga0068868_100203972 3300005338 Bacteria 1650
8 Ga0070660_100159395 3300005339 Bacteria 1817
9 Ga0070667_100091728 3300005367 Bacteria 2612
10 Ga0070709_10105239 3300005434 Bacteria 1887
11 Ga0070711_100122077 3300005439 Bacteria 1929
12 Ga0070711_100393727 3300005439 Bacteria 1123
13 Ga0070708_100403758 3300005445 Bacteria 1288
14 Ga0070678_100220215 3300005456 Bacteria 1577
15 Ga0070662_100072683 3300005457 Bacteria 2540
16 Ga0070681_10004017 3300005458 Bacteria 13877
17 Ga0070706_100077550 3300005467 Bacteria 3075
18 Ga0070698_100000327 3300005471 Bacteria 48760
19 Ga0070698_100004797 3300005471 Bacteria 14845
20 Ga0070698_100007423 3300005471 Bacteria 11863
21 Ga0070699_100004541 3300005518 Bacteria 12285
22 Ga0070699_100466679 3300005518 Bacteria 1145
23 Ga0070679_100002660 3300005530 Bacteria 16263
24 Ga0070679_100058926 3300005530 Bacteria 3827
25 Ga0070679_100088875 3300005530 Bacteria 3076
26 Ga0070679_100344084 3300005530 Bacteria 1439
27 Ga0070679_100348897 3300005530 Bacteria 1428
28 Ga0070684_100003257 3300005535 Bacteria 12159
29 Ga0070693_100011879 3300005547 Bacteria 4394
30 Ga0070665_100119537 3300005548 Bacteria 2637
31 Ga0068856_100092693 3300005614 Bacteria 3006
32 Ga0070702_100051829 3300005615 Bacteria 2351
33 Ga0081455_10006412 3300005937 Bacteria 12616
34 Ga0081455_10029581 3300005937 Bacteria 4992
35 Ga0081455_10112254 3300005937 Bacteria 2164
36 Ga0081538_10031523 3300005981 Bacteria 3573
37 Ga0081538_10101727 3300005981 Bacteria 1445
38 Ga0081540_1023310 3300005983 Bacteria 3622
39 Ga0081539_10000200 3300005985 Bacteria 139291
40 Ga0081539_10047836 3300005985 Bacteria 2438
41 Ga0070717_10144651 3300006028 Bacteria 2053
42 Ga0070717_10257366 3300006028 Bacteria 1544
43 Ga0075365_10048725 3300006038 Bacteria 2790
44 Ga0075365_10155073 3300006038 Bacteria 1594
45 Ga0075365_10390704 3300006038 Bacteria 981
46 Ga0075369_10073895 3300006186 Bacteria 1504
47 Ga0097621_100479061 3300006237 Bacteria 1125
48 Ga0075428_100070420 3300006844 Bacteria 3823
49 Ga0075428_100129409 3300006844 Bacteria 2747
50 Ga0075431_100201157 3300006847 Bacteria 2038
51 Ga0075433_10061867 3300006852 Bacteria 3279
52 Ga0075434_100459164 3300006871 Bacteria 1295
53 Ga0111539_10002558 3300009094 Bacteria 24079
54 Ga0111539_10279959 3300009094 Bacteria 1941
55 Ga0111539_10514778 3300009094 Bacteria 1394
56 Ga0105245_10048902 3300009098 Bacteria 3784
57 Ga0114129_10055535 3300009147 Bacteria 5549
58 Ga0105243_10287380 3300009148 Bacteria 1484
59 Ga0105243_10348860 3300009148 Bacteria 1358
60 Ga0105241_10172671 3300009174 Bacteria 1787
61 Ga0105237_10002611 3300009545 Bacteria 22183
62 Ga0105238_10003569 3300009551 Bacteria 15509
63 Ga0105239_10006876 3300010375 Bacteria 13127
64 Ga0105239_10449417 3300010375 Bacteria 1462
65 Ga0157370_10379172 3300013104 Bacteria 1303
66 Ga0157369_10458350 3300013105 Bacteria 1320
67 Ga0157374_10265057 3300013296 Bacteria 1693
68 Ga0157374_10303890 3300013296 Bacteria 1579
69 Ga0157378_10555359 3300013297 Bacteria 1154
70 Ga0157375_10041927 3300013308 Bacteria 4425
71 Ga0163163_10325467 3300014325 Bacteria 1591
72 Ga0157377_10073609 3300014745 Bacteria 1980
73 Ga0157377_10296181 3300014745 Bacteria 1066
74 Ga0157376_10318714 3300014969 Bacteria 1477
75 Ga0206351_10461549 3300020077 Bacteria 1298
76 Ga0213876_10002817 3300021384 Bacteria 10116
77 Ga0228598_1019390 3300024227 Bacteria 1340
78 Ga0207645_10033731 3300025907 Bacteria 3289
79 Ga0207684_10022884 3300025910 Bacteria 5336
80 Ga0207707_10047411 3300025912 Bacteria 3742
81 Ga0207671_10040406 3300025914 Bacteria 3453
82 Ga0207657_10030677 3300025919 Bacteria 4877
83 Ga0207657_10129181 3300025919 Bacteria 2072
84 Ga0207652_10001566 3300025921 Bacteria 20128
85 Ga0207652_10069468 3300025921 Bacteria 3058
86 Ga0207652_10078887 3300025921 Bacteria 2876
87 Ga0207652_10101157 3300025921 Bacteria 2546
88 Ga0207652_10192413 3300025921 Bacteria 1835
89 Ga0207694_10018592 3300025924 Bacteria 5252
90 Ga0207687_10017151 3300025927 Bacteria 4761
91 Ga0207706_10001474 3300025933 Bacteria 23502
92 Ga0207706_10140885 3300025933 Bacteria 2121
93 Ga0207661_10005272 3300025944 Bacteria 9099
94 Ga0207668_10152156 3300025972 Bacteria 1792
95 Ga0207702_10088802 3300026078 Bacteria 2702
96 Ga0207702_10256704 3300026078 Bacteria 1644
97 Ga0207683_10220696 3300026121 Bacteria 1727
98 Ga0207683_10652805 3300026121 Bacteria 975
99 Ga0207428_10001417 3300027907 Bacteria 25243
100 Ga0207428_10334621 3300027907 Bacteria 1116
101 Ga0268266_10097845 3300028379 Bacteria 2581
102 Ga0268266_10245833 3300028379 Bacteria 1653
103 Ga0307410_10006957 3300031852 Bacteria 6153
104 Ga0307406_10146524 3300031901 Bacteria 1679
105 Ga0307406_10203675 3300031901 Bacteria 1459
106 Ga0307407_10212297 3300031903 Bacteria 1304
107 Ga0307409_100253506 3300031995 Bacteria 1610
108 Ga0373923_0018025 3300035111 Bacteria 2710
109 Ga0373956_0114080 3300035119 Bacteria 1259
110 Ga0373960_0019846 3300035121 Bacteria 1771
111 Ga0373943_0180873 3300035170 Bacteria 1159
112 Ga0373946_0049172 3300035171 Bacteria 1758
113 Ga0373935_0047976 3300035692 Bacteria 2702
114 Ga0373947_0023919 3300035725 Bacteria 3557
115 Ga0373947_0208819 3300035725 Bacteria 1280
116 Ga0373937_0275345 3300036401 Bacteria 1589
117 Ga0310110_015248 3300036535 Eukaryota 1101
118 Ga0373925_0010946 3300037068 Bacteria 6583
119 Ga0395900_0020518 3300037418 Bacteria 6747
120 Ga0395900_0423427 3300037418 Bacteria 1292
121 Ga0395905_0489627 3300037471 Bacteria 1129
122 Ga0436364_0285135 3300037853 Bacteria 11529
123 Ga0395901_0206434 3300038443 Bacteria 2058
124 Ga0395901_0266120 3300038443 Bacteria 1784
125 Ga0436365_0172815 3300039437 Bacteria 22318
126 Ga0436360_0436680 3300039438 Bacteria 1315
127 Ga0436362_0083380 3300039453 Bacteria 1137
128 Ga0439439_0011580 3300041406 Bacteria 2125
129 Ga0466966_0143711 3300044684 Bacteria 1457
130 Ga0466966_0194774 3300044684 Bacteria 1227
131 Ga0466961_0126249 3300044693 Bacteria 1605
132 Ga0466963_0008404 3300044694 Bacteria 6185
133 Ga0466963_0280387 3300044694 Bacteria 1171
134 Ga0466970_0060287 3300044765 Bacteria 2032
135 Ga0466970_0075032 3300044765 Bacteria 1821
136 Ga0466957_0001691 3300044842 Bacteria 11595
137 Ga0466957_0037764 3300044842 Bacteria 2908
138 Ga0466960_0038931 3300044901 Bacteria 2239
139 Ga0466959_0021899 3300045049 Bacteria 4720
140 Ga0466959_0107070 3300045049 Bacteria 1998
141 Ga0466958_0002235 3300045836 Bacteria 9645
142 Ga0495592_0259155 3300046454 Bacteria 1146
143 Ga0495638_0077774 3300046460 Bacteria 2019
144 Ga0495651_0206970 3300046462 Bacteria 1368
145 Ga0495653_0074976 3300046463 Bacteria 2519
146 Ga0495664_0024665 3300046477 Bacteria 3497
147 Ga0495585_0050765 3300046492 Bacteria 2300
148 Ga0495607_0052734 3300046501 Bacteria 2354
149 Ga0495666_0180264 3300046526 Bacteria 976
150 Ga0495587_0009688 3300046536 Bacteria 6161
151 Ga0495645_0027823 3300046543 Bacteria 4108
152 Ga0495667_0094834 3300046559 Bacteria 1932
153 Ga0495668_0095764 3300046616 Bacteria 1625
154 Ga0495668_0151114 3300046616 Bacteria 1272
155 Ga0495611_0011291 3300046648 Bacteria 3787
156 Ga0495635_0052619 3300046663 Bacteria 2805
157 Ga0495613_0228322 3300046689 Bacteria 1305
158 Ga0495589_0005270 3300046794 Bacteria 6835
159 Ga0495589_0017462 3300046794 Bacteria 3682
160 Ga0495674_0043943 3300047319 Bacteria 3973
161 Ga0495674_0382030 3300047319 Bacteria 1139
162 Ga0495680_0040888 3300047322 Bacteria 3690
163 Ga0495675_0032270 3300047444 Bacteria 3341
164 Ga0495685_000921 3300047447 Bacteria 8925
165 Ga0495684_0241490 3300047471 Bacteria 1317
166 Ga0495593_0105083 3300047673 Bacteria 1446
167 Ga0495602_0013132 3300048088 Bacteria 8472
168 Ga0495602_0260267 3300048088 Bacteria 1287
169 Ga0496101_0001367 3300048904 Bacteria 14609
170 Ga0496102_0275231 3300048905 Bacteria 1587
171 Ga0496103_0038274 3300048906 Bacteria 2942
172 Ga0496104_0002716 3300048907 Bacteria 15230
173 Ga0496104_0053077 3300048907 Bacteria 3829
174 Ga0496105_0000277 3300048908 Bacteria 33919
175 Ga0496107_0093919 3300048910 Bacteria 2194
176 Ga0496108_0021254 3300048911 Bacteria 5333
177 Ga0496109_0165403 3300048912 Bacteria 2073
178 Ga0496110_0000245 3300048913 Bacteria 35097
179 Ga0496110_0084644 3300048913 Bacteria 2830
180 Ga0496111_0000392 3300048914 Bacteria 21948
181 Ga0496111_0007724 3300048914 Bacteria 7073
182 Ga0496111_0013842 3300048914 Bacteria 5501
183 Ga0496113_0033227 3300048916 Bacteria 3755
184 Ga0496114_0003701 3300048917 Bacteria 11768
185 Ga0496114_0004773 3300048917 Bacteria 10550
186 Ga0496114_0091732 3300048917 Bacteria 2580
187 Ga0496125_0212431 3300048928 Bacteria 1255
188 Ga0501031_0082016 3300049568 Bacteria 2102
189 Ga0501032_0066786 3300049569 Bacteria 2403
190 Ga0501033_0113386 3300049570 Bacteria 1971
191 Ga0501034_0016083 3300049571 Bacteria 7676
192 Ga0501036_0252169 3300049572 Bacteria 1479
193 Ga0501037_0059985 3300049573 Bacteria 2774
194 Ga0501038_0028163 3300049574 Bacteria 4991
195 Ga0501038_0208948 3300049574 Bacteria 1563
196 Ga0501039_0183647 3300049575 Bacteria 1644
197 Ga0501039_0330976 3300049575 Bacteria 1197
198 Ga0501040_0055754 3300049576 Bacteria 2711
199 Ga0501041_0010314 3300049577 Bacteria 5505
200 Ga0501041_0016597 3300049577 Bacteria 4380
201 Ga0501042_0031383 3300049578 Bacteria 3757
202 Ga0501043_0034618 3300049579 Bacteria 3972
203 Ga0501046_0028914 3300049580 Bacteria 4510
204 Ga0501046_0069599 3300049580 Bacteria 2738
205 Ga0501048_0101712 3300049582 Bacteria 2027
206 Ga0501068_0008030 3300049584 Bacteria 5852
207 Ga0501069_0008824 3300049585 Bacteria 5312
208 Ga0501070_0057279 3300049586 Bacteria 3230
209 Ga0501071_0012642 3300049587 Bacteria 5734
210 Ga0501072_0041269 3300049588 Bacteria 3624
211 Ga0501072_0077387 3300049588 Bacteria 2633
212 Ga0501072_0316124 3300049588 Bacteria 1241
213 Ga0501073_0071848 3300049589 Bacteria 2410
214 Ga0501074_0226887 3300049590 Bacteria 1330
215 Ga0501077_0012210 3300049593 Bacteria 5377
216 Ga0501079_0346523 3300049741 Bacteria 1164
217 Ga0501080_0005826 3300049742 Bacteria 11032
218 Ga0501081_0002092 3300049743 Bacteria 12463
219 Ga0501081_0013845 3300049743 Bacteria 5308
220 Ga0501081_0135803 3300049743 Bacteria 1760
221 Ga0501083_0054423 3300049744 Bacteria 2685
222 Ga0501035_0077076 3300049822 Bacteria 2946
223 Ga0501045_0017506 3300049824 Bacteria 5088
224 Ga0501045_0031389 3300049824 Bacteria 3847
225 Ga0501045_0035281 3300049824 Bacteria 3631
226 nmdc:mga0yw44_135552_c1 3300050492 Bacteria 1597
227 nmdc:mga0yw44_38533_c1 3300050492 Bacteria 2829
228 nmdc:mga05p37_183042_c1 3300050507 Bacteria 2548
229 nmdc:mga05p37_411508_c1 3300050507 Bacteria 1576
230 nmdc:mga09592_90368_c1 3300050508 Bacteria 2616
231 nmdc:mga0qj67_51349_c1 3300050509 Bacteria 3260
232 nmdc:mga0qj67_72336_c1 3300050509 Bacteria 2753
233 nmdc:mga06r32_222137_c1 3300050510 Bacteria 1877
234 nmdc:mga06r32_456774_c1 3300050510 Bacteria 1257
235 nmdc:mga08y16_1703_c1 3300050511 Bacteria 22297
236 nmdc:mga08y16_333002_c1 3300050511 Bacteria 1561
237 nmdc:mga08y16_40326_c1 3300050511 Bacteria 4895
238 nmdc:mga0a205_108917_c1 3300050515 Bacteria 2668
239 nmdc:mga0a205_389498_c1 3300050515 Bacteria 1258
240 nmdc:mga0a205_79260_c1 3300050515 Bacteria 3173
241 Ga0495612_0007236 3300053078 Bacteria 4541
242 Ga0500618_008153 3300053125 Bacteria 2944
243 Ga0500568_0000017 3300053139 Bacteria 197578
244 Ga0500573_0005865 3300053140 Bacteria 6603
245 Ga0500573_0012568 3300053140 Bacteria 4756
246 Ga0500611_030742 3300053727 Bacteria 1110
247 Ga0501084_0057995 3300054114 Bacteria 3240
248 Ga0501084_0175915 3300054114 Bacteria 1806
249 Ga0501082_0076108 3300060353 Bacteria 2892
250 Ga0501082_0117622 3300060353 Bacteria 2302
251 Ga0501082_0228198 3300060353 Bacteria 1621
252 Ga0466962_0245917 3300061719 Bacteria 878
253 Ga0530510_0011333 3300061734 Bacteria 6257
254 Ga0530510_0012377 3300061734 Bacteria 5993
255 Ga0530510_0176047 3300061734 Bacteria 1585
256 2558907851 2558860112 Bacteria 9931328
257 2644445639 2643221679 Bacteria 3839507
258 2676492844 2675903060 Bacteria 10051191
259 2854682680 2854681122 Bacteria 4548679
260 2876378172 2876377896 Bacteria 6565995
261 2891558981 2891554331 Bacteria 8812224
262 2919683145 2919679072 Bacteria 4629602
263 2996338620 2996336353 Bacteria 5511628
264 3006428818 3006425503 Bacteria 6491253
265 Ga0075429_100430506
266 rootH1_10028958
267 Ga0058863_11571186
268 Ga0070676_10075722
269 Ga0070683_100007023
270 Ga0070682_100011144
271 Ga0068868_100203972
272 Ga0070660_100159395
273 Ga0070667_100091728
274 Ga0070709_10105239
275 Ga0070711_100122077
276 Ga0070711_100393727
277 Ga0070708_100403758
278 Ga0070678_100220215
279 Ga0070662_100072683
280 Ga0070681_10004017
281 Ga0070706_100077550
282 Ga0070698_100000327
283 Ga0070698_100004797
284 Ga0070698_100007423
285 Ga0070699_100004541
286 Ga0070699_100466679
287 Ga0070679_100002660
288 Ga0070679_100058926
289 Ga0070679_100088875
290 Ga0070679_100344084
291 Ga0070679_100348897
292 Ga0070684_100003257
293 Ga0070693_100011879
294 Ga0070665_100119537
295 Ga0068856_100092693
296 Ga0070702_100051829
297 Ga0081455_10006412
298 Ga0081455_10029581
299 Ga0081455_10112254
300 Ga0081538_10031523
301 Ga0081538_10101727
302 Ga0081540_1023310
303 Ga0081539_10000200
304 Ga0081539_10047836
305 Ga0070717_10144651
306 Ga0070717_10257366
307 Ga0075365_10048725
308 Ga0075365_10155073
309 Ga0075365_10390704
310 Ga0075369_10073895
311 Ga0097621_100479061
312 Ga0075428_100070420
313 Ga0075428_100129409
314 Ga0075431_100201157
315 Ga0075433_10061867
316 Ga0075434_100459164
317 Ga0111539_10002558
318 Ga0111539_10279959
319 Ga0111539_10514778
320 Ga0105245_10048902
321 Ga0114129_10055535
322 Ga0105243_10287380
323 Ga0105243_10348860
324 Ga0105241_10172671
325 Ga0105237_10002611
326 Ga0105238_10003569
327 Ga0105239_10006876
328 Ga0105239_10449417
329 Ga0157370_10379172
330 Ga0157369_10458350
331 Ga0157374_10265057
332 Ga0157374_10303890
333 Ga0157378_10555359
334 Ga0157375_10041927
335 Ga0163163_10325467
336 Ga0157377_10073609
337 Ga0157377_10296181
338 Ga0157376_10318714
339 Ga0206351_10461549
340 Ga0213876_10002817
341 Ga0228598_1019390
342 Ga0207645_10033731
343 Ga0207684_10022884
344 Ga0207707_10047411
345 Ga0207671_10040406
346 Ga0207657_10030677
347 Ga0207657_10129181
348 Ga0207652_10001566
349 Ga0207652_10069468
350 Ga0207652_10078887
351 Ga0207652_10101157
352 Ga0207652_10192413
353 Ga0207694_10018592
354 Ga0207687_10017151
355 Ga0207706_10001474
356 Ga0207706_10140885
357 Ga0207661_10005272
358 Ga0207668_10152156
359 Ga0207702_10088802
360 Ga0207702_10256704
361 Ga0207683_10220696
362 Ga0207683_10652805
363 Ga0207428_10001417
364 Ga0207428_10334621
365 Ga0268266_10097845
366 Ga0268266_10245833
367 Ga0307410_10006957
368 Ga0307406_10146524
369 Ga0307406_10203675
370 Ga0307407_10212297
371 Ga0307409_100253506
372 Ga0373923_0018025
373 Ga0373956_0114080
374 Ga0373960_0019846
375 Ga0373943_0180873
376 Ga0373946_0049172
377 Ga0373935_0047976
378 Ga0373947_0023919
379 Ga0373947_0208819
380 Ga0373937_0275345
381 Ga0310110_015248
382 Ga0373925_0010946
383 Ga0395900_0020518
384 Ga0395900_0423427
385 Ga0395905_0489627
386 Ga0436364_0285135
387 Ga0395901_0206434
388 Ga0395901_0266120
389 Ga0436365_0172815
390 Ga0436360_0436680
391 Ga0436362_0083380
392 Ga0439439_0011580
393 Ga0466966_0143711
394 Ga0466966_0194774
395 Ga0466961_0126249
396 Ga0466963_0008404
397 Ga0466963_0280387
398 Ga0466970_0060287
399 Ga0466970_0075032
400 Ga0466957_0001691
401 Ga0466957_0037764
402 Ga0466960_0038931
403 Ga0466959_0021899
404 Ga0466959_0107070
405 Ga0466958_0002235
406 Ga0495592_0259155
407 Ga0495638_0077774
408 Ga0495651_0206970
409 Ga0495653_0074976
410 Ga0495664_0024665
411 Ga0495585_0050765
412 Ga0495607_0052734
413 Ga0495666_0180264
414 Ga0495587_0009688
415 Ga0495645_0027823
416 Ga0495667_0094834
417 Ga0495668_0095764
418 Ga0495668_0151114
419 Ga0495611_0011291
420 Ga0495635_0052619
421 Ga0495613_0228322
422 Ga0495589_0005270
423 Ga0495589_0017462
424 Ga0495674_0043943
425 Ga0495674_0382030
426 Ga0495680_0040888
427 Ga0495675_0032270
428 Ga0495685_000921
429 Ga0495684_0241490
430 Ga0495593_0105083
431 Ga0495602_0013132
432 Ga0495602_0260267
433 Ga0496101_0001367
434 Ga0496102_0275231
435 Ga0496103_0038274
436 Ga0496104_0002716
437 Ga0496104_0053077
438 Ga0496105_0000277
439 Ga0496107_0093919
440 Ga0496108_0021254
441 Ga0496109_0165403
442 Ga0496110_0000245
443 Ga0496110_0084644
444 Ga0496111_0000392
445 Ga0496111_0007724
446 Ga0496111_0013842
447 Ga0496113_0033227
448 Ga0496114_0003701
449 Ga0496114_0004773
450 Ga0496114_0091732
451 Ga0496125_0212431
452 Ga0501031_0082016
453 Ga0501032_0066786
454 Ga0501033_0113386
455 Ga0501034_0016083
456 Ga0501036_0252169
457 Ga0501037_0059985
458 Ga0501038_0028163
459 Ga0501038_0208948
460 Ga0501039_0183647
461 Ga0501039_0330976
462 Ga0501040_0055754
463 Ga0501041_0010314
464 Ga0501041_0016597
465 Ga0501042_0031383
466 Ga0501043_0034618
467 Ga0501046_0028914
468 Ga0501046_0069599
469 Ga0501048_0101712
470 Ga0501068_0008030
471 Ga0501069_0008824
472 Ga0501070_0057279
473 Ga0501071_0012642
474 Ga0501072_0041269
475 Ga0501072_0077387
476 Ga0501072_0316124
477 Ga0501073_0071848
478 Ga0501074_0226887
479 Ga0501077_0012210
480 Ga0501079_0346523
481 Ga0501080_0005826
482 Ga0501081_0002092
483 Ga0501081_0013845
484 Ga0501081_0135803
485 Ga0501083_0054423
486 Ga0501035_0077076
487 Ga0501045_0017506
488 Ga0501045_0031389
489 Ga0501045_0035281
490 nmdc:mga0yw44_135552_c1
491 nmdc:mga0yw44_38533_c1
492 nmdc:mga05p37_183042_c1
493 nmdc:mga05p37_411508_c1
494 nmdc:mga09592_90368_c1
495 nmdc:mga0qj67_51349_c1
496 nmdc:mga0qj67_72336_c1
497 nmdc:mga06r32_222137_c1
498 nmdc:mga06r32_456774_c1
499 nmdc:mga08y16_1703_c1
500 nmdc:mga08y16_333002_c1
501 nmdc:mga08y16_40326_c1
502 nmdc:mga0a205_108917_c1
503 nmdc:mga0a205_389498_c1
504 nmdc:mga0a205_79260_c1
505 Ga0495612_0007236
506 Ga0500618_008153
507 Ga0500568_0000017
508 Ga0500573_0005865
509 Ga0500573_0012568
510 Ga0500611_030742
511 Ga0501084_0057995
512 Ga0501084_0175915
513 Ga0501082_0076108
514 Ga0501082_0117622
515 Ga0501082_0228198
516 Ga0466962_0245917
517 Ga0530510_0011333
518 Ga0530510_0012377
519 Ga0530510_0176047
520 2558907851
521 2644445639
522 2676492844
523 2854682680
524 2876378172
525 2891558981
526 2919683145
527 2996338620
528 3006428818

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01522

Polysacc_deac_1

Polysaccharide deacetylase

30

145

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qbu-assembly1.cif.gz_C crystal structure of putative peptidoglycan deactelyase (hp0310) from helicobacter pylori 0.9692 2 290
3qbu-assembly1.cif.gz_C crystal structure of putative peptidoglycan deactelyase (hp0310) from helicobacter pylori 0.9627 2 290
3rxz-assembly1.cif.gz_B crystal structure of putative polysaccharide deacetylase from mycobacterium smegmatis 0.8681 1 298
6go1-assembly2.cif.gz_B crystal structure of a bacillus anthracis peptidoglycan deacetylase 0.8522 55 151
6hm9-assembly1.cif.gz_A crystal structure of a ba3943 mutant,a ce4 family pseudoenzyme with restored enzymatic activity. 0.8457 2 284
ID Description Score Start End Superfamily
3qbuB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.9693 2 290 3.20.20.370
3qbuB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.9628 2 290 3.20.20.370
3rxzD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.8523 3 298 3.20.20.370
4f9dB01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.8309 43 150 3.20.20.370
1z7aC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.8234 3 291 3.20.20.370
ID Description Score Start End GO Terms
AF-A0A4Y9ZK59-F1-model_v4 NodB homology domain-containing protein 0.9788 37 253 GO:0004099
GO:0005886
GO:0005975
GO:0071555
GO:0098552
AF-A0A6N8RX61-F1-model_v4 deleted 0.9762 1 290
AF-M3D3Q5-F1-model_v4 Arp2/3 complex subunit Arc16 0.9751 1 288 GO:0005975
GO:0016810
AF-A0A1V6QWH7-F1-model_v4 NodB homology domain-containing protein 0.9751 96 290 GO:0005975
AF-A0A2N5KUB9-F1-model_v4 Polysaccharide deacetylase 0.975 2 294 GO:0005975
GO:0016810

Map