F371868
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 263 | 190 | 259 | 139 |
Family's Representative Sequence
| Representative Sequence | 3300013105|Ga0157369_10996912|Ga0157369_109969122 |
| Length | 164 |
| Sequence | MLAMYDNLYKFAMALPSARRYKWRMQTHLAHIALVVRDYDEAIAFYVGKLGFALVEDTYQPEQDKRWVTIRPPGAPANATTILLARASNAHQAKYIGDQAGGRVFLFLATDDFDRDHAAFTAAGVEWARPPAMYDYGKVAVFLDLYGNRWDLVQFAEGHPGAAT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2864733723 | Paenibacillus sp. JGP012 | Isolate | Rhizosphere |
| 2 | 2889049205 | Paenibacillus rhizovicinus 14171R-81 | Isolate | Rhizosphere |
| 3 | 2946053406 | Paenibacillus sp. W4I10 | Isolate | Rhizosphere |
| 4 | 2971403814 | Paenibacillus tritici LMG 29502 | Isolate | Unclassified |
| 5 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 6 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 7 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 8 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 9 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 10 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 12 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 13 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 14 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 35 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 36 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 37 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 39 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 40 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 41 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 42 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 43 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 44 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 45 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 47 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 68 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 70 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 71 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 105 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 106 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 107 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 108 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 109 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 110 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 111 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 112 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 113 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 114 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 115 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 116 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 117 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 118 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 119 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 120 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 121 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 122 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 123 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 124 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 125 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 126 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 127 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 128 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 158 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 159 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 160 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 161 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 162 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 163 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 164 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 165 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 166 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 167 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 168 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 169 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 170 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 171 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 172 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 173 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 174 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 175 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 176 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 177 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 178 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 179 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 181 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 182 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 183 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 184 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 185 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 186 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 187 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 188 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 189 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 190 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.48 |
| Metatranscriptomes | 0 |
| Isolates | 1.52 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.69 |
| Nodule | 0 |
| Rhizoplane | 4.56 |
| Rhizosphere | 72.62 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.13 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24744J21845_10003363 | 3300002077 | Bacteria | 3285 |
| 2 | JGI25165J46597_1000010 | 3300003214 | Bacteria | 442113 |
| 3 | JGI25153J46596_10000034 | 3300003215 | Bacteria | 192215 |
| 4 | rootL2_10043363 | 3300003322 | Bacteria | 1744 |
| 5 | Ga0055525_1000139 | 3300003759 | Bacteria | 102623 |
| 6 | Ga0055542_1000012 | 3300003762 | Bacteria | 391808 |
| 7 | Ga0055529_1000004 | 3300003763 | Bacteria | 433331 |
| 8 | Ga0055526_1016494 | 3300003771 | Bacteria | 2884 |
| 9 | Ga0055537_1005862 | 3300003773 | Bacteria | 3215 |
| 10 | Ga0065165_1040146 | 3300005262 | Bacteria | 1398 |
| 11 | Ga0070658_10005023 | 3300005327 | Bacteria | 10770 |
| 12 | Ga0070658_10472364 | 3300005327 | Bacteria | 1082 |
| 13 | Ga0070658_10625634 | 3300005327 | Bacteria | 934 |
| 14 | Ga0070676_10315565 | 3300005328 | Bacteria | 1064 |
| 15 | Ga0068869_100324139 | 3300005334 | Bacteria | 1250 |
| 16 | Ga0070666_10000005 | 3300005335 | Bacteria | 343092 |
| 17 | Ga0070680_100342231 | 3300005336 | Bacteria | 1271 |
| 18 | Ga0068868_100026949 | 3300005338 | Bacteria | 4382 |
| 19 | Ga0070660_100214044 | 3300005339 | Bacteria | 1565 |
| 20 | Ga0070674_100000483 | 3300005356 | Bacteria | 20099 |
| 21 | Ga0070673_100183596 | 3300005364 | Bacteria | 1792 |
| 22 | Ga0070659_100041985 | 3300005366 | Bacteria | 3576 |
| 23 | Ga0070659_101252604 | 3300005366 | Unclassified | 657 |
| 24 | Ga0070667_100075442 | 3300005367 | Bacteria | 2879 |
| 25 | Ga0070705_100097159 | 3300005440 | Bacteria | 1851 |
| 26 | Ga0070678_100001925 | 3300005456 | Bacteria | 11196 |
| 27 | Ga0070662_100344229 | 3300005457 | Bacteria | 1220 |
| 28 | Ga0070662_100401777 | 3300005457 | Bacteria | 1131 |
| 29 | Ga0070681_10100878 | 3300005458 | Bacteria | 2832 |
| 30 | Ga0070679_100228597 | 3300005530 | Unclassified | 1820 |
| 31 | Ga0070679_100414133 | 3300005530 | Bacteria | 1293 |
| 32 | Ga0068853_100021085 | 3300005539 | Bacteria | 5425 |
| 33 | Ga0068853_100067451 | 3300005539 | Bacteria | 3108 |
| 34 | Ga0068853_101292110 | 3300005539 | Bacteria | 705 |
| 35 | Ga0070672_100124991 | 3300005543 | Bacteria | 2109 |
| 36 | Ga0070665_100000043 | 3300005548 | Bacteria | 279774 |
| 37 | Ga0070665_100009525 | 3300005548 | Bacteria | 9825 |
| 38 | Ga0068855_100449430 | 3300005563 | Unclassified | 1406 |
| 39 | Ga0068855_100703920 | 3300005563 | Bacteria | 1081 |
| 40 | Ga0068857_100106619 | 3300005577 | Unclassified | 2516 |
| 41 | Ga0068854_100312446 | 3300005578 | Unclassified | 1275 |
| 42 | Ga0070702_100142830 | 3300005615 | Bacteria | 1527 |
| 43 | Ga0068852_100424469 | 3300005616 | Bacteria | 1312 |
| 44 | Ga0068852_101317251 | 3300005616 | Bacteria | 744 |
| 45 | Ga0068859_100781323 | 3300005617 | Bacteria | 1043 |
| 46 | Ga0068861_100000269 | 3300005719 | Bacteria | 29033 |
| 47 | Ga0068863_100019204 | 3300005841 | Bacteria | 6543 |
| 48 | Ga0068858_100000274 | 3300005842 | Bacteria | 55319 |
| 49 | Ga0068860_100002577 | 3300005843 | Bacteria | 18971 |
| 50 | Ga0075367_11052202 | 3300006178 | Bacteria | 520 |
| 51 | Ga0097621_100457004 | 3300006237 | Bacteria | 1151 |
| 52 | Ga0068871_100048888 | 3300006358 | Bacteria | 3416 |
| 53 | Ga0068871_100099863 | 3300006358 | Bacteria | 2430 |
| 54 | Ga0097620_100781395 | 3300006931 | Bacteria | 1043 |
| 55 | Ga0105244_10157867 | 3300009036 | Bacteria | 1084 |
| 56 | Ga0105245_10070457 | 3300009098 | Bacteria | 3173 |
| 57 | Ga0105245_11012811 | 3300009098 | Unclassified | 875 |
| 58 | Ga0105243_10001132 | 3300009148 | Bacteria | 24182 |
| 59 | Ga0105243_10237880 | 3300009148 | Bacteria | 1619 |
| 60 | Ga0105242_11503698 | 3300009176 | Bacteria | 704 |
| 61 | Ga0105238_10000783 | 3300009551 | Bacteria | 33020 |
| 62 | Ga0105238_10021033 | 3300009551 | Bacteria | 6648 |
| 63 | Ga0105239_11799373 | 3300010375 | Unclassified | 710 |
| 64 | Ga0105246_10325869 | 3300011119 | Bacteria | 1250 |
| 65 | Ga0157370_11641253 | 3300013104 | Bacteria | 577 |
| 66 | Ga0157369_10081582 | 3300013105 | Bacteria | 3461 |
| 67 | Ga0157369_10996912 | 3300013105 | Bacteria | 858 |
| 68 | Ga0157374_10110173 | 3300013296 | Bacteria | 2648 |
| 69 | Ga0157378_10037118 | 3300013297 | Bacteria | 4315 |
| 70 | Ga0157378_10119000 | 3300013297 | Bacteria | 2432 |
| 71 | Ga0163162_10000281 | 3300013306 | Bacteria | 46556 |
| 72 | Ga0163162_10121746 | 3300013306 | Bacteria | 2714 |
| 73 | Ga0157372_10104723 | 3300013307 | Unclassified | 3235 |
| 74 | Ga0157376_10115387 | 3300014969 | Bacteria | 2371 |
| 75 | Ga0209563_100070 | 3300025230 | Bacteria | 249779 |
| 76 | Ga0209437_105836 | 3300025233 | Bacteria | 2081 |
| 77 | Ga0209677_105094 | 3300025253 | Bacteria | 3543 |
| 78 | Ga0209148_1000008 | 3300025254 | Bacteria | 1504371 |
| 79 | Ga0209233_1000044 | 3300025261 | Bacteria | 489783 |
| 80 | Ga0209565_1000052 | 3300025263 | Bacteria | 212056 |
| 81 | Ga0209455_1000002 | 3300025272 | Bacteria | 1505459 |
| 82 | Ga0209673_1022598 | 3300025273 | Bacteria | 2165 |
| 83 | Ga0209564_1007179 | 3300025295 | Bacteria | 5807 |
| 84 | Ga0209758_1000007 | 3300025297 | Bacteria | 1270410 |
| 85 | Ga0209050_1018318 | 3300025298 | Bacteria | 2728 |
| 86 | Ga0209257_1074493 | 3300025304 | Bacteria | 886 |
| 87 | Ga0207680_10000005 | 3300025903 | Bacteria | 660983 |
| 88 | Ga0207647_10017043 | 3300025904 | Bacteria | 4945 |
| 89 | Ga0207645_10403045 | 3300025907 | Bacteria | 920 |
| 90 | Ga0207705_10016812 | 3300025909 | Bacteria | 5239 |
| 91 | Ga0207705_11413385 | 3300025909 | Bacteria | 529 |
| 92 | Ga0207660_10297721 | 3300025917 | Unclassified | 1284 |
| 93 | Ga0207657_10091438 | 3300025919 | Unclassified | 2537 |
| 94 | Ga0207657_10262799 | 3300025919 | Bacteria | 1373 |
| 95 | Ga0207652_10033635 | 3300025921 | Unclassified | 4318 |
| 96 | Ga0207694_10000916 | 3300025924 | Bacteria | 26125 |
| 97 | Ga0207694_10005116 | 3300025924 | Bacteria | 10122 |
| 98 | Ga0207687_10065192 | 3300025927 | Bacteria | 2586 |
| 99 | Ga0207644_10207165 | 3300025931 | Bacteria | 1549 |
| 100 | Ga0207706_10009115 | 3300025933 | Bacteria | 9125 |
| 101 | Ga0207706_10023591 | 3300025933 | Bacteria | 5523 |
| 102 | Ga0207686_10878019 | 3300025934 | Bacteria | 723 |
| 103 | Ga0207709_10000005 | 3300025935 | Bacteria | 806813 |
| 104 | Ga0207669_10008360 | 3300025937 | Bacteria | 4853 |
| 105 | Ga0207691_10136916 | 3300025940 | Bacteria | 2159 |
| 106 | Ga0207689_10190217 | 3300025942 | Bacteria | 1693 |
| 107 | Ga0207689_10195074 | 3300025942 | Bacteria | 1671 |
| 108 | Ga0207679_10073273 | 3300025945 | Unclassified | 2590 |
| 109 | Ga0207667_10215850 | 3300025949 | Bacteria | 1966 |
| 110 | Ga0207667_10354457 | 3300025949 | Unclassified | 1496 |
| 111 | Ga0207667_11685654 | 3300025949 | Bacteria | 601 |
| 112 | Ga0207651_11286474 | 3300025960 | Bacteria | 657 |
| 113 | Ga0207640_10395889 | 3300025981 | Unclassified | 1123 |
| 114 | Ga0207677_11269692 | 3300026023 | Bacteria | 676 |
| 115 | Ga0207703_10001826 | 3300026035 | Bacteria | 18987 |
| 116 | Ga0207703_10342824 | 3300026035 | Bacteria | 1374 |
| 117 | Ga0207639_10010872 | 3300026041 | Bacteria | 6312 |
| 118 | Ga0207639_10466640 | 3300026041 | Bacteria | 1149 |
| 119 | Ga0207639_11816727 | 3300026041 | Bacteria | 570 |
| 120 | Ga0207641_10012642 | 3300026088 | Bacteria | 6923 |
| 121 | Ga0207674_10047557 | 3300026116 | Unclassified | 4396 |
| 122 | Ga0207674_10052820 | 3300026116 | Unclassified | 4144 |
| 123 | Ga0207675_100000856 | 3300026118 | Bacteria | 30350 |
| 124 | Ga0207675_102085696 | 3300026118 | Bacteria | 584 |
| 125 | Ga0207683_10005199 | 3300026121 | Bacteria | 11175 |
| 126 | Ga0207698_11662142 | 3300026142 | Bacteria | 654 |
| 127 | Ga0268266_10000002 | 3300028379 | Bacteria | 3059047 |
| 128 | Ga0268266_10000004 | 3300028379 | Bacteria | 1495817 |
| 129 | Ga0268264_10002128 | 3300028381 | Bacteria | 17665 |
| 130 | Ga0265323_10009782 | 3300028653 | Bacteria | 3903 |
| 131 | Ga0307517_10026118 | 3300028786 | Bacteria | 7094 |
| 132 | Ga0307517_10101331 | 3300028786 | Bacteria | 2267 |
| 133 | Ga0307513_10112282 | 3300031456 | Bacteria | 2716 |
| 134 | Ga0307513_10719127 | 3300031456 | Bacteria | 704 |
| 135 | Ga0307509_10276376 | 3300031507 | Bacteria | 1444 |
| 136 | Ga0307509_10794621 | 3300031507 | Bacteria | 611 |
| 137 | Ga0307508_10000011 | 3300031616 | Bacteria | 248001 |
| 138 | Ga0316578_10340962 | 3300031728 | Bacteria | 893 |
| 139 | Ga0307413_10365443 | 3300031824 | Bacteria | 1119 |
| 140 | Ga0307410_10074624 | 3300031852 | Bacteria | 2363 |
| 141 | Ga0307406_10519215 | 3300031901 | Bacteria | 969 |
| 142 | Ga0307407_10024299 | 3300031903 | Bacteria | 3176 |
| 143 | Ga0307415_100221893 | 3300032126 | Bacteria | 1516 |
| 144 | Ga0307415_100583456 | 3300032126 | Bacteria | 992 |
| 145 | Ga0307510_10006365 | 3300033180 | Bacteria | 14082 |
| 146 | Ga0373927_0586581 | 3300035695 | Bacteria | 737 |
| 147 | Ga0395899_0078399 | 3300037312 | Bacteria | 2408 |
| 148 | Ga0395899_0482412 | 3300037312 | Bacteria | 807 |
| 149 | Ga0395905_0480258 | 3300037471 | Bacteria | 1142 |
| 150 | Ga0436364_0816896 | 3300037853 | Bacteria | 908 |
| 151 | Ga0400483_080023 | 3300039062 | Bacteria | 1025 |
| 152 | Ga0451789_0134399 | 3300041443 | Bacteria | 670 |
| 153 | Ga0451797_0048517 | 3300041453 | Bacteria | 544 |
| 154 | Ga0451577_0002265 | 3300042876 | Bacteria | 23287 |
| 155 | Ga0453683_0153376 | 3300044673 | Bacteria | 1456 |
| 156 | Ga0453683_0227877 | 3300044673 | Bacteria | 1186 |
| 157 | Ga0466965_0661411 | 3300044683 | Bacteria | 597 |
| 158 | Ga0453684_0000095 | 3300044712 | Bacteria | 378681 |
| 159 | Ga0453684_0000581 | 3300044712 | Bacteria | 136088 |
| 160 | Ga0453684_0188340 | 3300044712 | Unclassified | 2416 |
| 161 | Ga0453684_1100560 | 3300044712 | Bacteria | 839 |
| 162 | Ga0451576_0004396 | 3300045051 | Bacteria | 18345 |
| 163 | Ga0495638_0323508 | 3300046460 | Bacteria | 823 |
| 164 | Ga0495650_0005912 | 3300046471 | Bacteria | 7775 |
| 165 | Ga0495584_0052588 | 3300046491 | Bacteria | 2050 |
| 166 | Ga0495584_0196913 | 3300046491 | Bacteria | 1024 |
| 167 | Ga0495585_0012921 | 3300046492 | Bacteria | 4907 |
| 168 | Ga0495585_0165192 | 3300046492 | Bacteria | 1146 |
| 169 | Ga0495596_0006093 | 3300046500 | Bacteria | 5611 |
| 170 | Ga0495583_0000311 | 3300046506 | Bacteria | 76925 |
| 171 | Ga0495583_0002358 | 3300046506 | Bacteria | 16323 |
| 172 | Ga0495583_0037275 | 3300046506 | Bacteria | 2306 |
| 173 | Ga0495583_0040307 | 3300046506 | Bacteria | 2195 |
| 174 | Ga0495583_0104352 | 3300046506 | Bacteria | 1207 |
| 175 | Ga0495583_0113324 | 3300046506 | Bacteria | 1147 |
| 176 | Ga0495583_0406796 | 3300046506 | Bacteria | 534 |
| 177 | Ga0495606_0007432 | 3300046507 | Bacteria | 9812 |
| 178 | Ga0495606_0050184 | 3300046507 | Bacteria | 2731 |
| 179 | Ga0495606_0079069 | 3300046507 | Bacteria | 2049 |
| 180 | Ga0495616_0143758 | 3300046513 | Bacteria | 1084 |
| 181 | Ga0495631_0003238 | 3300046518 | Bacteria | 8953 |
| 182 | Ga0495631_0148834 | 3300046518 | Bacteria | 1004 |
| 183 | Ga0495637_0076975 | 3300046520 | Bacteria | 1336 |
| 184 | Ga0495643_0008103 | 3300046522 | Bacteria | 6695 |
| 185 | Ga0495643_0009167 | 3300046522 | Bacteria | 6179 |
| 186 | Ga0495643_0061582 | 3300046522 | Bacteria | 1989 |
| 187 | Ga0495648_0002467 | 3300046524 | Bacteria | 17023 |
| 188 | Ga0495648_0092702 | 3300046524 | Bacteria | 1686 |
| 189 | Ga0495663_0001846 | 3300046525 | Bacteria | 6531 |
| 190 | Ga0495642_0025899 | 3300046528 | Bacteria | 2327 |
| 191 | Ga0495622_0178921 | 3300046557 | Bacteria | 952 |
| 192 | Ga0495633_0000538 | 3300046558 | Bacteria | 37829 |
| 193 | Ga0495633_0151947 | 3300046558 | Bacteria | 1069 |
| 194 | Ga0495668_0000468 | 3300046616 | Bacteria | 51229 |
| 195 | Ga0495611_0016361 | 3300046648 | Bacteria | 3171 |
| 196 | Ga0495611_0044388 | 3300046648 | Bacteria | 1988 |
| 197 | Ga0495625_0002092 | 3300046660 | Bacteria | 22304 |
| 198 | Ga0495625_0017622 | 3300046660 | Bacteria | 5589 |
| 199 | Ga0495625_0054479 | 3300046660 | Bacteria | 2856 |
| 200 | Ga0495625_0061872 | 3300046660 | Bacteria | 2647 |
| 201 | Ga0495625_0257825 | 3300046660 | Bacteria | 1129 |
| 202 | Ga0495625_0532009 | 3300046660 | Bacteria | 714 |
| 203 | Ga0495669_0000118 | 3300046684 | Bacteria | 51189 |
| 204 | Ga0495670_0024887 | 3300046691 | Bacteria | 2959 |
| 205 | Ga0495670_0063361 | 3300046691 | Bacteria | 1861 |
| 206 | Ga0495670_0066689 | 3300046691 | Bacteria | 1816 |
| 207 | Ga0495649_0369617 | 3300046694 | Bacteria | 723 |
| 208 | Ga0495600_0068983 | 3300046809 | Bacteria | 2311 |
| 209 | Ga0495660_0047984 | 3300046810 | Bacteria | 2336 |
| 210 | Ga0495660_0076645 | 3300046810 | Bacteria | 1761 |
| 211 | Ga0495683_0008964 | 3300047323 | Bacteria | 5338 |
| 212 | Ga0495683_0060632 | 3300047323 | Bacteria | 1874 |
| 213 | Ga0495687_000499 | 3300047443 | Bacteria | 47300 |
| 214 | Ga0495677_0012361 | 3300047445 | Bacteria | 3114 |
| 215 | Ga0495681_0032858 | 3300047470 | Bacteria | 2606 |
| 216 | Ga0495681_0181770 | 3300047470 | Bacteria | 864 |
| 217 | Ga0495686_0002629 | 3300047472 | Bacteria | 16626 |
| 218 | Ga0495686_0091780 | 3300047472 | Bacteria | 1843 |
| 219 | Ga0496101_0156255 | 3300048904 | Bacteria | 1747 |
| 220 | Ga0496102_0000022 | 3300048905 | Bacteria | 246314 |
| 221 | Ga0496103_0000075 | 3300048906 | Bacteria | 114569 |
| 222 | Ga0496105_0021589 | 3300048908 | Bacteria | 5211 |
| 223 | Ga0496107_0259453 | 3300048910 | Bacteria | 1293 |
| 224 | Ga0496110_0035849 | 3300048913 | Bacteria | 4307 |
| 225 | Ga0496111_0016874 | 3300048914 | Bacteria | 5039 |
| 226 | Ga0496113_0329504 | 3300048916 | Bacteria | 1224 |
| 227 | Ga0496114_0036720 | 3300048917 | Bacteria | 4050 |
| 228 | Ga0496115_0017647 | 3300048918 | Bacteria | 5463 |
| 229 | Ga0496117_0010437 | 3300048920 | Bacteria | 8467 |
| 230 | Ga0496118_0000039 | 3300048921 | Bacteria | 305458 |
| 231 | Ga0496119_0017347 | 3300048922 | Bacteria | 5418 |
| 232 | Ga0496120_0043007 | 3300048923 | Bacteria | 2635 |
| 233 | Ga0496121_0024276 | 3300048924 | Bacteria | 5806 |
| 234 | Ga0496123_0186963 | 3300048926 | Bacteria | 1075 |
| 235 | Ga0496124_0000076 | 3300048927 | Bacteria | 215767 |
| 236 | Ga0496124_0555524 | 3300048927 | Bacteria | 757 |
| 237 | Ga0496125_0011759 | 3300048928 | Bacteria | 8724 |
| 238 | Ga0496125_0078061 | 3300048928 | Bacteria | 2548 |
| 239 | Ga0496126_0002266 | 3300048929 | Bacteria | 26518 |
| 240 | Ga0496126_0023885 | 3300048929 | Bacteria | 5913 |
| 241 | Ga0501299_090740 | 3300049522 | Bacteria | 694 |
| 242 | Ga0501033_0774169 | 3300049570 | Bacteria | 650 |
| 243 | Ga0501263_095808 | 3300049760 | Bacteria | 505 |
| 244 | Ga0501035_0415637 | 3300049822 | Bacteria | 1117 |
| 245 | Ga0500610_0000255 | 3300053079 | Bacteria | 16041 |
| 246 | Ga0500646_0239269 | 3300053090 | Bacteria | 635 |
| 247 | Ga0500556_0157902 | 3300053104 | Bacteria | 895 |
| 248 | Ga0500595_004149 | 3300053119 | Bacteria | 6568 |
| 249 | Ga0500595_006182 | 3300053119 | Bacteria | 5123 |
| 250 | Ga0500559_0002999 | 3300053136 | Bacteria | 8459 |
| 251 | Ga0500559_0003593 | 3300053136 | Bacteria | 7581 |
| 252 | Ga0500559_0046463 | 3300053136 | Bacteria | 1904 |
| 253 | Ga0500616_0007481 | 3300053153 | Bacteria | 6929 |
| 254 | Ga0500622_0000119 | 3300053156 | Bacteria | 82219 |
| 255 | Ga0500636_0180105 | 3300053177 | Bacteria | 1135 |
| 256 | Ga0500645_000003 | 3300053730 | Bacteria | 305887 |
| 257 | Ga0500645_001905 | 3300053730 | Bacteria | 9923 |
| 258 | Ga0500596_003834 | 3300053735 | Bacteria | 2816 |
| 259 | Ga0500661_009279 | 3300055283 | Bacteria | 1804 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005530 | Ga0070679_100414133 | Ga0070679_1004141332 | 123 |
| 2 | 3300013104 | Ga0157370_11641253 | Ga0157370_116412531 | 123 |
| 3 | 3300013297 | Ga0157378_10037118 | Ga0157378_100371184 | 131 |
| 4 | 3300025253 | Ga0209677_105094 | Ga0209677_1050943 | 132 |
| 5 | 3300046507 | Ga0495606_0079069 | Ga0495606_0079069_616_1032 | 132 |
| 6 | 3300047472 | Ga0495686_0091780 | Ga0495686_0091780_393_806 | 132 |
| 7 | 3300003771 | Ga0055526_1016494 | Ga0055526_10164942 | 133 |
| 8 | 3300003773 | Ga0055537_1005862 | Ga0055537_10058622 | 133 |
| 9 | 3300025263 | Ga0209565_1000052 | Ga0209565_1000052133 | 133 |
| 10 | 3300025273 | Ga0209673_1022598 | Ga0209673_10225983 | 133 |
| 11 | 3300025295 | Ga0209564_1007179 | Ga0209564_10071794 | 133 |
| 12 | 3300025298 | Ga0209050_1018318 | Ga0209050_10183184 | 133 |
| 13 | 3300025304 | Ga0209257_1074493 | Ga0209257_10744932 | 133 |
| 14 | 3300028786 | Ga0307517_10101331 | Ga0307517_101013314 | 133 |
| 15 | 3300031901 | Ga0307406_10519215 | Ga0307406_105192152 | 133 |
| 16 | 3300032126 | Ga0307415_100583456 | Ga0307415_1005834562 | 133 |
| 17 | 3300037853 | Ga0436364_0816896 | Ga0436364_0816896_184_591 | 133 |
| 18 | 3300044712 | Ga0453684_0000581 | Ga0453684_0000581_46522_46923 | 133 |
| 19 | 3300046660 | Ga0495625_0532009 | Ga0495625_0532009_105_506 | 133 |
| 20 | 3300046691 | Ga0495670_0024887 | Ga0495670_0024887_164_565 | 133 |
| 21 | 3300053136 | Ga0500559_0002999 | Ga0500559_0002999_6892_7293 | 133 |
| 22 | 3300005616 | Ga0068852_101317251 | Ga0068852_1013172512 | 134 |
| 23 | 3300005719 | Ga0068861_100000269 | Ga0068861_10000026911 | 134 |
| 24 | 3300025949 | Ga0207667_11685654 | Ga0207667_116856541 | 134 |
| 25 | 3300026118 | Ga0207675_100000856 | Ga0207675_10000085611 | 134 |
| 26 | 3300026142 | Ga0207698_11662142 | Ga0207698_116621422 | 134 |
| 27 | 3300046691 | Ga0495670_0063361 | Ga0495670_0063361_483_896 | 134 |
| 28 | 3300047472 | Ga0495686_0002629 | Ga0495686_0002629_10313_10717 | 134 |
| 29 | 3300049570 | Ga0501033_0774169 | Ga0501033_0774169_69_473 | 134 |
| 30 | 3300053153 | Ga0500616_0007481 | Ga0500616_0007481_1210_1614 | 134 |
| 31 | iso_pu_bacteria | 2864733723 | 2864734979 | 134 |
| 32 | iso_pu_bacteria | 2889049205 | 2889049547 | 134 |
| 33 | iso_pu_bacteria | 2946053406 | 2946059848 | 134 |
| 34 | iso_pu_bacteria | 2971403814 | 2971405589 | 134 |
| 35 | 3300003214 | JGI25165J46597_1000010 | JGI25165J46597_1000010166 | 135 |
| 36 | 3300003322 | rootL2_10043363 | rootL2_100433631 | 135 |
| 37 | 3300005327 | Ga0070658_10472364 | Ga0070658_104723642 | 135 |
| 38 | 3300005334 | Ga0068869_100324139 | Ga0068869_1003241392 | 135 |
| 39 | 3300005563 | Ga0068855_100703920 | Ga0068855_1007039202 | 135 |
| 40 | 3300005616 | Ga0068852_100424469 | Ga0068852_1004244692 | 135 |
| 41 | 3300005617 | Ga0068859_100781323 | Ga0068859_1007813232 | 135 |
| 42 | 3300005841 | Ga0068863_100019204 | Ga0068863_1000192045 | 135 |
| 43 | 3300005842 | Ga0068858_100000274 | Ga0068858_10000027448 | 135 |
| 44 | 3300006178 | Ga0075367_11052202 | Ga0075367_110522021 | 135 |
| 45 | 3300006237 | Ga0097621_100457004 | Ga0097621_1004570042 | 135 |
| 46 | 3300006358 | Ga0068871_100099863 | Ga0068871_1000998631 | 135 |
| 47 | 3300006931 | Ga0097620_100781395 | Ga0097620_1007813952 | 135 |
| 48 | 3300009098 | Ga0105245_10070457 | Ga0105245_100704574 | 135 |
| 49 | 3300009176 | Ga0105242_11503698 | Ga0105242_115036981 | 135 |
| 50 | 3300009551 | Ga0105238_10021033 | Ga0105238_100210337 | 135 |
| 51 | 3300013296 | Ga0157374_10110173 | Ga0157374_101101733 | 135 |
| 52 | 3300013297 | Ga0157378_10119000 | Ga0157378_101190002 | 135 |
| 53 | 3300013306 | Ga0163162_10121746 | Ga0163162_101217464 | 135 |
| 54 | 3300025233 | Ga0209437_105836 | Ga0209437_1058363 | 135 |
| 55 | 3300025261 | Ga0209233_1000044 | Ga0209233_1000044317 | 135 |
| 56 | 3300025909 | Ga0207705_11413385 | Ga0207705_114133851 | 135 |
| 57 | 3300025924 | Ga0207694_10005116 | Ga0207694_1000511614 | 135 |
| 58 | 3300025927 | Ga0207687_10065192 | Ga0207687_100651922 | 135 |
| 59 | 3300025931 | Ga0207644_10207165 | Ga0207644_102071652 | 135 |
| 60 | 3300025934 | Ga0207686_10878019 | Ga0207686_108780192 | 135 |
| 61 | 3300025942 | Ga0207689_10190217 | Ga0207689_101902172 | 135 |
| 62 | 3300025942 | Ga0207689_10195074 | Ga0207689_101950743 | 135 |
| 63 | 3300025949 | Ga0207667_10215850 | Ga0207667_102158502 | 135 |
| 64 | 3300026035 | Ga0207703_10001826 | Ga0207703_1000182612 | 135 |
| 65 | 3300026041 | Ga0207639_11816727 | Ga0207639_118167271 | 135 |
| 66 | 3300026088 | Ga0207641_10012642 | Ga0207641_100126426 | 135 |
| 67 | 3300031456 | Ga0307513_10719127 | Ga0307513_107191271 | 135 |
| 68 | 3300031507 | Ga0307509_10276376 | Ga0307509_102763761 | 135 |
| 69 | 3300031616 | Ga0307508_10000011 | Ga0307508_1000001177 | 135 |
| 70 | 3300041453 | Ga0451797_0048517 | Ga0451797_0048517_120_527 | 135 |
| 71 | 3300046528 | Ga0495642_0025899 | Ga0495642_0025899_328_735 | 135 |
| 72 | 3300048927 | Ga0496124_0555524 | Ga0496124_0555524_295_702 | 135 |
| 73 | 3300053104 | Ga0500556_0157902 | Ga0500556_0157902_86_493 | 135 |
| 74 | 3300053119 | Ga0500595_006182 | Ga0500595_006182_2729_3136 | 135 |
| 75 | 3300053136 | Ga0500559_0046463 | Ga0500559_0046463_1226_1633 | 135 |
| 76 | 3300009148 | Ga0105243_10237880 | Ga0105243_102378801 | 136 |
| 77 | 3300046460 | Ga0495638_0323508 | Ga0495638_0323508_109_519 | 136 |
| 78 | 3300046506 | Ga0495583_0037275 | Ga0495583_0037275_486_896 | 136 |
| 79 | 3300046507 | Ga0495606_0007432 | Ga0495606_0007432_1719_2129 | 136 |
| 80 | 3300046513 | Ga0495616_0143758 | Ga0495616_0143758_545_955 | 136 |
| 81 | 3300049822 | Ga0501035_0415637 | Ga0501035_0415637_119_538 | 136 |
| 82 | 3300053156 | Ga0500622_0000119 | Ga0500622_0000119_14735_15145 | 136 |
| 83 | 3300005327 | Ga0070658_10005023 | Ga0070658_100050233 | 137 |
| 84 | 3300005335 | Ga0070666_10000005 | Ga0070666_1000000538 | 137 |
| 85 | 3300005367 | Ga0070667_100075442 | Ga0070667_1000754421 | 137 |
| 86 | 3300005539 | Ga0068853_101292110 | Ga0068853_1012921102 | 137 |
| 87 | 3300005548 | Ga0070665_100009525 | Ga0070665_1000095257 | 137 |
| 88 | 3300009551 | Ga0105238_10000783 | Ga0105238_100007835 | 137 |
| 89 | 3300013306 | Ga0163162_10000281 | Ga0163162_1000028110 | 137 |
| 90 | 3300025903 | Ga0207680_10000005 | Ga0207680_10000005394 | 137 |
| 91 | 3300025909 | Ga0207705_10016812 | Ga0207705_100168123 | 137 |
| 92 | 3300025924 | Ga0207694_10000916 | Ga0207694_100009165 | 137 |
| 93 | 3300026035 | Ga0207703_10342824 | Ga0207703_103428242 | 137 |
| 94 | 3300026041 | Ga0207639_10466640 | Ga0207639_104666402 | 137 |
| 95 | 3300028379 | Ga0268266_10000004 | Ga0268266_100000041136 | 137 |
| 96 | 3300031824 | Ga0307413_10365443 | Ga0307413_103654432 | 137 |
| 97 | 3300031852 | Ga0307410_10074624 | Ga0307410_100746243 | 137 |
| 98 | 3300031903 | Ga0307407_10024299 | Ga0307407_100242992 | 137 |
| 99 | 3300032126 | Ga0307415_100221893 | Ga0307415_1002218931 | 137 |
| 100 | 3300033180 | Ga0307510_10006365 | Ga0307510_100063659 | 137 |
| 101 | 3300044673 | Ga0453683_0227877 | Ga0453683_0227877_297_710 | 137 |
| 102 | 3300048928 | Ga0496125_0078061 | Ga0496125_0078061_1666_2085 | 137 |
| 103 | 3300048929 | Ga0496126_0002266 | Ga0496126_0002266_26086_26505 | 137 |
| 104 | 3300053730 | Ga0500645_001905 | Ga0500645_001905_5362_5775 | 137 |
| 105 | 3300003215 | JGI25153J46596_10000034 | JGI25153J46596_10000034185 | 138 |
| 106 | 3300003759 | Ga0055525_1000139 | Ga0055525_10001395 | 138 |
| 107 | 3300005336 | Ga0070680_100342231 | Ga0070680_1003422312 | 138 |
| 108 | 3300005366 | Ga0070659_100041985 | Ga0070659_1000419853 | 138 |
| 109 | 3300005366 | Ga0070659_101252604 | Ga0070659_1012526041 | 138 |
| 110 | 3300005440 | Ga0070705_100097159 | Ga0070705_1000971591 | 138 |
| 111 | 3300005457 | Ga0070662_100344229 | Ga0070662_1003442292 | 138 |
| 112 | 3300005457 | Ga0070662_100401777 | Ga0070662_1004017772 | 138 |
| 113 | 3300005458 | Ga0070681_10100878 | Ga0070681_101008783 | 138 |
| 114 | 3300005530 | Ga0070679_100228597 | Ga0070679_1002285972 | 138 |
| 115 | 3300005539 | Ga0068853_100021085 | Ga0068853_1000210856 | 138 |
| 116 | 3300005539 | Ga0068853_100067451 | Ga0068853_1000674513 | 138 |
| 117 | 3300005548 | Ga0070665_100000043 | Ga0070665_10000004373 | 138 |
| 118 | 3300005563 | Ga0068855_100449430 | Ga0068855_1004494303 | 138 |
| 119 | 3300005577 | Ga0068857_100106619 | Ga0068857_1001066193 | 138 |
| 120 | 3300005578 | Ga0068854_100312446 | Ga0068854_1003124461 | 138 |
| 121 | 3300005615 | Ga0070702_100142830 | Ga0070702_1001428302 | 138 |
| 122 | 3300005843 | Ga0068860_100002577 | Ga0068860_10000257719 | 138 |
| 123 | 3300009098 | Ga0105245_11012811 | Ga0105245_110128112 | 138 |
| 124 | 3300010375 | Ga0105239_11799373 | Ga0105239_117993732 | 138 |
| 125 | 3300013105 | Ga0157369_10081582 | Ga0157369_100815823 | 138 |
| 126 | 3300013307 | Ga0157372_10104723 | Ga0157372_101047232 | 138 |
| 127 | 3300025230 | Ga0209563_100070 | Ga0209563_100070156 | 138 |
| 128 | 3300025297 | Ga0209758_1000007 | Ga0209758_1000007656 | 138 |
| 129 | 3300025917 | Ga0207660_10297721 | Ga0207660_102977212 | 138 |
| 130 | 3300025919 | Ga0207657_10091438 | Ga0207657_100914383 | 138 |
| 131 | 3300025921 | Ga0207652_10033635 | Ga0207652_100336351 | 138 |
| 132 | 3300025933 | Ga0207706_10009115 | Ga0207706_1000911512 | 138 |
| 133 | 3300025933 | Ga0207706_10023591 | Ga0207706_100235913 | 138 |
| 134 | 3300025945 | Ga0207679_10073273 | Ga0207679_100732732 | 138 |
| 135 | 3300025949 | Ga0207667_10354457 | Ga0207667_103544572 | 138 |
| 136 | 3300025981 | Ga0207640_10395889 | Ga0207640_103958892 | 138 |
| 137 | 3300026041 | Ga0207639_10010872 | Ga0207639_100108727 | 138 |
| 138 | 3300026116 | Ga0207674_10047557 | Ga0207674_100475573 | 138 |
| 139 | 3300026116 | Ga0207674_10052820 | Ga0207674_100528203 | 138 |
| 140 | 3300028379 | Ga0268266_10000002 | Ga0268266_10000002517 | 138 |
| 141 | 3300028381 | Ga0268264_10002128 | Ga0268264_100021283 | 138 |
| 142 | 3300028653 | Ga0265323_10009782 | Ga0265323_100097823 | 138 |
| 143 | 3300028786 | Ga0307517_10026118 | Ga0307517_1002611811 | 138 |
| 144 | 3300031507 | Ga0307509_10794621 | Ga0307509_107946211 | 138 |
| 145 | 3300031728 | Ga0316578_10340962 | Ga0316578_103409622 | 138 |
| 146 | 3300035695 | Ga0373927_0586581 | Ga0373927_0586581_260_691 | 138 |
| 147 | 3300037312 | Ga0395899_0482412 | Ga0395899_0482412_334_756 | 138 |
| 148 | 3300037471 | Ga0395905_0480258 | Ga0395905_0480258_474_896 | 138 |
| 149 | 3300039062 | Ga0400483_080023 | Ga0400483_080023_407_838 | 138 |
| 150 | 3300042876 | Ga0451577_0002265 | Ga0451577_0002265_17126_17548 | 138 |
| 151 | 3300044673 | Ga0453683_0153376 | Ga0453683_0153376_110_532 | 138 |
| 152 | 3300044683 | Ga0466965_0661411 | Ga0466965_0661411_119_538 | 138 |
| 153 | 3300044712 | Ga0453684_0000095 | Ga0453684_0000095_363222_363644 | 138 |
| 154 | 3300044712 | Ga0453684_0188340 | Ga0453684_0188340_1362_1784 | 138 |
| 155 | 3300044712 | Ga0453684_1100560 | Ga0453684_1100560_391_813 | 138 |
| 156 | 3300045051 | Ga0451576_0004396 | Ga0451576_0004396_12074_12496 | 138 |
| 157 | 3300046471 | Ga0495650_0005912 | Ga0495650_0005912_4486_4902 | 138 |
| 158 | 3300046492 | Ga0495585_0165192 | Ga0495585_0165192_620_1036 | 138 |
| 159 | 3300046506 | Ga0495583_0000311 | Ga0495583_0000311_3457_3873 | 138 |
| 160 | 3300046524 | Ga0495648_0002467 | Ga0495648_0002467_4176_4592 | 138 |
| 161 | 3300046558 | Ga0495633_0151947 | Ga0495633_0151947_531_947 | 138 |
| 162 | 3300046660 | Ga0495625_0054479 | Ga0495625_0054479_2234_2662 | 138 |
| 163 | 3300046809 | Ga0495600_0068983 | Ga0495600_0068983_1414_1830 | 138 |
| 164 | 3300049522 | Ga0501299_090740 | Ga0501299_090740_67_489 | 138 |
| 165 | 3300049760 | Ga0501263_095808 | Ga0501263_095808_16_435 | 138 |
| 166 | 3300053090 | Ga0500646_0239269 | Ga0500646_0239269_105_533 | 138 |
| 167 | 3300003762 | Ga0055542_1000012 | Ga0055542_100001264 | 139 |
| 168 | 3300003763 | Ga0055529_1000004 | Ga0055529_1000004207 | 139 |
| 169 | 3300005262 | Ga0065165_1040146 | Ga0065165_10401463 | 139 |
| 170 | 3300005543 | Ga0070672_100124991 | Ga0070672_1001249912 | 139 |
| 171 | 3300025254 | Ga0209148_1000008 | Ga0209148_1000008697 | 139 |
| 172 | 3300025272 | Ga0209455_1000002 | Ga0209455_1000002727 | 139 |
| 173 | 3300025904 | Ga0207647_10017043 | Ga0207647_100170437 | 139 |
| 174 | 3300025940 | Ga0207691_10136916 | Ga0207691_101369163 | 139 |
| 175 | 3300026118 | Ga0207675_102085696 | Ga0207675_1020856962 | 139 |
| 176 | 3300031456 | Ga0307513_10112282 | Ga0307513_101122823 | 139 |
| 177 | 3300037312 | Ga0395899_0078399 | Ga0395899_0078399_320_739 | 139 |
| 178 | 3300046491 | Ga0495584_0196913 | Ga0495584_0196913_297_716 | 139 |
| 179 | 3300046492 | Ga0495585_0012921 | Ga0495585_0012921_3462_3881 | 139 |
| 180 | 3300046500 | Ga0495596_0006093 | Ga0495596_0006093_1246_1665 | 139 |
| 181 | 3300046506 | Ga0495583_0002358 | Ga0495583_0002358_1687_2106 | 139 |
| 182 | 3300046506 | Ga0495583_0040307 | Ga0495583_0040307_1021_1440 | 139 |
| 183 | 3300046506 | Ga0495583_0104352 | Ga0495583_0104352_636_1055 | 139 |
| 184 | 3300046506 | Ga0495583_0406796 | Ga0495583_0406796_62_481 | 139 |
| 185 | 3300046518 | Ga0495631_0003238 | Ga0495631_0003238_962_1381 | 139 |
| 186 | 3300046518 | Ga0495631_0148834 | Ga0495631_0148834_544_963 | 139 |
| 187 | 3300046520 | Ga0495637_0076975 | Ga0495637_0076975_530_949 | 139 |
| 188 | 3300046522 | Ga0495643_0008103 | Ga0495643_0008103_2244_2663 | 139 |
| 189 | 3300046522 | Ga0495643_0009167 | Ga0495643_0009167_943_1362 | 139 |
| 190 | 3300046524 | Ga0495648_0092702 | Ga0495648_0092702_367_786 | 139 |
| 191 | 3300046525 | Ga0495663_0001846 | Ga0495663_0001846_5059_5478 | 139 |
| 192 | 3300046557 | Ga0495622_0178921 | Ga0495622_0178921_129_608 | 139 |
| 193 | 3300046558 | Ga0495633_0000538 | Ga0495633_0000538_35274_35693 | 139 |
| 194 | 3300046616 | Ga0495668_0000468 | Ga0495668_0000468_4084_4503 | 139 |
| 195 | 3300046660 | Ga0495625_0002092 | Ga0495625_0002092_2275_2694 | 139 |
| 196 | 3300046660 | Ga0495625_0061872 | Ga0495625_0061872_334_753 | 139 |
| 197 | 3300046660 | Ga0495625_0257825 | Ga0495625_0257825_497_916 | 139 |
| 198 | 3300046684 | Ga0495669_0000118 | Ga0495669_0000118_47259_47678 | 139 |
| 199 | 3300046691 | Ga0495670_0066689 | Ga0495670_0066689_924_1343 | 139 |
| 200 | 3300046810 | Ga0495660_0047984 | Ga0495660_0047984_1148_1567 | 139 |
| 201 | 3300046810 | Ga0495660_0076645 | Ga0495660_0076645_393_812 | 139 |
| 202 | 3300047323 | Ga0495683_0008964 | Ga0495683_0008964_3620_4039 | 139 |
| 203 | 3300047323 | Ga0495683_0060632 | Ga0495683_0060632_471_890 | 139 |
| 204 | 3300047445 | Ga0495677_0012361 | Ga0495677_0012361_814_1233 | 139 |
| 205 | 3300047470 | Ga0495681_0032858 | Ga0495681_0032858_1982_2401 | 139 |
| 206 | 3300047470 | Ga0495681_0181770 | Ga0495681_0181770_355_774 | 139 |
| 207 | 3300048904 | Ga0496101_0156255 | Ga0496101_0156255_625_1044 | 139 |
| 208 | 3300048905 | Ga0496102_0000022 | Ga0496102_0000022_1986_2405 | 139 |
| 209 | 3300048906 | Ga0496103_0000075 | Ga0496103_0000075_2222_2641 | 139 |
| 210 | 3300048908 | Ga0496105_0021589 | Ga0496105_0021589_2855_3274 | 139 |
| 211 | 3300048910 | Ga0496107_0259453 | Ga0496107_0259453_805_1224 | 139 |
| 212 | 3300048913 | Ga0496110_0035849 | Ga0496110_0035849_1882_2301 | 139 |
| 213 | 3300048914 | Ga0496111_0016874 | Ga0496111_0016874_2832_3251 | 139 |
| 214 | 3300048916 | Ga0496113_0329504 | Ga0496113_0329504_86_505 | 139 |
| 215 | 3300048917 | Ga0496114_0036720 | Ga0496114_0036720_784_1203 | 139 |
| 216 | 3300048918 | Ga0496115_0017647 | Ga0496115_0017647_2189_2608 | 139 |
| 217 | 3300048920 | Ga0496117_0010437 | Ga0496117_0010437_2389_2808 | 139 |
| 218 | 3300048921 | Ga0496118_0000039 | Ga0496118_0000039_92883_93302 | 139 |
| 219 | 3300048922 | Ga0496119_0017347 | Ga0496119_0017347_2903_3322 | 139 |
| 220 | 3300048923 | Ga0496120_0043007 | Ga0496120_0043007_2199_2618 | 139 |
| 221 | 3300048924 | Ga0496121_0024276 | Ga0496121_0024276_2532_2951 | 139 |
| 222 | 3300048926 | Ga0496123_0186963 | Ga0496123_0186963_635_1054 | 139 |
| 223 | 3300048927 | Ga0496124_0000076 | Ga0496124_0000076_213198_213617 | 139 |
| 224 | 3300048928 | Ga0496125_0011759 | Ga0496125_0011759_5690_6109 | 139 |
| 225 | 3300048929 | Ga0496126_0023885 | Ga0496126_0023885_2929_3348 | 139 |
| 226 | 3300053079 | Ga0500610_0000255 | Ga0500610_0000255_1666_2085 | 139 |
| 227 | 3300053119 | Ga0500595_004149 | Ga0500595_004149_1399_1878 | 139 |
| 228 | 3300053177 | Ga0500636_0180105 | Ga0500636_0180105_671_1090 | 139 |
| 229 | 3300053735 | Ga0500596_003834 | Ga0500596_003834_935_1354 | 139 |
| 230 | 3300055283 | Ga0500661_009279 | Ga0500661_009279_893_1312 | 139 |
| 231 | 3300002077 | JGI24744J21845_10003363 | JGI24744J21845_100033631 | 140 |
| 232 | 3300005327 | Ga0070658_10625634 | Ga0070658_106256342 | 140 |
| 233 | 3300005328 | Ga0070676_10315565 | Ga0070676_103155651 | 140 |
| 234 | 3300005338 | Ga0068868_100026949 | Ga0068868_1000269496 | 140 |
| 235 | 3300005339 | Ga0070660_100214044 | Ga0070660_1002140442 | 140 |
| 236 | 3300005356 | Ga0070674_100000483 | Ga0070674_1000004835 | 140 |
| 237 | 3300005364 | Ga0070673_100183596 | Ga0070673_1001835961 | 140 |
| 238 | 3300005456 | Ga0070678_100001925 | Ga0070678_1000019254 | 140 |
| 239 | 3300006358 | Ga0068871_100048888 | Ga0068871_1000488883 | 140 |
| 240 | 3300009036 | Ga0105244_10157867 | Ga0105244_101578673 | 140 |
| 241 | 3300009148 | Ga0105243_10001132 | Ga0105243_1000113226 | 140 |
| 242 | 3300011119 | Ga0105246_10325869 | Ga0105246_103258692 | 140 |
| 243 | 3300013105 | Ga0157369_10996912 | Ga0157369_109969122 | 140 |
| 244 | 3300014969 | Ga0157376_10115387 | Ga0157376_101153874 | 140 |
| 245 | 3300025907 | Ga0207645_10403045 | Ga0207645_104030451 | 140 |
| 246 | 3300025919 | Ga0207657_10262799 | Ga0207657_102627993 | 140 |
| 247 | 3300025935 | Ga0207709_10000005 | Ga0207709_10000005402 | 140 |
| 248 | 3300025937 | Ga0207669_10008360 | Ga0207669_100083605 | 140 |
| 249 | 3300025960 | Ga0207651_11286474 | Ga0207651_112864741 | 140 |
| 250 | 3300026023 | Ga0207677_11269692 | Ga0207677_112696922 | 140 |
| 251 | 3300026121 | Ga0207683_10005199 | Ga0207683_1000519911 | 140 |
| 252 | 3300041443 | Ga0451789_0134399 | Ga0451789_0134399_63_485 | 140 |
| 253 | 3300046491 | Ga0495584_0052588 | Ga0495584_0052588_297_719 | 140 |
| 254 | 3300046506 | Ga0495583_0113324 | Ga0495583_0113324_713_1135 | 140 |
| 255 | 3300046507 | Ga0495606_0050184 | Ga0495606_0050184_1838_2260 | 140 |
| 256 | 3300046522 | Ga0495643_0061582 | Ga0495643_0061582_48_470 | 140 |
| 257 | 3300046648 | Ga0495611_0016361 | Ga0495611_0016361_925_1347 | 140 |
| 258 | 3300046648 | Ga0495611_0044388 | Ga0495611_0044388_1038_1463 | 140 |
| 259 | 3300046660 | Ga0495625_0017622 | Ga0495625_0017622_2235_2657 | 140 |
| 260 | 3300046694 | Ga0495649_0369617 | Ga0495649_0369617_273_695 | 140 |
| 261 | 3300047443 | Ga0495687_000499 | Ga0495687_000499_44853_45275 | 140 |
| 262 | 3300053136 | Ga0500559_0003593 | Ga0500559_0003593_3106_3558 | 140 |
| 263 | 3300053730 | Ga0500645_000003 | Ga0500645_000003_2206_2628 | 140 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5ump-assembly1.cif.gz_B | crystal structure of tnms3, an antibiotic binding protein from streptomyces sp. cb03234 | 0.8702 | 2 | 132 |
| 5umw-assembly2.cif.gz_B | crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 | 0.8515 | 2 | 129 |
| 5ump-assembly1.cif.gz_B | crystal structure of tnms3, an antibiotic binding protein from streptomyces sp. cb03234 | 0.8436 | 2 | 132 |
| 6cky-assembly1.cif.gz_B | crystal structure of ucms2 | 0.8366 | 1 | 129 |
| 5umw-assembly3.cif.gz_D | crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 | 0.8309 | 1 | 129 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3itwA02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.9016 | 82 | 132 | 3.30.720.110 |
| 3m2oB02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8653 | 80 | 129 | 3.30.720.110 |
| 5uhjB00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8382 | 3 | 132 | 3.10.180.10 |
| 3itwB02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8356 | 82 | 133 | 3.30.720.110 |
| 5ujpB00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8302 | 4 | 130 | 3.10.180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7D5UW52-F1-model_v4 | VOC domain-containing protein | 0.972 | 1 | 132 |
|
| AF-A0A1Y2QN79-F1-model_v4 | Glyoxalase | 0.9698 | 2 | 132 |
|
| AF-A0A2S6HXD3-F1-model_v4 | Catechol 2,3-dioxygenase-like lactoylglutathione lyase family enzyme | 0.9684 | 1 | 136 |
GO:0016829
GO:0051213 |
| AF-A0A1L8TP16-F1-model_v4 | VOC domain-containing protein | 0.9674 | 1 | 136 |
|
| AF-W4L6D7-F1-model_v4 | VOC domain-containing protein | 0.9667 | 1 | 132 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar