F372248

General Info

Members Datasets Scaffolds Average Seq Length
263 161 526 159

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2811994872|2812324240
Length 182
Sequence HLDESGRARMVDVTAKQPTVRAATARGFVRCSAEVVAALREGTVPKGDVLAVARIAGIQAAKRTPDLLPLAHVIGVHGAVVDLTITDQGVEIEATVRTADRTGVEMEALTAVSVAALAIVDMVKGLDKATSIESIRITAKEGGRSGSWTRPDETSRPAPVDPAPGLDEVDPASGRGRVDPSS

Samples

Sample ID Description Type Environment
1 3300003285 Grassland soil microbial communities from Hopland, California, USA - Sample H3_Rhizo_39 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
2 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
7 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
8 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
9 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
10 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
11 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
12 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
13 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
14 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
15 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
16 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
17 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
18 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
19 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
20 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
21 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
22 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
23 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
24 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
25 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
26 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
27 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
28 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
29 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
40 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
41 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
42 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
43 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
44 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
45 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
46 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
47 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
48 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
49 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
50 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
51 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
52 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
53 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
54 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
55 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
56 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
57 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
58 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
59 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
60 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
61 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
62 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
63 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
64 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
65 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
66 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
67 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
68 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
69 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
70 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
71 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
72 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
73 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
74 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
75 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
76 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
77 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
78 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
79 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
80 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
81 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
82 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
83 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
84 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
86 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
87 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
94 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
95 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
96 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
97 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
99 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
100 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
101 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
102 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
103 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
104 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
105 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
106 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
107 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
108 2643221546 Microbacterium sp. Root53 Isolate Unclassified
109 2643221553 Microbacterium sp. Root553 Isolate Unclassified
110 2643221566 Microbacterium sp. Root166 Isolate Unclassified
111 2643221575 Microbacterium sp. Root61 Isolate Unclassified
112 2643221597 Microbacterium sp. Root180 Isolate Unclassified
113 2643221613 Oerskovia sp. Root22 Isolate Unclassified
114 2643221630 Microbacterium sp. Root322 Isolate Unclassified
115 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
116 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
117 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
118 2643221721 Oerskovia sp. Root918 Isolate Unclassified
119 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
120 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
121 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
122 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
123 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
124 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
125 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
126 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
127 2773857759 Microbacterium sp. 1294 Isolate Unclassified
128 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
129 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
130 2808606394 Promicromonospora sp. C35 Isolate Unclassified
131 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
132 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
133 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
134 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
135 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
136 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
137 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
138 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
139 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
140 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
141 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
142 2897561785 Pseudoclavibacter endophyticus EGI 60007 Isolate Unclassified
143 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
144 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
145 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
146 2919069694 Microbacterium sp. 1154 Isolate Unclassified
147 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
148 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
149 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
150 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
151 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
152 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
153 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
154 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
155 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
156 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
157 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
158 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
159 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
160 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
161 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 76.81
Metatranscriptomes 1.52
Isolates 21.67

Biome Distribution

Category Percentage (%)
Aerial Root 0.76
Bulb 0
Endosphere 3.8
Nodule 0
Rhizoplane 7.6
Rhizosphere 52.85
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0007423J48922_100900 3300003285 Bacteria 677
2 Ga0006562J51391_1206009 3300003578 Bacteria 1384
3 Ga0006562J51391_1206010 3300003578 Bacteria 1310
4 Ga0068868_101081598 3300005338 Bacteria 737
5 Ga0070668_100324242 3300005347 Bacteria 1297
6 Ga0070668_101553121 3300005347 Bacteria 606
7 Ga0070674_100230060 3300005356 Bacteria 1446
8 Ga0070674_100429451 3300005356 Bacteria 1086
9 Ga0070663_100638610 3300005455 Bacteria 899
10 Ga0070678_100067212 3300005456 Bacteria 2667
11 Ga0068854_101381154 3300005578 Bacteria 636
12 Ga0070702_100014120 3300005615 Bacteria 4046
13 Ga0068852_100833751 3300005616 Bacteria 937
14 Ga0068861_100263543 3300005719 Bacteria 1476
15 Ga0075365_10050015 3300006038 Bacteria 2756
16 Ga0075364_10295966 3300006051 Bacteria 1102
17 Ga0075364_10395401 3300006051 Bacteria 943
18 Ga0075364_10751601 3300006051 Bacteria 665
19 Ga0105244_10030350 3300009036 Bacteria 2877
20 Ga0105245_10675723 3300009098 Bacteria 1064
21 Ga0105245_11040248 3300009098 Bacteria 864
22 Ga0105243_10019548 3300009148 Bacteria 5135
23 Ga0105243_10090997 3300009148 Bacteria 2512
24 Ga0105243_11573909 3300009148 Bacteria 683
25 Ga0105238_11009590 3300009551 Bacteria 853
26 Ga0105249_10165967 3300009553 Bacteria 2137
27 Ga0105246_11164962 3300011119 Bacteria 707
28 Ga0157370_10820858 3300013104 Bacteria 846
29 Ga0157370_11085408 3300013104 Bacteria 723
30 Ga0157369_10062004 3300013105 Bacteria 4030
31 Ga0157369_10094937 3300013105 Bacteria 3183
32 Ga0171462_1004 3300013250 Bacteria 678877
33 Ga0163162_10182129 3300013306 Bacteria 2227
34 Ga0157375_11012058 3300013308 Bacteria 970
35 Ga0157375_11132089 3300013308 Bacteria 917
36 Ga0157375_12239500 3300013308 Bacteria 651
37 Ga0163163_12293285 3300014325 Bacteria 599
38 Ga0157380_10455035 3300014326 Bacteria 1230
39 Ga0157380_10583437 3300014326 Bacteria 1103
40 Ga0163161_10534204 3300017792 Bacteria 959
41 Ga0163161_10983640 3300017792 Bacteria 719
42 Ga0206356_10418490 3300020070 Bacteria 613
43 Ga0207655_1043136 3300025728 Bacteria 1912
44 Ga0207647_10117314 3300025904 Bacteria 1571
45 Ga0207709_10011182 3300025935 Bacteria 4951
46 Ga0207669_10166935 3300025937 Bacteria 1562
47 Ga0207712_10298192 3300025961 Bacteria 1322
48 Ga0207712_10530990 3300025961 Bacteria 1010
49 Ga0207668_10459706 3300025972 Bacteria 1088
50 Ga0207668_10532514 3300025972 Bacteria 1015
51 Ga0207677_10502369 3300026023 Bacteria 1049
52 Ga0207678_10523364 3300026067 Bacteria 1035
53 Ga0207675_100120557 3300026118 Bacteria 2481
54 Ga0207683_10086081 3300026121 Bacteria 2794
55 Ga0307405_10986906 3300031731 Bacteria 718
56 Ga0307405_11730603 3300031731 Bacteria 554
57 Ga0307405_11982403 3300031731 Bacteria 521
58 Ga0307410_10983916 3300031852 Bacteria 727
59 Ga0307406_10000424 3300031901 Bacteria 24559
60 Ga0307406_10000529 3300031901 Bacteria 21966
61 Ga0307406_10288417 3300031901 Bacteria 1255
62 Ga0307406_10373219 3300031901 Bacteria 1122
63 Ga0307406_10557824 3300031901 Bacteria 938
64 Ga0307407_10912182 3300031903 Bacteria 675
65 Ga0307412_10081987 3300031911 Bacteria 2232
66 Ga0307412_10308989 3300031911 Bacteria 1253
67 Ga0307412_10380249 3300031911 Bacteria 1143
68 Ga0307412_10754057 3300031911 Bacteria 841
69 Ga0307409_100674823 3300031995 Bacteria 1030
70 Ga0307409_100768130 3300031995 Bacteria 969
71 Ga0307416_100435903 3300032002 Bacteria 1359
72 Ga0307416_102770362 3300032002 Bacteria 586
73 Ga0307414_10193590 3300032004 Bacteria 1647
74 Ga0307414_10601682 3300032004 Bacteria 986
75 Ga0307415_100121134 3300032126 Bacteria 1962
76 Ga0307415_102031679 3300032126 Bacteria 560
77 Ga0395901_0145785 3300038443 Bacteria 2488
78 Ga0451791_0128724 3300041451 Bacteria 774
79 Ga0451791_0831494 3300041451 Bacteria 660
80 Ga0451791_1386896 3300041451 Bacteria 546
81 Ga0451797_0230440 3300041453 Bacteria 515
82 Ga0451795_0642694 3300041456 Bacteria 860
83 Ga0451837_0186500 3300041494 Bacteria 643
84 Ga0451841_0734673 3300041498 Bacteria 658
85 Ga0451849_1195176 3300041505 Bacteria 574
86 Ga0451851_1031006 3300041507 Bacteria 844
87 Ga0451843_0778727 3300041509 Bacteria 770
88 Ga0451843_0972889 3300041509 Bacteria 565
89 Ga0451855_1514153 3300041511 Bacteria 560
90 Ga0451853_2676830 3300041512 Bacteria 974
91 Ga0451853_3655446 3300041512 Bacteria 783
92 Ga0450901_030226 3300042533 Bacteria 597
93 Ga0466965_0101963 3300044683 Bacteria 1468
94 Ga0466965_0658387 3300044683 Bacteria 598
95 Ga0466968_0054979 3300044735 Bacteria 1707
96 Ga0466960_0027039 3300044901 Bacteria 2613
97 Ga0495627_000849 3300046453 Bacteria 21863
98 Ga0495627_017953 3300046453 Bacteria 2396
99 Ga0495645_0013163 3300046543 Bacteria 5849
100 Ga0495645_0518784 3300046543 Bacteria 743
101 Ga0496104_0120189 3300048907 Bacteria 2522
102 Ga0496105_0135319 3300048908 Bacteria 2030
103 Ga0496108_0763363 3300048911 Bacteria 836
104 Ga0496109_0035909 3300048912 Bacteria 4474
105 Ga0496110_0048681 3300048913 Bacteria 3716
106 Ga0496111_0016922 3300048914 Bacteria 5032
107 Ga0496111_0067407 3300048914 Bacteria 2600
108 Ga0496113_0178844 3300048916 Bacteria 1681
109 Ga0496114_0027267 3300048917 Bacteria 4678
110 Ga0496114_0129836 3300048917 Bacteria 2175
111 Ga0496114_0454294 3300048917 Bacteria 1134
112 Ga0496114_0470176 3300048917 Bacteria 1113
113 Ga0496114_0590094 3300048917 Bacteria 980
114 Ga0496114_1403408 3300048917 Bacteria 586
115 Ga0496115_0334769 3300048918 Bacteria 1236
116 Ga0496116_0050023 3300048919 Bacteria 2788
117 Ga0496116_0240179 3300048919 Bacteria 911
118 Ga0496117_0000061 3300048920 Bacteria 258454
119 Ga0496117_0053782 3300048920 Bacteria 2826
120 Ga0496117_0347475 3300048920 Bacteria 767
121 Ga0496118_0006130 3300048921 Bacteria 13352
122 Ga0496118_0041227 3300048921 Bacteria 3658
123 Ga0496118_0218756 3300048921 Bacteria 1110
124 Ga0496118_0232096 3300048921 Bacteria 1064
125 Ga0496119_0003524 3300048922 Bacteria 16169
126 Ga0496119_0009297 3300048922 Bacteria 8458
127 Ga0496119_0034731 3300048922 Bacteria 3313
128 Ga0496119_0076852 3300048922 Bacteria 1936
129 Ga0496119_0333588 3300048922 Bacteria 739
130 Ga0496120_0000336 3300048923 Bacteria 78318
131 Ga0496120_0001077 3300048923 Bacteria 35930
132 Ga0496120_0008296 3300048923 Bacteria 7576
133 Ga0496122_0000338 3300048925 Bacteria 101772
134 Ga0496122_0001650 3300048925 Bacteria 34624
135 Ga0496122_0024060 3300048925 Bacteria 5341
136 Ga0496122_0028481 3300048925 Bacteria 4738
137 Ga0496122_0161226 3300048925 Bacteria 1367
138 Ga0496122_0426534 3300048925 Bacteria 665
139 Ga0496123_0000016 3300048926 Bacteria 424330
140 Ga0496123_0002259 3300048926 Bacteria 24282
141 Ga0496123_0042014 3300048926 Bacteria 3162
142 Ga0496123_0120290 3300048926 Bacteria 1479
143 Ga0496124_0002157 3300048927 Bacteria 26423
144 Ga0496124_0005763 3300048927 Bacteria 13788
145 Ga0496124_0070768 3300048927 Bacteria 2893
146 Ga0496124_0214729 3300048927 Bacteria 1452
147 Ga0496124_0644875 3300048927 Bacteria 681
148 Ga0496124_0659187 3300048927 Bacteria 670
149 Ga0496125_0002746 3300048928 Bacteria 22271
150 Ga0496125_0004546 3300048928 Bacteria 15919
151 Ga0496125_0012617 3300048928 Bacteria 8368
152 Ga0496125_0022881 3300048928 Bacteria 5789
153 Ga0496125_0124743 3300048928 Bacteria 1827
154 Ga0496126_0003385 3300048929 Bacteria 20197
155 Ga0496126_0013285 3300048929 Bacteria 8391
156 Ga0496126_0082981 3300048929 Bacteria 2829
157 Ga0496126_0122243 3300048929 Bacteria 2256
158 Ga0496126_0631924 3300048929 Bacteria 840
159 Ga0501031_0045370 3300049568 Bacteria 2868
160 Ga0501031_0171145 3300049568 Bacteria 1419
161 Ga0501032_0008923 3300049569 Bacteria 7291
162 Ga0501032_0082285 3300049569 Bacteria 2142
163 Ga0501032_0143484 3300049569 Bacteria 1572
164 Ga0501032_0420118 3300049569 Bacteria 858
165 Ga0501032_0499046 3300049569 Bacteria 778
166 Ga0501033_0006061 3300049570 Bacteria 9481
167 Ga0501033_0204540 3300049570 Bacteria 1409
168 Ga0501034_0023226 3300049571 Bacteria 6319
169 Ga0501034_0087901 3300049571 Bacteria 3107
170 Ga0501034_0211345 3300049571 Bacteria 1895
171 Ga0501034_0365107 3300049571 Bacteria 1370
172 Ga0501034_0438828 3300049571 Bacteria 1224
173 Ga0501034_0778776 3300049571 Bacteria 850
174 Ga0501034_0851226 3300049571 Bacteria 802
175 Ga0501034_1287815 3300049571 Bacteria 608
176 Ga0501037_0242216 3300049573 Bacteria 1264
177 Ga0501037_0243305 3300049573 Bacteria 1260
178 Ga0501038_0002028 3300049574 Bacteria 18718
179 Ga0501038_0005896 3300049574 Bacteria 11325
180 Ga0501038_0233998 3300049574 Bacteria 1461
181 Ga0501039_0086206 3300049575 Bacteria 2446
182 Ga0501039_0442463 3300049575 Bacteria 1021
183 Ga0501043_0113831 3300049579 Bacteria 2124
184 Ga0501043_0160451 3300049579 Bacteria 1757
185 Ga0501043_0180128 3300049579 Bacteria 1647
186 Ga0501043_0904601 3300049579 Bacteria 633
187 Ga0501047_0021825 3300049581 Bacteria 6148
188 Ga0501047_0044132 3300049581 Bacteria 4306
189 Ga0501069_0109528 3300049585 Bacteria 1572
190 Ga0501070_0080725 3300049586 Bacteria 2691
191 Ga0501070_0266652 3300049586 Bacteria 1399
192 Ga0501071_0021928 3300049587 Bacteria 4452
193 Ga0501083_0085382 3300049744 Bacteria 2088
194 Ga0501035_0271438 3300049822 Bacteria 1435
195 Ga0501044_0073679 3300049823 Bacteria 3470
196 Ga0501044_0235609 3300049823 Bacteria 1776
197 Ga0501044_0961975 3300049823 Bacteria 727
198 nmdc:mga00v17_281515_c1 3300050491 Bacteria 1079
199 nmdc:mga00v17_350175_c1 3300050491 Bacteria 960
200 nmdc:mga00v17_353040_c1 3300050491 Bacteria 956
201 nmdc:mga0yw44_241407_c1 3300050492 Bacteria 1201
202 Ga0495619_0970293 3300053085 Bacteria 569
203 Ga0500641_0000552 3300053096 Bacteria 13511
204 Ga0500616_0014576 3300053153 Bacteria 4514
205 Ga0501082_0001685 3300060353 Bacteria 19498
206 Ga0501082_0508520 3300060353 Bacteria 1053
207 2812324240 2811994872 Bacteria 4121241
208 2588109141 2585428157 Bacteria 3018951
209 2643734349 2643221542 Bacteria 3563959
210 2643753347 2643221546 Bacteria 2910897
211 2643784102 2643221553 Bacteria 3544260
212 2643848874 2643221566 Bacteria 3460379
213 2643886440 2643221575 Bacteria 4022601
214 2643995037 2643221597 Bacteria 3347721
215 2644081122 2643221613 Bacteria 4622396
216 2644172466 2643221630 Bacteria 3601215
217 2644181136 2643221632 Bacteria 3406696
218 2644504424 2643221690 Bacteria 4654705
219 2644524086 2643221694 Bacteria 4392972
220 2644663566 2643221721 Bacteria 4486924
221 2644668186 2643221722 Bacteria 4247614
222 2644678739 2643221724 Bacteria 3593515
223 2730228244 2728369380 Bacteria 3620317
224 2739608286 2739367654 Bacteria 6049412
225 2747955067 2747842429 Bacteria 3914386
226 2758226988 2757320536 Bacteria 3629334
227 2760305637 2758568522 Bacteria 5953541
228 2774381026 2773857758 Bacteria 3592392
229 2774383271 2773857759 Bacteria 2963774
230 2774398481 2773857763 Bacteria 4180068
231 2808630290 2808606306 Bacteria 3608896
232 2809030882 2808606394 Bacteria 6248540
233 2809228175 2808606447 Bacteria 3572005
234 2833711908 2833709550 Bacteria 4008291
235 2839987974 2839986021 Bacteria 3685650
236 2852634887 2852632344 Bacteria 3463163
237 2852666425 2852663356 Bacteria 4090475
238 2852679799 2852677369 Bacteria 3768884
239 2857722413 2857720070 Bacteria 3189373
240 2857725651 2857723135 Bacteria 4217853
241 2870631261 2870628048 Bacteria 3696012
242 2884997379 2884994152 Bacteria 4492978
243 2887446882 2887443736 Bacteria 4426037
244 2897561897 2897561785 Bacteria 3256946
245 2904511090 2904509784 Bacteria 3520416
246 2906800453 2906799679 Bacteria 4031749
247 2908680160 2908678064 Bacteria 3482747
248 2919072360 2919069694 Bacteria 3622919
249 2928092631 2928090899 Bacteria 3158267
250 2932432575 2932431166 Bacteria 4215299
251 2935892712 2935890801 Bacteria 4593001
252 2946036677 2946033335 Bacteria 3835514
253 2974327360 2974324384 Bacteria 3750535
254 2977228981 2977228692 Bacteria 3450105
255 2977237767 2977236895 Bacteria 3569373
256 2977253453 2977251589 Bacteria 2952848
257 2977267647 2977264416 Bacteria 3750737
258 2984544449 2984542743 Bacteria 3569378
259 2984583832 2984580707 Bacteria 3351387
260 3001891912 3001889506 Bacteria 2975194
261 8016256632 8016254467 Bacteria 3797036
262 8045834208 8045830549 Bacteria 4444727
263 8056581854 8056579771 Bacteria 5840325
264 Ga0007423J48922_100900
265 Ga0006562J51391_1206009
266 Ga0006562J51391_1206010
267 Ga0068868_101081598
268 Ga0070668_100324242
269 Ga0070668_101553121
270 Ga0070674_100230060
271 Ga0070674_100429451
272 Ga0070663_100638610
273 Ga0070678_100067212
274 Ga0068854_101381154
275 Ga0070702_100014120
276 Ga0068852_100833751
277 Ga0068861_100263543
278 Ga0075365_10050015
279 Ga0075364_10295966
280 Ga0075364_10395401
281 Ga0075364_10751601
282 Ga0105244_10030350
283 Ga0105245_10675723
284 Ga0105245_11040248
285 Ga0105243_10019548
286 Ga0105243_10090997
287 Ga0105243_11573909
288 Ga0105238_11009590
289 Ga0105249_10165967
290 Ga0105246_11164962
291 Ga0157370_10820858
292 Ga0157370_11085408
293 Ga0157369_10062004
294 Ga0157369_10094937
295 Ga0171462_1004
296 Ga0163162_10182129
297 Ga0157375_11012058
298 Ga0157375_11132089
299 Ga0157375_12239500
300 Ga0163163_12293285
301 Ga0157380_10455035
302 Ga0157380_10583437
303 Ga0163161_10534204
304 Ga0163161_10983640
305 Ga0206356_10418490
306 Ga0207655_1043136
307 Ga0207647_10117314
308 Ga0207709_10011182
309 Ga0207669_10166935
310 Ga0207712_10298192
311 Ga0207712_10530990
312 Ga0207668_10459706
313 Ga0207668_10532514
314 Ga0207677_10502369
315 Ga0207678_10523364
316 Ga0207675_100120557
317 Ga0207683_10086081
318 Ga0307405_10986906
319 Ga0307405_11730603
320 Ga0307405_11982403
321 Ga0307410_10983916
322 Ga0307406_10000424
323 Ga0307406_10000529
324 Ga0307406_10288417
325 Ga0307406_10373219
326 Ga0307406_10557824
327 Ga0307407_10912182
328 Ga0307412_10081987
329 Ga0307412_10308989
330 Ga0307412_10380249
331 Ga0307412_10754057
332 Ga0307409_100674823
333 Ga0307409_100768130
334 Ga0307416_100435903
335 Ga0307416_102770362
336 Ga0307414_10193590
337 Ga0307414_10601682
338 Ga0307415_100121134
339 Ga0307415_102031679
340 Ga0395901_0145785
341 Ga0451791_0128724
342 Ga0451791_0831494
343 Ga0451791_1386896
344 Ga0451797_0230440
345 Ga0451795_0642694
346 Ga0451837_0186500
347 Ga0451841_0734673
348 Ga0451849_1195176
349 Ga0451851_1031006
350 Ga0451843_0778727
351 Ga0451843_0972889
352 Ga0451855_1514153
353 Ga0451853_2676830
354 Ga0451853_3655446
355 Ga0450901_030226
356 Ga0466965_0101963
357 Ga0466965_0658387
358 Ga0466968_0054979
359 Ga0466960_0027039
360 Ga0495627_000849
361 Ga0495627_017953
362 Ga0495645_0013163
363 Ga0495645_0518784
364 Ga0496104_0120189
365 Ga0496105_0135319
366 Ga0496108_0763363
367 Ga0496109_0035909
368 Ga0496110_0048681
369 Ga0496111_0016922
370 Ga0496111_0067407
371 Ga0496113_0178844
372 Ga0496114_0027267
373 Ga0496114_0129836
374 Ga0496114_0454294
375 Ga0496114_0470176
376 Ga0496114_0590094
377 Ga0496114_1403408
378 Ga0496115_0334769
379 Ga0496116_0050023
380 Ga0496116_0240179
381 Ga0496117_0000061
382 Ga0496117_0053782
383 Ga0496117_0347475
384 Ga0496118_0006130
385 Ga0496118_0041227
386 Ga0496118_0218756
387 Ga0496118_0232096
388 Ga0496119_0003524
389 Ga0496119_0009297
390 Ga0496119_0034731
391 Ga0496119_0076852
392 Ga0496119_0333588
393 Ga0496120_0000336
394 Ga0496120_0001077
395 Ga0496120_0008296
396 Ga0496122_0000338
397 Ga0496122_0001650
398 Ga0496122_0024060
399 Ga0496122_0028481
400 Ga0496122_0161226
401 Ga0496122_0426534
402 Ga0496123_0000016
403 Ga0496123_0002259
404 Ga0496123_0042014
405 Ga0496123_0120290
406 Ga0496124_0002157
407 Ga0496124_0005763
408 Ga0496124_0070768
409 Ga0496124_0214729
410 Ga0496124_0644875
411 Ga0496124_0659187
412 Ga0496125_0002746
413 Ga0496125_0004546
414 Ga0496125_0012617
415 Ga0496125_0022881
416 Ga0496125_0124743
417 Ga0496126_0003385
418 Ga0496126_0013285
419 Ga0496126_0082981
420 Ga0496126_0122243
421 Ga0496126_0631924
422 Ga0501031_0045370
423 Ga0501031_0171145
424 Ga0501032_0008923
425 Ga0501032_0082285
426 Ga0501032_0143484
427 Ga0501032_0420118
428 Ga0501032_0499046
429 Ga0501033_0006061
430 Ga0501033_0204540
431 Ga0501034_0023226
432 Ga0501034_0087901
433 Ga0501034_0211345
434 Ga0501034_0365107
435 Ga0501034_0438828
436 Ga0501034_0778776
437 Ga0501034_0851226
438 Ga0501034_1287815
439 Ga0501037_0242216
440 Ga0501037_0243305
441 Ga0501038_0002028
442 Ga0501038_0005896
443 Ga0501038_0233998
444 Ga0501039_0086206
445 Ga0501039_0442463
446 Ga0501043_0113831
447 Ga0501043_0160451
448 Ga0501043_0180128
449 Ga0501043_0904601
450 Ga0501047_0021825
451 Ga0501047_0044132
452 Ga0501069_0109528
453 Ga0501070_0080725
454 Ga0501070_0266652
455 Ga0501071_0021928
456 Ga0501083_0085382
457 Ga0501035_0271438
458 Ga0501044_0073679
459 Ga0501044_0235609
460 Ga0501044_0961975
461 nmdc:mga00v17_281515_c1
462 nmdc:mga00v17_350175_c1
463 nmdc:mga00v17_353040_c1
464 nmdc:mga0yw44_241407_c1
465 Ga0495619_0970293
466 Ga0500641_0000552
467 Ga0500616_0014576
468 Ga0501082_0001685
469 Ga0501082_0508520
470 2812324240
471 2588109141
472 2643734349
473 2643753347
474 2643784102
475 2643848874
476 2643886440
477 2643995037
478 2644081122
479 2644172466
480 2644181136
481 2644504424
482 2644524086
483 2644663566
484 2644668186
485 2644678739
486 2730228244
487 2739608286
488 2747955067
489 2758226988
490 2760305637
491 2774381026
492 2774383271
493 2774398481
494 2808630290
495 2809030882
496 2809228175
497 2833711908
498 2839987974
499 2852634887
500 2852666425
501 2852679799
502 2857722413
503 2857725651
504 2870631261
505 2884997379
506 2887446882
507 2897561897
508 2904511090
509 2906800453
510 2908680160
511 2919072360
512 2928092631
513 2932432575
514 2935892712
515 2946036677
516 2974327360
517 2977228981
518 2977237767
519 2977253453
520 2977267647
521 2984544449
522 2984583832
523 3001891912
524 8016256632
525 8045834208
526 8056581854

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01967

MoaC

MoaC family

10

143

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fdf-assembly1.cif.gz_B structural insights into putative molybdenum cofactor biosynthesis protein c (moac2) from mycobacterium tuberculosis h37rv 0.9657 12 155
4pyd-assembly1.cif.gz_A moac in complex with cpmp crystallized in space group p212121 0.9623 15 155
4pya-assembly1.cif.gz_A moac k51a in complex with 3',8-ch2gtp 0.9616 24 142
4fdf-assembly1.cif.gz_B structural insights into putative molybdenum cofactor biosynthesis protein c (moac2) from mycobacterium tuberculosis h37rv 0.9589 12 155
4fdf-assembly1.cif.gz_A structural insights into putative molybdenum cofactor biosynthesis protein c (moac2) from mycobacterium tuberculosis h37rv 0.9544 11 145
ID Description Score Start End Superfamily
af_B4FJH5_64_220_3.30.70.640 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.9617 4 156 3.30.70.640
2ohdB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.956 13 142 3.30.70.640
4fdfA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.9544 11 145 3.30.70.640
af_Q20624_440_595_3.30.70.640 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.953 3 156 3.30.70.640
af_Q2FVX9_1_163_3.30.70.640 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.9507 1 158 3.30.70.640
ID Description Score Start End GO Terms
AF-A0A4Q2XSH4-F1-model_v4 deleted 0.9968 27 155
AF-A0A353K8V0-F1-model_v4 deleted 0.9947 34 156
AF-A0A7Y3PEI4-F1-model_v4 Cyclic pyranopterin monophosphate synthase MoaC (EC 4.6.1.17) 0.9941 37 157 GO:0006777
GO:0061799
AF-A0A1A3SCP1-F1-model_v4 cyclic pyranopterin monophosphate synthase (EC 4.6.1.17) 0.994 30 156 GO:0006777
GO:0061799
AF-A0A838Q804-F1-model_v4 Cyclic pyranopterin monophosphate synthase MoaC (EC 4.6.1.17) 0.9938 24 146 GO:0006777
GO:0016829

Map