F371868

General Info

Members Datasets Scaffolds Average Seq Length
263 190 259 139

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_10996912|Ga0157369_109969122
Length 164
Sequence MLAMYDNLYKFAMALPSARRYKWRMQTHLAHIALVVRDYDEAIAFYVGKLGFALVEDTYQPEQDKRWVTIRPPGAPANATTILLARASNAHQAKYIGDQAGGRVFLFLATDDFDRDHAAFTAAGVEWARPPAMYDYGKVAVFLDLYGNRWDLVQFAEGHPGAAT

Samples

Sample ID Description Type Environment
1 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
2 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
3 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
4 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
10 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
11 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
12 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
13 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
64 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
67 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
72 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
105 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
106 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
107 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
108 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
109 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
110 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
111 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
112 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
113 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
114 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
115 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
116 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
117 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
120 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
121 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
122 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
123 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
124 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
125 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
126 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
127 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
128 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
129 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
130 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
131 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
132 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
133 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
134 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
135 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
136 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
137 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
138 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
139 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
140 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
141 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
142 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
143 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
144 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
145 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
146 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
147 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
148 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
149 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
150 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
151 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
152 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
153 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
154 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
155 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
156 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
157 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
158 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
159 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
160 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
161 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
162 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
163 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
164 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
165 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
166 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
167 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
168 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
169 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
170 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
171 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
172 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
173 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
174 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
175 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
176 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
177 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
179 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
180 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
181 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
182 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
183 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
184 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
185 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
186 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
187 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
188 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
189 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
190 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.48
Metatranscriptomes 0
Isolates 1.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.69
Nodule 0
Rhizoplane 4.56
Rhizosphere 72.62
Stem 0
Stem Tuber 0
Unclassified 9.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10003363 3300002077 Bacteria 3285
2 JGI25165J46597_1000010 3300003214 Bacteria 442113
3 JGI25153J46596_10000034 3300003215 Bacteria 192215
4 rootL2_10043363 3300003322 Bacteria 1744
5 Ga0055525_1000139 3300003759 Bacteria 102623
6 Ga0055542_1000012 3300003762 Bacteria 391808
7 Ga0055529_1000004 3300003763 Bacteria 433331
8 Ga0055526_1016494 3300003771 Bacteria 2884
9 Ga0055537_1005862 3300003773 Bacteria 3215
10 Ga0065165_1040146 3300005262 Bacteria 1398
11 Ga0070658_10005023 3300005327 Bacteria 10770
12 Ga0070658_10472364 3300005327 Bacteria 1082
13 Ga0070658_10625634 3300005327 Bacteria 934
14 Ga0070676_10315565 3300005328 Bacteria 1064
15 Ga0068869_100324139 3300005334 Bacteria 1250
16 Ga0070666_10000005 3300005335 Bacteria 343092
17 Ga0070680_100342231 3300005336 Bacteria 1271
18 Ga0068868_100026949 3300005338 Bacteria 4382
19 Ga0070660_100214044 3300005339 Bacteria 1565
20 Ga0070674_100000483 3300005356 Bacteria 20099
21 Ga0070673_100183596 3300005364 Bacteria 1792
22 Ga0070659_100041985 3300005366 Bacteria 3576
23 Ga0070659_101252604 3300005366 Unclassified 657
24 Ga0070667_100075442 3300005367 Bacteria 2879
25 Ga0070705_100097159 3300005440 Bacteria 1851
26 Ga0070678_100001925 3300005456 Bacteria 11196
27 Ga0070662_100344229 3300005457 Bacteria 1220
28 Ga0070662_100401777 3300005457 Bacteria 1131
29 Ga0070681_10100878 3300005458 Bacteria 2832
30 Ga0070679_100228597 3300005530 Unclassified 1820
31 Ga0070679_100414133 3300005530 Bacteria 1293
32 Ga0068853_100021085 3300005539 Bacteria 5425
33 Ga0068853_100067451 3300005539 Bacteria 3108
34 Ga0068853_101292110 3300005539 Bacteria 705
35 Ga0070672_100124991 3300005543 Bacteria 2109
36 Ga0070665_100000043 3300005548 Bacteria 279774
37 Ga0070665_100009525 3300005548 Bacteria 9825
38 Ga0068855_100449430 3300005563 Unclassified 1406
39 Ga0068855_100703920 3300005563 Bacteria 1081
40 Ga0068857_100106619 3300005577 Unclassified 2516
41 Ga0068854_100312446 3300005578 Unclassified 1275
42 Ga0070702_100142830 3300005615 Bacteria 1527
43 Ga0068852_100424469 3300005616 Bacteria 1312
44 Ga0068852_101317251 3300005616 Bacteria 744
45 Ga0068859_100781323 3300005617 Bacteria 1043
46 Ga0068861_100000269 3300005719 Bacteria 29033
47 Ga0068863_100019204 3300005841 Bacteria 6543
48 Ga0068858_100000274 3300005842 Bacteria 55319
49 Ga0068860_100002577 3300005843 Bacteria 18971
50 Ga0075367_11052202 3300006178 Bacteria 520
51 Ga0097621_100457004 3300006237 Bacteria 1151
52 Ga0068871_100048888 3300006358 Bacteria 3416
53 Ga0068871_100099863 3300006358 Bacteria 2430
54 Ga0097620_100781395 3300006931 Bacteria 1043
55 Ga0105244_10157867 3300009036 Bacteria 1084
56 Ga0105245_10070457 3300009098 Bacteria 3173
57 Ga0105245_11012811 3300009098 Unclassified 875
58 Ga0105243_10001132 3300009148 Bacteria 24182
59 Ga0105243_10237880 3300009148 Bacteria 1619
60 Ga0105242_11503698 3300009176 Bacteria 704
61 Ga0105238_10000783 3300009551 Bacteria 33020
62 Ga0105238_10021033 3300009551 Bacteria 6648
63 Ga0105239_11799373 3300010375 Unclassified 710
64 Ga0105246_10325869 3300011119 Bacteria 1250
65 Ga0157370_11641253 3300013104 Bacteria 577
66 Ga0157369_10081582 3300013105 Bacteria 3461
67 Ga0157369_10996912 3300013105 Bacteria 858
68 Ga0157374_10110173 3300013296 Bacteria 2648
69 Ga0157378_10037118 3300013297 Bacteria 4315
70 Ga0157378_10119000 3300013297 Bacteria 2432
71 Ga0163162_10000281 3300013306 Bacteria 46556
72 Ga0163162_10121746 3300013306 Bacteria 2714
73 Ga0157372_10104723 3300013307 Unclassified 3235
74 Ga0157376_10115387 3300014969 Bacteria 2371
75 Ga0209563_100070 3300025230 Bacteria 249779
76 Ga0209437_105836 3300025233 Bacteria 2081
77 Ga0209677_105094 3300025253 Bacteria 3543
78 Ga0209148_1000008 3300025254 Bacteria 1504371
79 Ga0209233_1000044 3300025261 Bacteria 489783
80 Ga0209565_1000052 3300025263 Bacteria 212056
81 Ga0209455_1000002 3300025272 Bacteria 1505459
82 Ga0209673_1022598 3300025273 Bacteria 2165
83 Ga0209564_1007179 3300025295 Bacteria 5807
84 Ga0209758_1000007 3300025297 Bacteria 1270410
85 Ga0209050_1018318 3300025298 Bacteria 2728
86 Ga0209257_1074493 3300025304 Bacteria 886
87 Ga0207680_10000005 3300025903 Bacteria 660983
88 Ga0207647_10017043 3300025904 Bacteria 4945
89 Ga0207645_10403045 3300025907 Bacteria 920
90 Ga0207705_10016812 3300025909 Bacteria 5239
91 Ga0207705_11413385 3300025909 Bacteria 529
92 Ga0207660_10297721 3300025917 Unclassified 1284
93 Ga0207657_10091438 3300025919 Unclassified 2537
94 Ga0207657_10262799 3300025919 Bacteria 1373
95 Ga0207652_10033635 3300025921 Unclassified 4318
96 Ga0207694_10000916 3300025924 Bacteria 26125
97 Ga0207694_10005116 3300025924 Bacteria 10122
98 Ga0207687_10065192 3300025927 Bacteria 2586
99 Ga0207644_10207165 3300025931 Bacteria 1549
100 Ga0207706_10009115 3300025933 Bacteria 9125
101 Ga0207706_10023591 3300025933 Bacteria 5523
102 Ga0207686_10878019 3300025934 Bacteria 723
103 Ga0207709_10000005 3300025935 Bacteria 806813
104 Ga0207669_10008360 3300025937 Bacteria 4853
105 Ga0207691_10136916 3300025940 Bacteria 2159
106 Ga0207689_10190217 3300025942 Bacteria 1693
107 Ga0207689_10195074 3300025942 Bacteria 1671
108 Ga0207679_10073273 3300025945 Unclassified 2590
109 Ga0207667_10215850 3300025949 Bacteria 1966
110 Ga0207667_10354457 3300025949 Unclassified 1496
111 Ga0207667_11685654 3300025949 Bacteria 601
112 Ga0207651_11286474 3300025960 Bacteria 657
113 Ga0207640_10395889 3300025981 Unclassified 1123
114 Ga0207677_11269692 3300026023 Bacteria 676
115 Ga0207703_10001826 3300026035 Bacteria 18987
116 Ga0207703_10342824 3300026035 Bacteria 1374
117 Ga0207639_10010872 3300026041 Bacteria 6312
118 Ga0207639_10466640 3300026041 Bacteria 1149
119 Ga0207639_11816727 3300026041 Bacteria 570
120 Ga0207641_10012642 3300026088 Bacteria 6923
121 Ga0207674_10047557 3300026116 Unclassified 4396
122 Ga0207674_10052820 3300026116 Unclassified 4144
123 Ga0207675_100000856 3300026118 Bacteria 30350
124 Ga0207675_102085696 3300026118 Bacteria 584
125 Ga0207683_10005199 3300026121 Bacteria 11175
126 Ga0207698_11662142 3300026142 Bacteria 654
127 Ga0268266_10000002 3300028379 Bacteria 3059047
128 Ga0268266_10000004 3300028379 Bacteria 1495817
129 Ga0268264_10002128 3300028381 Bacteria 17665
130 Ga0265323_10009782 3300028653 Bacteria 3903
131 Ga0307517_10026118 3300028786 Bacteria 7094
132 Ga0307517_10101331 3300028786 Bacteria 2267
133 Ga0307513_10112282 3300031456 Bacteria 2716
134 Ga0307513_10719127 3300031456 Bacteria 704
135 Ga0307509_10276376 3300031507 Bacteria 1444
136 Ga0307509_10794621 3300031507 Bacteria 611
137 Ga0307508_10000011 3300031616 Bacteria 248001
138 Ga0316578_10340962 3300031728 Bacteria 893
139 Ga0307413_10365443 3300031824 Bacteria 1119
140 Ga0307410_10074624 3300031852 Bacteria 2363
141 Ga0307406_10519215 3300031901 Bacteria 969
142 Ga0307407_10024299 3300031903 Bacteria 3176
143 Ga0307415_100221893 3300032126 Bacteria 1516
144 Ga0307415_100583456 3300032126 Bacteria 992
145 Ga0307510_10006365 3300033180 Bacteria 14082
146 Ga0373927_0586581 3300035695 Bacteria 737
147 Ga0395899_0078399 3300037312 Bacteria 2408
148 Ga0395899_0482412 3300037312 Bacteria 807
149 Ga0395905_0480258 3300037471 Bacteria 1142
150 Ga0436364_0816896 3300037853 Bacteria 908
151 Ga0400483_080023 3300039062 Bacteria 1025
152 Ga0451789_0134399 3300041443 Bacteria 670
153 Ga0451797_0048517 3300041453 Bacteria 544
154 Ga0451577_0002265 3300042876 Bacteria 23287
155 Ga0453683_0153376 3300044673 Bacteria 1456
156 Ga0453683_0227877 3300044673 Bacteria 1186
157 Ga0466965_0661411 3300044683 Bacteria 597
158 Ga0453684_0000095 3300044712 Bacteria 378681
159 Ga0453684_0000581 3300044712 Bacteria 136088
160 Ga0453684_0188340 3300044712 Unclassified 2416
161 Ga0453684_1100560 3300044712 Bacteria 839
162 Ga0451576_0004396 3300045051 Bacteria 18345
163 Ga0495638_0323508 3300046460 Bacteria 823
164 Ga0495650_0005912 3300046471 Bacteria 7775
165 Ga0495584_0052588 3300046491 Bacteria 2050
166 Ga0495584_0196913 3300046491 Bacteria 1024
167 Ga0495585_0012921 3300046492 Bacteria 4907
168 Ga0495585_0165192 3300046492 Bacteria 1146
169 Ga0495596_0006093 3300046500 Bacteria 5611
170 Ga0495583_0000311 3300046506 Bacteria 76925
171 Ga0495583_0002358 3300046506 Bacteria 16323
172 Ga0495583_0037275 3300046506 Bacteria 2306
173 Ga0495583_0040307 3300046506 Bacteria 2195
174 Ga0495583_0104352 3300046506 Bacteria 1207
175 Ga0495583_0113324 3300046506 Bacteria 1147
176 Ga0495583_0406796 3300046506 Bacteria 534
177 Ga0495606_0007432 3300046507 Bacteria 9812
178 Ga0495606_0050184 3300046507 Bacteria 2731
179 Ga0495606_0079069 3300046507 Bacteria 2049
180 Ga0495616_0143758 3300046513 Bacteria 1084
181 Ga0495631_0003238 3300046518 Bacteria 8953
182 Ga0495631_0148834 3300046518 Bacteria 1004
183 Ga0495637_0076975 3300046520 Bacteria 1336
184 Ga0495643_0008103 3300046522 Bacteria 6695
185 Ga0495643_0009167 3300046522 Bacteria 6179
186 Ga0495643_0061582 3300046522 Bacteria 1989
187 Ga0495648_0002467 3300046524 Bacteria 17023
188 Ga0495648_0092702 3300046524 Bacteria 1686
189 Ga0495663_0001846 3300046525 Bacteria 6531
190 Ga0495642_0025899 3300046528 Bacteria 2327
191 Ga0495622_0178921 3300046557 Bacteria 952
192 Ga0495633_0000538 3300046558 Bacteria 37829
193 Ga0495633_0151947 3300046558 Bacteria 1069
194 Ga0495668_0000468 3300046616 Bacteria 51229
195 Ga0495611_0016361 3300046648 Bacteria 3171
196 Ga0495611_0044388 3300046648 Bacteria 1988
197 Ga0495625_0002092 3300046660 Bacteria 22304
198 Ga0495625_0017622 3300046660 Bacteria 5589
199 Ga0495625_0054479 3300046660 Bacteria 2856
200 Ga0495625_0061872 3300046660 Bacteria 2647
201 Ga0495625_0257825 3300046660 Bacteria 1129
202 Ga0495625_0532009 3300046660 Bacteria 714
203 Ga0495669_0000118 3300046684 Bacteria 51189
204 Ga0495670_0024887 3300046691 Bacteria 2959
205 Ga0495670_0063361 3300046691 Bacteria 1861
206 Ga0495670_0066689 3300046691 Bacteria 1816
207 Ga0495649_0369617 3300046694 Bacteria 723
208 Ga0495600_0068983 3300046809 Bacteria 2311
209 Ga0495660_0047984 3300046810 Bacteria 2336
210 Ga0495660_0076645 3300046810 Bacteria 1761
211 Ga0495683_0008964 3300047323 Bacteria 5338
212 Ga0495683_0060632 3300047323 Bacteria 1874
213 Ga0495687_000499 3300047443 Bacteria 47300
214 Ga0495677_0012361 3300047445 Bacteria 3114
215 Ga0495681_0032858 3300047470 Bacteria 2606
216 Ga0495681_0181770 3300047470 Bacteria 864
217 Ga0495686_0002629 3300047472 Bacteria 16626
218 Ga0495686_0091780 3300047472 Bacteria 1843
219 Ga0496101_0156255 3300048904 Bacteria 1747
220 Ga0496102_0000022 3300048905 Bacteria 246314
221 Ga0496103_0000075 3300048906 Bacteria 114569
222 Ga0496105_0021589 3300048908 Bacteria 5211
223 Ga0496107_0259453 3300048910 Bacteria 1293
224 Ga0496110_0035849 3300048913 Bacteria 4307
225 Ga0496111_0016874 3300048914 Bacteria 5039
226 Ga0496113_0329504 3300048916 Bacteria 1224
227 Ga0496114_0036720 3300048917 Bacteria 4050
228 Ga0496115_0017647 3300048918 Bacteria 5463
229 Ga0496117_0010437 3300048920 Bacteria 8467
230 Ga0496118_0000039 3300048921 Bacteria 305458
231 Ga0496119_0017347 3300048922 Bacteria 5418
232 Ga0496120_0043007 3300048923 Bacteria 2635
233 Ga0496121_0024276 3300048924 Bacteria 5806
234 Ga0496123_0186963 3300048926 Bacteria 1075
235 Ga0496124_0000076 3300048927 Bacteria 215767
236 Ga0496124_0555524 3300048927 Bacteria 757
237 Ga0496125_0011759 3300048928 Bacteria 8724
238 Ga0496125_0078061 3300048928 Bacteria 2548
239 Ga0496126_0002266 3300048929 Bacteria 26518
240 Ga0496126_0023885 3300048929 Bacteria 5913
241 Ga0501299_090740 3300049522 Bacteria 694
242 Ga0501033_0774169 3300049570 Bacteria 650
243 Ga0501263_095808 3300049760 Bacteria 505
244 Ga0501035_0415637 3300049822 Bacteria 1117
245 Ga0500610_0000255 3300053079 Bacteria 16041
246 Ga0500646_0239269 3300053090 Bacteria 635
247 Ga0500556_0157902 3300053104 Bacteria 895
248 Ga0500595_004149 3300053119 Bacteria 6568
249 Ga0500595_006182 3300053119 Bacteria 5123
250 Ga0500559_0002999 3300053136 Bacteria 8459
251 Ga0500559_0003593 3300053136 Bacteria 7581
252 Ga0500559_0046463 3300053136 Bacteria 1904
253 Ga0500616_0007481 3300053153 Bacteria 6929
254 Ga0500622_0000119 3300053156 Bacteria 82219
255 Ga0500636_0180105 3300053177 Bacteria 1135
256 Ga0500645_000003 3300053730 Bacteria 305887
257 Ga0500645_001905 3300053730 Bacteria 9923
258 Ga0500596_003834 3300053735 Bacteria 2816
259 Ga0500661_009279 3300055283 Bacteria 1804

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005530 Ga0070679_100414133 Ga0070679_1004141332 123
2 3300013104 Ga0157370_11641253 Ga0157370_116412531 123
3 3300013297 Ga0157378_10037118 Ga0157378_100371184 131
4 3300025253 Ga0209677_105094 Ga0209677_1050943 132
5 3300046507 Ga0495606_0079069 Ga0495606_0079069_616_1032 132
6 3300047472 Ga0495686_0091780 Ga0495686_0091780_393_806 132
7 3300003771 Ga0055526_1016494 Ga0055526_10164942 133
8 3300003773 Ga0055537_1005862 Ga0055537_10058622 133
9 3300025263 Ga0209565_1000052 Ga0209565_1000052133 133
10 3300025273 Ga0209673_1022598 Ga0209673_10225983 133
11 3300025295 Ga0209564_1007179 Ga0209564_10071794 133
12 3300025298 Ga0209050_1018318 Ga0209050_10183184 133
13 3300025304 Ga0209257_1074493 Ga0209257_10744932 133
14 3300028786 Ga0307517_10101331 Ga0307517_101013314 133
15 3300031901 Ga0307406_10519215 Ga0307406_105192152 133
16 3300032126 Ga0307415_100583456 Ga0307415_1005834562 133
17 3300037853 Ga0436364_0816896 Ga0436364_0816896_184_591 133
18 3300044712 Ga0453684_0000581 Ga0453684_0000581_46522_46923 133
19 3300046660 Ga0495625_0532009 Ga0495625_0532009_105_506 133
20 3300046691 Ga0495670_0024887 Ga0495670_0024887_164_565 133
21 3300053136 Ga0500559_0002999 Ga0500559_0002999_6892_7293 133
22 3300005616 Ga0068852_101317251 Ga0068852_1013172512 134
23 3300005719 Ga0068861_100000269 Ga0068861_10000026911 134
24 3300025949 Ga0207667_11685654 Ga0207667_116856541 134
25 3300026118 Ga0207675_100000856 Ga0207675_10000085611 134
26 3300026142 Ga0207698_11662142 Ga0207698_116621422 134
27 3300046691 Ga0495670_0063361 Ga0495670_0063361_483_896 134
28 3300047472 Ga0495686_0002629 Ga0495686_0002629_10313_10717 134
29 3300049570 Ga0501033_0774169 Ga0501033_0774169_69_473 134
30 3300053153 Ga0500616_0007481 Ga0500616_0007481_1210_1614 134
31 iso_pu_bacteria 2864733723 2864734979 134
32 iso_pu_bacteria 2889049205 2889049547 134
33 iso_pu_bacteria 2946053406 2946059848 134
34 iso_pu_bacteria 2971403814 2971405589 134
35 3300003214 JGI25165J46597_1000010 JGI25165J46597_1000010166 135
36 3300003322 rootL2_10043363 rootL2_100433631 135
37 3300005327 Ga0070658_10472364 Ga0070658_104723642 135
38 3300005334 Ga0068869_100324139 Ga0068869_1003241392 135
39 3300005563 Ga0068855_100703920 Ga0068855_1007039202 135
40 3300005616 Ga0068852_100424469 Ga0068852_1004244692 135
41 3300005617 Ga0068859_100781323 Ga0068859_1007813232 135
42 3300005841 Ga0068863_100019204 Ga0068863_1000192045 135
43 3300005842 Ga0068858_100000274 Ga0068858_10000027448 135
44 3300006178 Ga0075367_11052202 Ga0075367_110522021 135
45 3300006237 Ga0097621_100457004 Ga0097621_1004570042 135
46 3300006358 Ga0068871_100099863 Ga0068871_1000998631 135
47 3300006931 Ga0097620_100781395 Ga0097620_1007813952 135
48 3300009098 Ga0105245_10070457 Ga0105245_100704574 135
49 3300009176 Ga0105242_11503698 Ga0105242_115036981 135
50 3300009551 Ga0105238_10021033 Ga0105238_100210337 135
51 3300013296 Ga0157374_10110173 Ga0157374_101101733 135
52 3300013297 Ga0157378_10119000 Ga0157378_101190002 135
53 3300013306 Ga0163162_10121746 Ga0163162_101217464 135
54 3300025233 Ga0209437_105836 Ga0209437_1058363 135
55 3300025261 Ga0209233_1000044 Ga0209233_1000044317 135
56 3300025909 Ga0207705_11413385 Ga0207705_114133851 135
57 3300025924 Ga0207694_10005116 Ga0207694_1000511614 135
58 3300025927 Ga0207687_10065192 Ga0207687_100651922 135
59 3300025931 Ga0207644_10207165 Ga0207644_102071652 135
60 3300025934 Ga0207686_10878019 Ga0207686_108780192 135
61 3300025942 Ga0207689_10190217 Ga0207689_101902172 135
62 3300025942 Ga0207689_10195074 Ga0207689_101950743 135
63 3300025949 Ga0207667_10215850 Ga0207667_102158502 135
64 3300026035 Ga0207703_10001826 Ga0207703_1000182612 135
65 3300026041 Ga0207639_11816727 Ga0207639_118167271 135
66 3300026088 Ga0207641_10012642 Ga0207641_100126426 135
67 3300031456 Ga0307513_10719127 Ga0307513_107191271 135
68 3300031507 Ga0307509_10276376 Ga0307509_102763761 135
69 3300031616 Ga0307508_10000011 Ga0307508_1000001177 135
70 3300041453 Ga0451797_0048517 Ga0451797_0048517_120_527 135
71 3300046528 Ga0495642_0025899 Ga0495642_0025899_328_735 135
72 3300048927 Ga0496124_0555524 Ga0496124_0555524_295_702 135
73 3300053104 Ga0500556_0157902 Ga0500556_0157902_86_493 135
74 3300053119 Ga0500595_006182 Ga0500595_006182_2729_3136 135
75 3300053136 Ga0500559_0046463 Ga0500559_0046463_1226_1633 135
76 3300009148 Ga0105243_10237880 Ga0105243_102378801 136
77 3300046460 Ga0495638_0323508 Ga0495638_0323508_109_519 136
78 3300046506 Ga0495583_0037275 Ga0495583_0037275_486_896 136
79 3300046507 Ga0495606_0007432 Ga0495606_0007432_1719_2129 136
80 3300046513 Ga0495616_0143758 Ga0495616_0143758_545_955 136
81 3300049822 Ga0501035_0415637 Ga0501035_0415637_119_538 136
82 3300053156 Ga0500622_0000119 Ga0500622_0000119_14735_15145 136
83 3300005327 Ga0070658_10005023 Ga0070658_100050233 137
84 3300005335 Ga0070666_10000005 Ga0070666_1000000538 137
85 3300005367 Ga0070667_100075442 Ga0070667_1000754421 137
86 3300005539 Ga0068853_101292110 Ga0068853_1012921102 137
87 3300005548 Ga0070665_100009525 Ga0070665_1000095257 137
88 3300009551 Ga0105238_10000783 Ga0105238_100007835 137
89 3300013306 Ga0163162_10000281 Ga0163162_1000028110 137
90 3300025903 Ga0207680_10000005 Ga0207680_10000005394 137
91 3300025909 Ga0207705_10016812 Ga0207705_100168123 137
92 3300025924 Ga0207694_10000916 Ga0207694_100009165 137
93 3300026035 Ga0207703_10342824 Ga0207703_103428242 137
94 3300026041 Ga0207639_10466640 Ga0207639_104666402 137
95 3300028379 Ga0268266_10000004 Ga0268266_100000041136 137
96 3300031824 Ga0307413_10365443 Ga0307413_103654432 137
97 3300031852 Ga0307410_10074624 Ga0307410_100746243 137
98 3300031903 Ga0307407_10024299 Ga0307407_100242992 137
99 3300032126 Ga0307415_100221893 Ga0307415_1002218931 137
100 3300033180 Ga0307510_10006365 Ga0307510_100063659 137
101 3300044673 Ga0453683_0227877 Ga0453683_0227877_297_710 137
102 3300048928 Ga0496125_0078061 Ga0496125_0078061_1666_2085 137
103 3300048929 Ga0496126_0002266 Ga0496126_0002266_26086_26505 137
104 3300053730 Ga0500645_001905 Ga0500645_001905_5362_5775 137
105 3300003215 JGI25153J46596_10000034 JGI25153J46596_10000034185 138
106 3300003759 Ga0055525_1000139 Ga0055525_10001395 138
107 3300005336 Ga0070680_100342231 Ga0070680_1003422312 138
108 3300005366 Ga0070659_100041985 Ga0070659_1000419853 138
109 3300005366 Ga0070659_101252604 Ga0070659_1012526041 138
110 3300005440 Ga0070705_100097159 Ga0070705_1000971591 138
111 3300005457 Ga0070662_100344229 Ga0070662_1003442292 138
112 3300005457 Ga0070662_100401777 Ga0070662_1004017772 138
113 3300005458 Ga0070681_10100878 Ga0070681_101008783 138
114 3300005530 Ga0070679_100228597 Ga0070679_1002285972 138
115 3300005539 Ga0068853_100021085 Ga0068853_1000210856 138
116 3300005539 Ga0068853_100067451 Ga0068853_1000674513 138
117 3300005548 Ga0070665_100000043 Ga0070665_10000004373 138
118 3300005563 Ga0068855_100449430 Ga0068855_1004494303 138
119 3300005577 Ga0068857_100106619 Ga0068857_1001066193 138
120 3300005578 Ga0068854_100312446 Ga0068854_1003124461 138
121 3300005615 Ga0070702_100142830 Ga0070702_1001428302 138
122 3300005843 Ga0068860_100002577 Ga0068860_10000257719 138
123 3300009098 Ga0105245_11012811 Ga0105245_110128112 138
124 3300010375 Ga0105239_11799373 Ga0105239_117993732 138
125 3300013105 Ga0157369_10081582 Ga0157369_100815823 138
126 3300013307 Ga0157372_10104723 Ga0157372_101047232 138
127 3300025230 Ga0209563_100070 Ga0209563_100070156 138
128 3300025297 Ga0209758_1000007 Ga0209758_1000007656 138
129 3300025917 Ga0207660_10297721 Ga0207660_102977212 138
130 3300025919 Ga0207657_10091438 Ga0207657_100914383 138
131 3300025921 Ga0207652_10033635 Ga0207652_100336351 138
132 3300025933 Ga0207706_10009115 Ga0207706_1000911512 138
133 3300025933 Ga0207706_10023591 Ga0207706_100235913 138
134 3300025945 Ga0207679_10073273 Ga0207679_100732732 138
135 3300025949 Ga0207667_10354457 Ga0207667_103544572 138
136 3300025981 Ga0207640_10395889 Ga0207640_103958892 138
137 3300026041 Ga0207639_10010872 Ga0207639_100108727 138
138 3300026116 Ga0207674_10047557 Ga0207674_100475573 138
139 3300026116 Ga0207674_10052820 Ga0207674_100528203 138
140 3300028379 Ga0268266_10000002 Ga0268266_10000002517 138
141 3300028381 Ga0268264_10002128 Ga0268264_100021283 138
142 3300028653 Ga0265323_10009782 Ga0265323_100097823 138
143 3300028786 Ga0307517_10026118 Ga0307517_1002611811 138
144 3300031507 Ga0307509_10794621 Ga0307509_107946211 138
145 3300031728 Ga0316578_10340962 Ga0316578_103409622 138
146 3300035695 Ga0373927_0586581 Ga0373927_0586581_260_691 138
147 3300037312 Ga0395899_0482412 Ga0395899_0482412_334_756 138
148 3300037471 Ga0395905_0480258 Ga0395905_0480258_474_896 138
149 3300039062 Ga0400483_080023 Ga0400483_080023_407_838 138
150 3300042876 Ga0451577_0002265 Ga0451577_0002265_17126_17548 138
151 3300044673 Ga0453683_0153376 Ga0453683_0153376_110_532 138
152 3300044683 Ga0466965_0661411 Ga0466965_0661411_119_538 138
153 3300044712 Ga0453684_0000095 Ga0453684_0000095_363222_363644 138
154 3300044712 Ga0453684_0188340 Ga0453684_0188340_1362_1784 138
155 3300044712 Ga0453684_1100560 Ga0453684_1100560_391_813 138
156 3300045051 Ga0451576_0004396 Ga0451576_0004396_12074_12496 138
157 3300046471 Ga0495650_0005912 Ga0495650_0005912_4486_4902 138
158 3300046492 Ga0495585_0165192 Ga0495585_0165192_620_1036 138
159 3300046506 Ga0495583_0000311 Ga0495583_0000311_3457_3873 138
160 3300046524 Ga0495648_0002467 Ga0495648_0002467_4176_4592 138
161 3300046558 Ga0495633_0151947 Ga0495633_0151947_531_947 138
162 3300046660 Ga0495625_0054479 Ga0495625_0054479_2234_2662 138
163 3300046809 Ga0495600_0068983 Ga0495600_0068983_1414_1830 138
164 3300049522 Ga0501299_090740 Ga0501299_090740_67_489 138
165 3300049760 Ga0501263_095808 Ga0501263_095808_16_435 138
166 3300053090 Ga0500646_0239269 Ga0500646_0239269_105_533 138
167 3300003762 Ga0055542_1000012 Ga0055542_100001264 139
168 3300003763 Ga0055529_1000004 Ga0055529_1000004207 139
169 3300005262 Ga0065165_1040146 Ga0065165_10401463 139
170 3300005543 Ga0070672_100124991 Ga0070672_1001249912 139
171 3300025254 Ga0209148_1000008 Ga0209148_1000008697 139
172 3300025272 Ga0209455_1000002 Ga0209455_1000002727 139
173 3300025904 Ga0207647_10017043 Ga0207647_100170437 139
174 3300025940 Ga0207691_10136916 Ga0207691_101369163 139
175 3300026118 Ga0207675_102085696 Ga0207675_1020856962 139
176 3300031456 Ga0307513_10112282 Ga0307513_101122823 139
177 3300037312 Ga0395899_0078399 Ga0395899_0078399_320_739 139
178 3300046491 Ga0495584_0196913 Ga0495584_0196913_297_716 139
179 3300046492 Ga0495585_0012921 Ga0495585_0012921_3462_3881 139
180 3300046500 Ga0495596_0006093 Ga0495596_0006093_1246_1665 139
181 3300046506 Ga0495583_0002358 Ga0495583_0002358_1687_2106 139
182 3300046506 Ga0495583_0040307 Ga0495583_0040307_1021_1440 139
183 3300046506 Ga0495583_0104352 Ga0495583_0104352_636_1055 139
184 3300046506 Ga0495583_0406796 Ga0495583_0406796_62_481 139
185 3300046518 Ga0495631_0003238 Ga0495631_0003238_962_1381 139
186 3300046518 Ga0495631_0148834 Ga0495631_0148834_544_963 139
187 3300046520 Ga0495637_0076975 Ga0495637_0076975_530_949 139
188 3300046522 Ga0495643_0008103 Ga0495643_0008103_2244_2663 139
189 3300046522 Ga0495643_0009167 Ga0495643_0009167_943_1362 139
190 3300046524 Ga0495648_0092702 Ga0495648_0092702_367_786 139
191 3300046525 Ga0495663_0001846 Ga0495663_0001846_5059_5478 139
192 3300046557 Ga0495622_0178921 Ga0495622_0178921_129_608 139
193 3300046558 Ga0495633_0000538 Ga0495633_0000538_35274_35693 139
194 3300046616 Ga0495668_0000468 Ga0495668_0000468_4084_4503 139
195 3300046660 Ga0495625_0002092 Ga0495625_0002092_2275_2694 139
196 3300046660 Ga0495625_0061872 Ga0495625_0061872_334_753 139
197 3300046660 Ga0495625_0257825 Ga0495625_0257825_497_916 139
198 3300046684 Ga0495669_0000118 Ga0495669_0000118_47259_47678 139
199 3300046691 Ga0495670_0066689 Ga0495670_0066689_924_1343 139
200 3300046810 Ga0495660_0047984 Ga0495660_0047984_1148_1567 139
201 3300046810 Ga0495660_0076645 Ga0495660_0076645_393_812 139
202 3300047323 Ga0495683_0008964 Ga0495683_0008964_3620_4039 139
203 3300047323 Ga0495683_0060632 Ga0495683_0060632_471_890 139
204 3300047445 Ga0495677_0012361 Ga0495677_0012361_814_1233 139
205 3300047470 Ga0495681_0032858 Ga0495681_0032858_1982_2401 139
206 3300047470 Ga0495681_0181770 Ga0495681_0181770_355_774 139
207 3300048904 Ga0496101_0156255 Ga0496101_0156255_625_1044 139
208 3300048905 Ga0496102_0000022 Ga0496102_0000022_1986_2405 139
209 3300048906 Ga0496103_0000075 Ga0496103_0000075_2222_2641 139
210 3300048908 Ga0496105_0021589 Ga0496105_0021589_2855_3274 139
211 3300048910 Ga0496107_0259453 Ga0496107_0259453_805_1224 139
212 3300048913 Ga0496110_0035849 Ga0496110_0035849_1882_2301 139
213 3300048914 Ga0496111_0016874 Ga0496111_0016874_2832_3251 139
214 3300048916 Ga0496113_0329504 Ga0496113_0329504_86_505 139
215 3300048917 Ga0496114_0036720 Ga0496114_0036720_784_1203 139
216 3300048918 Ga0496115_0017647 Ga0496115_0017647_2189_2608 139
217 3300048920 Ga0496117_0010437 Ga0496117_0010437_2389_2808 139
218 3300048921 Ga0496118_0000039 Ga0496118_0000039_92883_93302 139
219 3300048922 Ga0496119_0017347 Ga0496119_0017347_2903_3322 139
220 3300048923 Ga0496120_0043007 Ga0496120_0043007_2199_2618 139
221 3300048924 Ga0496121_0024276 Ga0496121_0024276_2532_2951 139
222 3300048926 Ga0496123_0186963 Ga0496123_0186963_635_1054 139
223 3300048927 Ga0496124_0000076 Ga0496124_0000076_213198_213617 139
224 3300048928 Ga0496125_0011759 Ga0496125_0011759_5690_6109 139
225 3300048929 Ga0496126_0023885 Ga0496126_0023885_2929_3348 139
226 3300053079 Ga0500610_0000255 Ga0500610_0000255_1666_2085 139
227 3300053119 Ga0500595_004149 Ga0500595_004149_1399_1878 139
228 3300053177 Ga0500636_0180105 Ga0500636_0180105_671_1090 139
229 3300053735 Ga0500596_003834 Ga0500596_003834_935_1354 139
230 3300055283 Ga0500661_009279 Ga0500661_009279_893_1312 139
231 3300002077 JGI24744J21845_10003363 JGI24744J21845_100033631 140
232 3300005327 Ga0070658_10625634 Ga0070658_106256342 140
233 3300005328 Ga0070676_10315565 Ga0070676_103155651 140
234 3300005338 Ga0068868_100026949 Ga0068868_1000269496 140
235 3300005339 Ga0070660_100214044 Ga0070660_1002140442 140
236 3300005356 Ga0070674_100000483 Ga0070674_1000004835 140
237 3300005364 Ga0070673_100183596 Ga0070673_1001835961 140
238 3300005456 Ga0070678_100001925 Ga0070678_1000019254 140
239 3300006358 Ga0068871_100048888 Ga0068871_1000488883 140
240 3300009036 Ga0105244_10157867 Ga0105244_101578673 140
241 3300009148 Ga0105243_10001132 Ga0105243_1000113226 140
242 3300011119 Ga0105246_10325869 Ga0105246_103258692 140
243 3300013105 Ga0157369_10996912 Ga0157369_109969122 140
244 3300014969 Ga0157376_10115387 Ga0157376_101153874 140
245 3300025907 Ga0207645_10403045 Ga0207645_104030451 140
246 3300025919 Ga0207657_10262799 Ga0207657_102627993 140
247 3300025935 Ga0207709_10000005 Ga0207709_10000005402 140
248 3300025937 Ga0207669_10008360 Ga0207669_100083605 140
249 3300025960 Ga0207651_11286474 Ga0207651_112864741 140
250 3300026023 Ga0207677_11269692 Ga0207677_112696922 140
251 3300026121 Ga0207683_10005199 Ga0207683_1000519911 140
252 3300041443 Ga0451789_0134399 Ga0451789_0134399_63_485 140
253 3300046491 Ga0495584_0052588 Ga0495584_0052588_297_719 140
254 3300046506 Ga0495583_0113324 Ga0495583_0113324_713_1135 140
255 3300046507 Ga0495606_0050184 Ga0495606_0050184_1838_2260 140
256 3300046522 Ga0495643_0061582 Ga0495643_0061582_48_470 140
257 3300046648 Ga0495611_0016361 Ga0495611_0016361_925_1347 140
258 3300046648 Ga0495611_0044388 Ga0495611_0044388_1038_1463 140
259 3300046660 Ga0495625_0017622 Ga0495625_0017622_2235_2657 140
260 3300046694 Ga0495649_0369617 Ga0495649_0369617_273_695 140
261 3300047443 Ga0495687_000499 Ga0495687_000499_44853_45275 140
262 3300053136 Ga0500559_0003593 Ga0500559_0003593_3106_3558 140
263 3300053730 Ga0500645_000003 Ga0500645_000003_2206_2628 140

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

28

152

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ump-assembly1.cif.gz_B crystal structure of tnms3, an antibiotic binding protein from streptomyces sp. cb03234 0.8702 2 132
5umw-assembly2.cif.gz_B crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.8515 2 129
5ump-assembly1.cif.gz_B crystal structure of tnms3, an antibiotic binding protein from streptomyces sp. cb03234 0.8436 2 132
6cky-assembly1.cif.gz_B crystal structure of ucms2 0.8366 1 129
5umw-assembly3.cif.gz_D crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.8309 1 129
ID Description Score Start End Superfamily
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9016 82 132 3.30.720.110
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8653 80 129 3.30.720.110
5uhjB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8382 3 132 3.10.180.10
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8356 82 133 3.30.720.110
5ujpB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8302 4 130 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A7D5UW52-F1-model_v4 VOC domain-containing protein 0.972 1 132
AF-A0A1Y2QN79-F1-model_v4 Glyoxalase 0.9698 2 132
AF-A0A2S6HXD3-F1-model_v4 Catechol 2,3-dioxygenase-like lactoylglutathione lyase family enzyme 0.9684 1 136 GO:0016829
GO:0051213
AF-A0A1L8TP16-F1-model_v4 VOC domain-containing protein 0.9674 1 136
AF-W4L6D7-F1-model_v4 VOC domain-containing protein 0.9667 1 132

Feature Viewer

pLDDT pTM Quality
92.75 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map