F372402

General Info

Members Datasets Scaffolds Average Seq Length
264 157 528 189

Family's Representative Sequence

Representative Sequence 3300005353|Ga0070669_100504449|Ga0070669_1005044492
Length 214
Sequence LDSYKFVLNAGSIFNHPVTLSLHMPTNILLIKNMVCRRCVLAVEDILHDVEIPFTKVLFGEIHLSNQLSERQKELLKGKLAFIGFELIDNHLSGLVEKIKAYVIKRARNDVDEKENKITLSNYLSGKLHHEYTYLSSLFSSVEGRTIENFFIEQRIEKAKELLIYGQMTLSEIAYQLDYSSVAHLSAQFKKITGLTPSYFKEVGATMRKPLDSI

Samples

Sample ID Description Type Environment
1 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
124 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
125 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
126 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
127 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
128 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
129 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
130 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
131 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
132 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
133 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
134 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
135 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
136 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
137 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
138 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
139 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
140 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
141 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
142 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
143 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
144 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
145 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
146 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
147 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
148 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
149 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
150 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
151 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
152 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
153 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
154 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
155 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
156 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
157 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.38
Nodule 0
Rhizoplane 0.38
Rhizosphere 98.11
Stem 0
Stem Tuber 0
Unclassified 33.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070669_100504449 3300005353 Bacteria 1004
2 rootH1_10198497 3300003316 Bacteria 1219
3 rootL2_10386878 3300003322 Unclassified 1114
4 Ga0065714_10079256 3300005288 Bacteria 2530
5 Ga0065712_10097352 3300005290 Bacteria 2153
6 Ga0065715_10101256 3300005293 Bacteria 3224
7 Ga0065707_10120442 3300005295 Bacteria 2134
8 Ga0070676_10058654 3300005328 Unclassified 2281
9 Ga0070670_100070161 3300005331 Unclassified 3009
10 Ga0070670_100155042 3300005331 Bacteria 1983
11 Ga0070670_100271503 3300005331 Unclassified 1480
12 Ga0070670_100527663 3300005331 Bacteria 1052
13 Ga0068869_100106480 3300005334 Bacteria 2128
14 Ga0068869_100203801 3300005334 Bacteria 1561
15 Ga0068869_100277519 3300005334 Unclassified 1347
16 Ga0070666_10066386 3300005335 Unclassified 2448
17 Ga0070666_10141719 3300005335 Unclassified 1674
18 Ga0070680_100000512 3300005336 Bacteria 26640
19 Ga0070682_100001864 3300005337 Bacteria 11760
20 Ga0070682_100099522 3300005337 Bacteria 1917
21 Ga0068868_100137209 3300005338 Unclassified 2005
22 Ga0068868_100508359 3300005338 Bacteria 1056
23 Ga0068868_100663996 3300005338 Bacteria 929
24 Ga0070689_100029295 3300005340 Unclassified 4166
25 Ga0070691_10002070 3300005341 Bacteria 8858
26 Ga0070687_100265180 3300005343 Bacteria 1074
27 Ga0070668_100011119 3300005347 Bacteria 6701
28 Ga0070668_100139950 3300005347 Unclassified 1949
29 Ga0070669_100003436 3300005353 Bacteria 11408
30 Ga0070669_100089754 3300005353 Unclassified 2303
31 Ga0070675_100029497 3300005354 Bacteria 4425
32 Ga0070675_100211547 3300005354 Unclassified 1685
33 Ga0070674_100028707 3300005356 Bacteria 3655
34 Ga0070674_100114747 3300005356 Unclassified 1984
35 Ga0070673_100042621 3300005364 Bacteria 3500
36 Ga0070673_100097665 3300005364 Unclassified 2412
37 Ga0070673_100766455 3300005364 Bacteria 889
38 Ga0070688_100010207 3300005365 Bacteria 5170
39 Ga0070659_100036041 3300005366 Bacteria 3855
40 Ga0070659_100710959 3300005366 Bacteria 869
41 Ga0070659_100951508 3300005366 Unclassified 752
42 Ga0070667_100064918 3300005367 Unclassified 3098
43 Ga0070701_10018823 3300005438 Bacteria 3252
44 Ga0070700_100062465 3300005441 Bacteria 2353
45 Ga0070663_100387876 3300005455 Unclassified 1139
46 Ga0070663_100643356 3300005455 Bacteria 896
47 Ga0070678_100091460 3300005456 Unclassified 2335
48 Ga0070678_100093831 3300005456 Bacteria 2309
49 Ga0070678_100163246 3300005456 Bacteria 1807
50 Ga0070662_100191480 3300005457 Unclassified 1618
51 Ga0070681_10260422 3300005458 Bacteria 1646
52 Ga0070681_10616220 3300005458 Bacteria 1000
53 Ga0068867_100147991 3300005459 Bacteria 1842
54 Ga0068867_100191096 3300005459 Bacteria 1634
55 Ga0068867_100934377 3300005459 Bacteria 782
56 Ga0068867_101315922 3300005459 Unclassified 667
57 Ga0070685_10123894 3300005466 Unclassified 1608
58 Ga0070679_100006662 3300005530 Bacteria 10771
59 Ga0070679_100045876 3300005530 Bacteria 4354
60 Ga0070684_100052236 3300005535 Bacteria 3554
61 Ga0068853_100011868 3300005539 Bacteria 7085
62 Ga0070672_100081700 3300005543 Unclassified 2591
63 Ga0070672_100306181 3300005543 Bacteria 1348
64 Ga0070665_100176798 3300005548 Unclassified 2135
65 Ga0070665_100675761 3300005548 Unclassified 1046
66 Ga0070704_100445719 3300005549 Bacteria 1114
67 Ga0068855_100088229 3300005563 Bacteria 3583
68 Ga0068855_100107918 3300005563 Bacteria 3198
69 Ga0070664_100337045 3300005564 Unclassified 1369
70 Ga0068854_100876108 3300005578 Unclassified 788
71 Ga0068856_100345896 3300005614 Bacteria 1505
72 Ga0068856_101814997 3300005614 Unclassified 621
73 Ga0070702_100707766 3300005615 Bacteria 768
74 Ga0068852_100088219 3300005616 Bacteria 2770
75 Ga0068852_100395581 3300005616 Bacteria 1358
76 Ga0068852_100592407 3300005616 Bacteria 1112
77 Ga0068859_100166335 3300005617 Bacteria 2285
78 Ga0068859_100579294 3300005617 Bacteria 1216
79 Ga0068866_10037722 3300005718 Unclassified 2375
80 Ga0068866_10428008 3300005718 Bacteria 860
81 Ga0068861_100038358 3300005719 Bacteria 3566
82 Ga0068870_10036619 3300005840 Unclassified 2525
83 Ga0068870_10054497 3300005840 Unclassified 2127
84 Ga0068870_10469710 3300005840 Unclassified 833
85 Ga0068863_100530280 3300005841 Bacteria 1161
86 Ga0068863_100685503 3300005841 Bacteria 1018
87 Ga0068860_100003740 3300005843 Bacteria 15659
88 Ga0068860_100095825 3300005843 Unclassified 2828
89 Ga0068860_100561372 3300005843 Bacteria 1144
90 Ga0068860_101820927 3300005843 Bacteria 630
91 Ga0068862_100006035 3300005844 Bacteria 10087
92 Ga0097621_100308507 3300006237 Unclassified 1399
93 Ga0097621_100338059 3300006237 Unclassified 1337
94 Ga0097621_100360412 3300006237 Bacteria 1295
95 Ga0097621_100951057 3300006237 Bacteria 802
96 Ga0068871_101104653 3300006358 Bacteria 741
97 Ga0068871_101167838 3300006358 Bacteria 721
98 Ga0068865_100041366 3300006881 Unclassified 3135
99 Ga0068865_100111219 3300006881 Bacteria 2021
100 Ga0097620_100166328 3300006931 Bacteria 2285
101 Ga0097620_100579326 3300006931 Bacteria 1216
102 Ga0105240_10015808 3300009093 Bacteria 10240
103 Ga0105240_10043213 3300009093 Bacteria 5736
104 Ga0111539_10007294 3300009094 Bacteria 14156
105 Ga0105247_10416245 3300009101 Bacteria 961
106 Ga0105247_10608345 3300009101 Unclassified 811
107 Ga0105243_10793983 3300009148 Bacteria 932
108 Ga0105241_10020132 3300009174 Bacteria 4928
109 Ga0105241_10533550 3300009174 Bacteria 1051
110 Ga0105241_10705227 3300009174 Bacteria 922
111 Ga0105242_10017763 3300009176 Bacteria 5549
112 Ga0105242_10085044 3300009176 Bacteria 2652
113 Ga0105242_11710898 3300009176 Bacteria 665
114 Ga0105237_10077065 3300009545 Bacteria 3324
115 Ga0105249_10011164 3300009553 Bacteria 7892
116 Ga0105239_10068500 3300010375 Bacteria 3900
117 Ga0105246_10038471 3300011119 Unclassified 3217
118 Ga0157373_10035057 3300013100 Bacteria 3604
119 Ga0157373_10070017 3300013100 Bacteria 2479
120 Ga0157371_10038662 3300013102 Bacteria 3413
121 Ga0157371_10052499 3300013102 Bacteria 2895
122 Ga0157370_10005986 3300013104 Bacteria 13535
123 Ga0157370_10668226 3300013104 Unclassified 949
124 Ga0157374_10084692 3300013296 Unclassified 3014
125 Ga0157374_10167350 3300013296 Bacteria 2143
126 Ga0157374_10968366 3300013296 Unclassified 870
127 Ga0157374_11162528 3300013296 Bacteria 793
128 Ga0157378_10593397 3300013297 Unclassified 1118
129 Ga0163162_10063373 3300013306 Bacteria 3739
130 Ga0163162_10993782 3300013306 Bacteria 948
131 Ga0157372_10006795 3300013307 Bacteria 12162
132 Ga0157372_10313541 3300013307 Bacteria 1826
133 Ga0157372_10897773 3300013307 Bacteria 1028
134 Ga0157375_10129957 3300013308 Bacteria 2637
135 Ga0157375_11436464 3300013308 Unclassified 813
136 Ga0157375_12057510 3300013308 Unclassified 679
137 Ga0163163_10150533 3300014325 Bacteria 2371
138 Ga0163163_10344859 3300014325 Bacteria 1545
139 Ga0163163_10453968 3300014325 Unclassified 1342
140 Ga0163163_11340135 3300014325 Unclassified 777
141 Ga0157380_10000855 3300014326 Bacteria 19105
142 Ga0157380_10003359 3300014326 Bacteria 10978
143 Ga0157380_10288451 3300014326 Bacteria 1506
144 Ga0157380_10924124 3300014326 Unclassified 900
145 Ga0157379_10128627 3300014968 Unclassified 2279
146 Ga0157376_10143047 3300014969 Bacteria 2148
147 Ga0157376_10732070 3300014969 Unclassified 997
148 Ga0163161_10100718 3300017792 Bacteria 2150
149 Ga0207666_1010832 3300025271 Bacteria 1253
150 Ga0207697_10015828 3300025315 Bacteria 3112
151 Ga0207642_10083471 3300025899 Unclassified 1558
152 Ga0207688_10414135 3300025901 Bacteria 837
153 Ga0207680_10049582 3300025903 Unclassified 2500
154 Ga0207647_10305565 3300025904 Bacteria 905
155 Ga0207645_10075179 3300025907 Unclassified 2162
156 Ga0207643_10043879 3300025908 Bacteria 2524
157 Ga0207643_10104167 3300025908 Unclassified 1666
158 Ga0207654_10007802 3300025911 Bacteria 5401
159 Ga0207654_10017054 3300025911 Bacteria 3791
160 Ga0207707_10000682 3300025912 Bacteria 33701
161 Ga0207707_10369188 3300025912 Bacteria 1235
162 Ga0207695_10059555 3300025913 Bacteria 3959
163 Ga0207663_10930133 3300025916 Bacteria 696
164 Ga0207660_10001978 3300025917 Bacteria 13657
165 Ga0207662_10270783 3300025918 Unclassified 1121
166 Ga0207652_10069553 3300025921 Bacteria 3056
167 Ga0207681_10034859 3300025923 Bacteria 3312
168 Ga0207681_10126279 3300025923 Unclassified 1884
169 Ga0207681_10704551 3300025923 Bacteria 840
170 Ga0207650_10730373 3300025925 Unclassified 837
171 Ga0207659_10018477 3300025926 Bacteria 4571
172 Ga0207690_10311702 3300025932 Bacteria 1234
173 Ga0207706_10060777 3300025933 Bacteria 3328
174 Ga0207706_10202243 3300025933 Bacteria 1742
175 Ga0207686_10088169 3300025934 Bacteria 2042
176 Ga0207686_10249490 3300025934 Bacteria 1296
177 Ga0207686_10478709 3300025934 Unclassified 962
178 Ga0207670_10046706 3300025936 Unclassified 2878
179 Ga0207669_10176089 3300025937 Bacteria 1528
180 Ga0207669_10622910 3300025937 Unclassified 879
181 Ga0207669_10906402 3300025937 Unclassified 737
182 Ga0207704_10026176 3300025938 Unclassified 3196
183 Ga0207704_10424504 3300025938 Bacteria 1055
184 Ga0207691_10170171 3300025940 Unclassified 1908
185 Ga0207689_10006091 3300025942 Bacteria 10667
186 Ga0207689_10057268 3300025942 Unclassified 3207
187 Ga0207689_10089177 3300025942 Unclassified 2533
188 Ga0207689_10144502 3300025942 Bacteria 1960
189 Ga0207667_10043724 3300025949 Bacteria 4752
190 Ga0207667_10317373 3300025949 Bacteria 1591
191 Ga0207651_10072157 3300025960 Bacteria 2450
192 Ga0207668_10108601 3300025972 Bacteria 2077
193 Ga0207668_10243117 3300025972 Unclassified 1457
194 Ga0207668_11123459 3300025972 Unclassified 705
195 Ga0207658_10061478 3300025986 Bacteria 2807
196 Ga0207658_10447276 3300025986 Unclassified 1143
197 Ga0207677_10213993 3300026023 Unclassified 1541
198 Ga0207677_10654556 3300026023 Bacteria 928
199 Ga0207639_10063178 3300026041 Bacteria 2866
200 Ga0207639_10226115 3300026041 Bacteria 1619
201 Ga0207678_10425454 3300026067 Unclassified 1152
202 Ga0207708_10203879 3300026075 Bacteria 1579
203 Ga0207702_10103375 3300026078 Bacteria 2520
204 Ga0207641_10294942 3300026088 Unclassified 1530
205 Ga0207641_10479671 3300026088 Bacteria 1205
206 Ga0207648_10000479 3300026089 Bacteria 44522
207 Ga0207648_10138428 3300026089 Bacteria 2145
208 Ga0207648_10224759 3300026089 Bacteria 1669
209 Ga0207674_10038135 3300026116 Bacteria 4993
210 Ga0207674_10880078 3300026116 Unclassified 863
211 Ga0207675_100007987 3300026118 Bacteria 9973
212 Ga0207675_100034785 3300026118 Bacteria 4699
213 Ga0207683_10127148 3300026121 Bacteria 2291
214 Ga0207683_10195834 3300026121 Unclassified 1836
215 Ga0207698_10183364 3300026142 Bacteria 1857
216 Ga0207698_10356770 3300026142 Bacteria 1383
217 Ga0207698_10557658 3300026142 Bacteria 1124
218 Ga0268266_10409465 3300028379 Unclassified 1283
219 Ga0268266_10586695 3300028379 Unclassified 1070
220 Ga0268265_10020492 3300028380 Bacteria 4614
221 Ga0268265_10214843 3300028380 Bacteria 1678
222 Ga0268264_10004157 3300028381 Bacteria 12371
223 Ga0268264_10121200 3300028381 Unclassified 2305
224 Ga0268264_10404270 3300028381 Unclassified 1313
225 Ga0268264_10605846 3300028381 Bacteria 1080
226 Ga0307517_10043365 3300028786 Bacteria 4794
227 Ga0307405_10292746 3300031731 Bacteria 1231
228 Ga0307413_10269961 3300031824 Unclassified 1273
229 Ga0307410_10095857 3300031852 Bacteria 2116
230 Ga0307406_10120192 3300031901 Bacteria 1825
231 Ga0307407_10305713 3300031903 Bacteria 1110
232 Ga0307412_10238762 3300031911 Unclassified 1404
233 Ga0307409_100374597 3300031995 Bacteria 1351
234 Ga0307416_100063031 3300032002 Bacteria 3034
235 Ga0307414_10260784 3300032004 Bacteria 1446
236 Ga0307411_10260826 3300032005 Unclassified 1368
237 Ga0373943_0114241 3300035170 Unclassified 1428
238 Ga0373947_0091632 3300035725 Unclassified 1897
239 Ga0451807_1118617 3300041486 Bacteria 1178
240 Ga0439435_0052900 3300042436 Bacteria 1166
241 Ga0453684_0011119 3300044712 Bacteria 15186
242 Ga0453684_0264639 3300044712 Bacteria 1968
243 Ga0495650_0015261 3300046471 Bacteria 3948
244 Ga0495658_0383083 3300046683 Unclassified 896
245 Ga0495672_0030471 3300047320 Bacteria 3383
246 Ga0495676_0204308 3300047321 Unclassified 1371
247 Ga0495686_0071986 3300047472 Bacteria 2127
248 Ga0501202_000209 3300049652 Bacteria 7545
249 Ga0501202_007100 3300049652 Bacteria 2020
250 Ga0501216_024528 3300049660 Unclassified 1078
251 Ga0501217_026637 3300049661 Bacteria 1398
252 Ga0501217_058097 3300049661 Bacteria 1027
253 Ga0501223_038111 3300049663 Unclassified 933
254 Ga0501235_018971 3300049669 Unclassified 1525
255 Ga0501247_005347 3300049677 Bacteria 1428
256 Ga0501225_0001497 3300049705 Bacteria 7326
257 Ga0501266_005787 3300049763 Bacteria 1536
258 Ga0501272_018795 3300049769 Unclassified 820
259 Ga0501273_007203 3300049770 Unclassified 1306
260 Ga0501276_005108 3300049773 Unclassified 1002
261 Ga0501212_011291 3300049851 Unclassified 1285
262 Ga0501212_063334 3300049851 Bacteria 644
263 nmdc:mga08y16_5124_c1 3300050511 Bacteria 13695
264 Ga0500646_0004118 3300053090 Bacteria 3692
265 Ga0070669_100504449
266 rootH1_10198497
267 rootL2_10386878
268 Ga0065714_10079256
269 Ga0065712_10097352
270 Ga0065715_10101256
271 Ga0065707_10120442
272 Ga0070676_10058654
273 Ga0070670_100070161
274 Ga0070670_100155042
275 Ga0070670_100271503
276 Ga0070670_100527663
277 Ga0068869_100106480
278 Ga0068869_100203801
279 Ga0068869_100277519
280 Ga0070666_10066386
281 Ga0070666_10141719
282 Ga0070680_100000512
283 Ga0070682_100001864
284 Ga0070682_100099522
285 Ga0068868_100137209
286 Ga0068868_100508359
287 Ga0068868_100663996
288 Ga0070689_100029295
289 Ga0070691_10002070
290 Ga0070687_100265180
291 Ga0070668_100011119
292 Ga0070668_100139950
293 Ga0070669_100003436
294 Ga0070669_100089754
295 Ga0070675_100029497
296 Ga0070675_100211547
297 Ga0070674_100028707
298 Ga0070674_100114747
299 Ga0070673_100042621
300 Ga0070673_100097665
301 Ga0070673_100766455
302 Ga0070688_100010207
303 Ga0070659_100036041
304 Ga0070659_100710959
305 Ga0070659_100951508
306 Ga0070667_100064918
307 Ga0070701_10018823
308 Ga0070700_100062465
309 Ga0070663_100387876
310 Ga0070663_100643356
311 Ga0070678_100091460
312 Ga0070678_100093831
313 Ga0070678_100163246
314 Ga0070662_100191480
315 Ga0070681_10260422
316 Ga0070681_10616220
317 Ga0068867_100147991
318 Ga0068867_100191096
319 Ga0068867_100934377
320 Ga0068867_101315922
321 Ga0070685_10123894
322 Ga0070679_100006662
323 Ga0070679_100045876
324 Ga0070684_100052236
325 Ga0068853_100011868
326 Ga0070672_100081700
327 Ga0070672_100306181
328 Ga0070665_100176798
329 Ga0070665_100675761
330 Ga0070704_100445719
331 Ga0068855_100088229
332 Ga0068855_100107918
333 Ga0070664_100337045
334 Ga0068854_100876108
335 Ga0068856_100345896
336 Ga0068856_101814997
337 Ga0070702_100707766
338 Ga0068852_100088219
339 Ga0068852_100395581
340 Ga0068852_100592407
341 Ga0068859_100166335
342 Ga0068859_100579294
343 Ga0068866_10037722
344 Ga0068866_10428008
345 Ga0068861_100038358
346 Ga0068870_10036619
347 Ga0068870_10054497
348 Ga0068870_10469710
349 Ga0068863_100530280
350 Ga0068863_100685503
351 Ga0068860_100003740
352 Ga0068860_100095825
353 Ga0068860_100561372
354 Ga0068860_101820927
355 Ga0068862_100006035
356 Ga0097621_100308507
357 Ga0097621_100338059
358 Ga0097621_100360412
359 Ga0097621_100951057
360 Ga0068871_101104653
361 Ga0068871_101167838
362 Ga0068865_100041366
363 Ga0068865_100111219
364 Ga0097620_100166328
365 Ga0097620_100579326
366 Ga0105240_10015808
367 Ga0105240_10043213
368 Ga0111539_10007294
369 Ga0105247_10416245
370 Ga0105247_10608345
371 Ga0105243_10793983
372 Ga0105241_10020132
373 Ga0105241_10533550
374 Ga0105241_10705227
375 Ga0105242_10017763
376 Ga0105242_10085044
377 Ga0105242_11710898
378 Ga0105237_10077065
379 Ga0105249_10011164
380 Ga0105239_10068500
381 Ga0105246_10038471
382 Ga0157373_10035057
383 Ga0157373_10070017
384 Ga0157371_10038662
385 Ga0157371_10052499
386 Ga0157370_10005986
387 Ga0157370_10668226
388 Ga0157374_10084692
389 Ga0157374_10167350
390 Ga0157374_10968366
391 Ga0157374_11162528
392 Ga0157378_10593397
393 Ga0163162_10063373
394 Ga0163162_10993782
395 Ga0157372_10006795
396 Ga0157372_10313541
397 Ga0157372_10897773
398 Ga0157375_10129957
399 Ga0157375_11436464
400 Ga0157375_12057510
401 Ga0163163_10150533
402 Ga0163163_10344859
403 Ga0163163_10453968
404 Ga0163163_11340135
405 Ga0157380_10000855
406 Ga0157380_10003359
407 Ga0157380_10288451
408 Ga0157380_10924124
409 Ga0157379_10128627
410 Ga0157376_10143047
411 Ga0157376_10732070
412 Ga0163161_10100718
413 Ga0207666_1010832
414 Ga0207697_10015828
415 Ga0207642_10083471
416 Ga0207688_10414135
417 Ga0207680_10049582
418 Ga0207647_10305565
419 Ga0207645_10075179
420 Ga0207643_10043879
421 Ga0207643_10104167
422 Ga0207654_10007802
423 Ga0207654_10017054
424 Ga0207707_10000682
425 Ga0207707_10369188
426 Ga0207695_10059555
427 Ga0207663_10930133
428 Ga0207660_10001978
429 Ga0207662_10270783
430 Ga0207652_10069553
431 Ga0207681_10034859
432 Ga0207681_10126279
433 Ga0207681_10704551
434 Ga0207650_10730373
435 Ga0207659_10018477
436 Ga0207690_10311702
437 Ga0207706_10060777
438 Ga0207706_10202243
439 Ga0207686_10088169
440 Ga0207686_10249490
441 Ga0207686_10478709
442 Ga0207670_10046706
443 Ga0207669_10176089
444 Ga0207669_10622910
445 Ga0207669_10906402
446 Ga0207704_10026176
447 Ga0207704_10424504
448 Ga0207691_10170171
449 Ga0207689_10006091
450 Ga0207689_10057268
451 Ga0207689_10089177
452 Ga0207689_10144502
453 Ga0207667_10043724
454 Ga0207667_10317373
455 Ga0207651_10072157
456 Ga0207668_10108601
457 Ga0207668_10243117
458 Ga0207668_11123459
459 Ga0207658_10061478
460 Ga0207658_10447276
461 Ga0207677_10213993
462 Ga0207677_10654556
463 Ga0207639_10063178
464 Ga0207639_10226115
465 Ga0207678_10425454
466 Ga0207708_10203879
467 Ga0207702_10103375
468 Ga0207641_10294942
469 Ga0207641_10479671
470 Ga0207648_10000479
471 Ga0207648_10138428
472 Ga0207648_10224759
473 Ga0207674_10038135
474 Ga0207674_10880078
475 Ga0207675_100007987
476 Ga0207675_100034785
477 Ga0207683_10127148
478 Ga0207683_10195834
479 Ga0207698_10183364
480 Ga0207698_10356770
481 Ga0207698_10557658
482 Ga0268266_10409465
483 Ga0268266_10586695
484 Ga0268265_10020492
485 Ga0268265_10214843
486 Ga0268264_10004157
487 Ga0268264_10121200
488 Ga0268264_10404270
489 Ga0268264_10605846
490 Ga0307517_10043365
491 Ga0307405_10292746
492 Ga0307413_10269961
493 Ga0307410_10095857
494 Ga0307406_10120192
495 Ga0307407_10305713
496 Ga0307412_10238762
497 Ga0307409_100374597
498 Ga0307416_100063031
499 Ga0307414_10260784
500 Ga0307411_10260826
501 Ga0373943_0114241
502 Ga0373947_0091632
503 Ga0451807_1118617
504 Ga0439435_0052900
505 Ga0453684_0011119
506 Ga0453684_0264639
507 Ga0495650_0015261
508 Ga0495658_0383083
509 Ga0495672_0030471
510 Ga0495676_0204308
511 Ga0495686_0071986
512 Ga0501202_000209
513 Ga0501202_007100
514 Ga0501216_024528
515 Ga0501217_026637
516 Ga0501217_058097
517 Ga0501223_038111
518 Ga0501235_018971
519 Ga0501247_005347
520 Ga0501225_0001497
521 Ga0501266_005787
522 Ga0501272_018795
523 Ga0501273_007203
524 Ga0501276_005108
525 Ga0501212_011291
526 Ga0501212_063334
527 nmdc:mga08y16_5124_c1
528 Ga0500646_0004118

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00165

HTH_AraC

Bacterial regulatory helix-turn-helix proteins, AraC family

165

200

0.95

PF12833

HTH_18

Helix-turn-helix domain

124

202

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7w5x-assembly1.cif.gz_K cryo-em structure of soxs-dependent transcription activation complex with zwf promoter dna 0.9107 101 179
7w5y-assembly1.cif.gz_K cryo-em structure of soxs-dependent transcription activation complex with fpr promoter dna 0.8907 98 179
1xs9-assembly1.cif.gz_A a model of the ternary complex formed between mara, the alpha-ctd of rna polymerase and dna 0.8407 67 179
3oou-assembly1.cif.gz_A the structure of a protein with unkown function from listeria innocua 0.8399 101 180
7w5w-assembly1.cif.gz_J cryo-em structure of soxs-dependent transcription activation complex with micf promoter dna 0.8392 67 178
ID Description Score Start End Superfamily
1d5yD02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9468 132 179 1.10.10.60
1xs9A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9445 135 179 1.10.10.60
3lsgA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.921 134 178 1.10.10.60
af_P32677_219_275_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9093 130 184 1.10.10.60
3lsgB02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9035 134 178 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A3D6EEB2-F1-model_v4 AraC family transcriptional regulator 0.9585 1 185 GO:0003700
GO:0043565
GO:0046872
AF-A0A7W3MHY9-F1-model_v4 deleted 0.9519 4 181
AF-A0A7W3MHY9-F1-model_v4 deleted 0.9414 4 181
AF-R6CHT6-F1-model_v4 Transcriptional regulator AraC family 0.9391 4 181 GO:0003700
GO:0043565
AF-A0A380BPQ8-F1-model_v4 DNA gyrase inhibitor 0.9381 11 176 GO:0003700
GO:0043565

Map