F371754

General Info

Members Datasets Scaffolds Average Seq Length
263 172 526 308

Family's Representative Sequence

Representative Sequence 3300005985|Ga0081539_10008025|Ga0081539_100080256
Length 332
Sequence VSAPPRSDSPRPRTDVMALRLGTRGSALALAQSRLTADALTTATGRPVELVRIVTPGDRSSAPVAQLGVGVFVSALRDALLAGDIDFAVHSYKDLPTGDHAGLHIAAVPRREDARDVLIARDGRTLAELPPGAVIGTGAVRRIAQLRALGLQLHVTPIRGNVDSRIARVRGPEADLDAVVLARAGVVRLGRAAEISETLDPMLMLPAPAQGALAVECRADDADLVELLAALDHAPSRAAVVAERAMLATLEAGCSAPVAAHARLTGGEHAGSAAEGEHGDEIHLRGAVISPDGARAIRLSRTGTPADAAEIGKALAADLLDAGADTLIGSSA

Samples

Sample ID Description Type Environment
1 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
15 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
18 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
19 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
20 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
21 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
22 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
23 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
24 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
25 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
26 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
27 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
28 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
29 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
32 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
33 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
34 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
35 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
36 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
37 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
55 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
56 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
57 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
58 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
59 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
60 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
61 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
62 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
63 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
64 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
65 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
66 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
67 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
68 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
69 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
70 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
71 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
72 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
73 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
74 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
75 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
76 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
77 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
78 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
79 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
80 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
81 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
82 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
83 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
84 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
85 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
86 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
87 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
88 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
89 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
90 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
91 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
92 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
93 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
94 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
95 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
96 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
97 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
98 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
99 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
100 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
101 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
102 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
103 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
104 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
105 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
106 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
107 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
108 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
109 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
110 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
111 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
113 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
114 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
115 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
116 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
117 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
118 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
119 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
120 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
121 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
122 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
123 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
124 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
125 2501939600 Micromonospora sp. L5 Isolate Unclassified
126 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
127 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
128 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
129 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
130 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
131 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
132 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
133 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
134 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
135 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
136 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
137 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
138 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
139 2855683550 Micromonospora sp. RP3T Isolate Unclassified
140 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
141 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
142 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
143 2858868258 Micromonospora sp. MH33 Isolate Unclassified
144 2858882152 Micromonospora noduli MED15 Isolate Nodule
145 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
146 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
147 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
148 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
149 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
150 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
151 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
152 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
153 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
154 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
155 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
156 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
157 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
158 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
159 2902582711 Micromonospora sp. AP08 Isolate Unclassified
160 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
161 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
162 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
163 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
164 649633069 Micromonospora sp. L5 Isolate Unclassified
165 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
166 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
167 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
168 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
169 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
170 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
171 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
172 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 81.75
Metatranscriptomes 0
Isolates 18.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.66
Nodule 2.28
Rhizoplane 6.08
Rhizosphere 70.72
Stem 0
Stem Tuber 0
Unclassified 1.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081539_10008025 3300005985 Bacteria 9361
2 JGI25406J46586_10015463 3300003203 Bacteria 3218
3 JGI25406J46586_10029108 3300003203 Bacteria 2095
4 Ga0070683_100143816 3300005329 Bacteria 2259
5 Ga0070682_100140052 3300005337 Bacteria 1648
6 Ga0070689_100134796 3300005340 Bacteria 1983
7 Ga0070668_100002088 3300005347 Bacteria 14615
8 Ga0070668_100267213 3300005347 Bacteria 1424
9 Ga0070675_100240652 3300005354 Bacteria 1581
10 Ga0070675_100410901 3300005354 Bacteria 1209
11 Ga0070667_100084735 3300005367 Bacteria 2717
12 Ga0070709_10039816 3300005434 Bacteria 2886
13 Ga0070714_100252209 3300005435 Bacteria 1632
14 Ga0070711_100044867 3300005439 Bacteria 3003
15 Ga0070711_100072381 3300005439 Bacteria 2432
16 Ga0070698_100218478 3300005471 Unclassified 1840
17 Ga0070679_100220516 3300005530 Bacteria 1857
18 Ga0070664_100447843 3300005564 Bacteria 1185
19 Ga0068857_100055007 3300005577 Bacteria 3532
20 Ga0068857_100186005 3300005577 Bacteria 1891
21 Ga0068857_100423192 3300005577 Bacteria 1242
22 Ga0068856_100005173 3300005614 Bacteria 12878
23 Ga0068856_100352276 3300005614 Bacteria 1491
24 Ga0068859_100079889 3300005617 Bacteria 3311
25 Ga0068864_100003646 3300005618 Bacteria 12733
26 Ga0068864_100077688 3300005618 Bacteria 2904
27 Ga0068864_100591260 3300005618 Bacteria 1076
28 Ga0068863_100008790 3300005841 Bacteria 9863
29 Ga0068863_100037714 3300005841 Bacteria 4600
30 Ga0068863_100245190 3300005841 Bacteria 1730
31 Ga0068858_100067599 3300005842 Bacteria 3310
32 Ga0068860_100094613 3300005843 Bacteria 2848
33 Ga0068862_100047554 3300005844 Bacteria 3662
34 Ga0081540_1013035 3300005983 Bacteria 5427
35 Ga0081539_10000094 3300005985 Bacteria 206102
36 Ga0081539_10000362 3300005985 Bacteria 99991
37 Ga0081539_10003779 3300005985 Bacteria 17898
38 Ga0081539_10010146 3300005985 Bacteria 7721
39 Ga0081539_10052348 3300005985 Bacteria 2294
40 Ga0075428_100000285 3300006844 Bacteria 49638
41 Ga0075428_100001086 3300006844 Bacteria 28950
42 Ga0075428_100029819 3300006844 Bacteria 6035
43 Ga0075428_100668163 3300006844 Bacteria 1107
44 Ga0075430_100004937 3300006846 Bacteria 11219
45 Ga0075430_100011110 3300006846 Bacteria 7633
46 Ga0075430_100018929 3300006846 Bacteria 5859
47 Ga0075430_100166215 3300006846 Bacteria 1836
48 Ga0075430_100526776 3300006846 Bacteria 975
49 Ga0075431_100010461 3300006847 Bacteria 9331
50 Ga0075431_100039635 3300006847 Bacteria 4853
51 Ga0075431_100215723 3300006847 Bacteria 1959
52 Ga0075434_100230804 3300006871 Bacteria 1870
53 Ga0075429_100000714 3300006880 Bacteria 26009
54 Ga0075429_100011961 3300006880 Bacteria 7524
55 Ga0075429_100023738 3300006880 Bacteria 5322
56 Ga0075429_100248067 3300006880 Bacteria 1559
57 Ga0097620_100079891 3300006931 Bacteria 3311
58 Ga0114129_10000278 3300009147 Bacteria 58533
59 Ga0114129_10000585 3300009147 Bacteria 44984
60 Ga0114129_10002476 3300009147 Bacteria 25644
61 Ga0114129_10029095 3300009147 Bacteria 7826
62 Ga0114129_10167678 3300009147 Bacteria 2995
63 Ga0114129_10343865 3300009147 Bacteria 1978
64 Ga0114129_10765054 3300009147 Bacteria 1235
65 Ga0105248_10009836 3300009177 Bacteria 10536
66 Ga0105248_10240734 3300009177 Bacteria 2037
67 Ga0157378_10097998 3300013297 Bacteria 2673
68 Ga0163162_10200277 3300013306 Bacteria 2125
69 Ga0163163_10139992 3300014325 Bacteria 2462
70 Ga0163163_10146537 3300014325 Bacteria 2405
71 Ga0157379_10085481 3300014968 Bacteria 2827
72 Ga0157379_10178274 3300014968 Bacteria 1920
73 Ga0157379_10438384 3300014968 Bacteria 1204
74 Ga0157376_10241281 3300014969 Bacteria 1684
75 Ga0207692_10022584 3300025898 Bacteria 2897
76 Ga0207654_10272491 3300025911 Bacteria 1142
77 Ga0207652_10113119 3300025921 Bacteria 2409
78 Ga0207700_10003757 3300025928 Bacteria 8863
79 Ga0207664_10422363 3300025929 Bacteria 1188
80 Ga0207670_10301922 3300025936 Bacteria 1254
81 Ga0207661_10265006 3300025944 Bacteria 1532
82 Ga0207668_10006028 3300025972 Bacteria 7146
83 Ga0207658_10127916 3300025986 Bacteria 2036
84 Ga0207703_10011442 3300026035 Bacteria 6899
85 Ga0207703_10098710 3300026035 Bacteria 2470
86 Ga0207641_10013718 3300026088 Bacteria 6648
87 Ga0207641_10407919 3300026088 Bacteria 1306
88 Ga0207676_10009004 3300026095 Bacteria 7104
89 Ga0207674_10111903 3300026116 Bacteria 2704
90 Ga0207683_10164030 3300026121 Bacteria 2010
91 Ga0268266_10215771 3300028379 Bacteria 1761
92 Ga0268265_10094464 3300028380 Bacteria 2398
93 Ga0268264_10068996 3300028381 Bacteria 2989
94 Ga0307517_10080278 3300028786 Bacteria 2795
95 Ga0307517_10111021 3300028786 Bacteria 2086
96 Ga0307515_10000119 3300028794 Bacteria 189566
97 Ga0307515_10033588 3300028794 Bacteria 8436
98 Ga0307515_10090130 3300028794 Bacteria 3850
99 Ga0307512_10003144 3300030522 Bacteria 19632
100 Ga0307512_10003620 3300030522 Bacteria 17667
101 Ga0307513_10025619 3300031456 Bacteria 6827
102 Ga0307513_10070815 3300031456 Bacteria 3642
103 Ga0307509_10017954 3300031507 Bacteria 8123
104 Ga0307408_100395926 3300031548 Bacteria 1185
105 Ga0307508_10002658 3300031616 Bacteria 18756
106 Ga0307508_10019356 3300031616 Bacteria 6187
107 Ga0307508_10084795 3300031616 Bacteria 2751
108 Ga0307516_10000149 3300031730 Bacteria 86821
109 Ga0307516_10099558 3300031730 Bacteria 2723
110 Ga0307516_10234184 3300031730 Bacteria 1538
111 Ga0307405_10012018 3300031731 Bacteria 4564
112 Ga0307405_10046579 3300031731 Bacteria 2665
113 Ga0307405_10086870 3300031731 Bacteria 2060
114 Ga0307405_10127171 3300031731 Bacteria 1754
115 Ga0307413_10108821 3300031824 Bacteria 1850
116 Ga0307413_10484191 3300031824 Bacteria 990
117 Ga0307410_10304872 3300031852 Bacteria 1258
118 Ga0307406_10001142 3300031901 Bacteria 14859
119 Ga0307406_10008662 3300031901 Bacteria 5683
120 Ga0307406_10008801 3300031901 Bacteria 5642
121 Ga0307406_10098705 3300031901 Bacteria 1984
122 Ga0307406_10159548 3300031901 Bacteria 1619
123 Ga0307407_10104059 3300031903 Bacteria 1768
124 Ga0307412_10057897 3300031911 Bacteria 2589
125 Ga0307409_100000561 3300031995 Bacteria 16158
126 Ga0307409_100003817 3300031995 Bacteria 8312
127 Ga0307409_100327827 3300031995 Bacteria 1435
128 Ga0307409_100528586 3300031995 Bacteria 1154
129 Ga0307416_100002704 3300032002 Bacteria 10272
130 Ga0307416_100005302 3300032002 Bacteria 7903
131 Ga0307416_100068241 3300032002 Bacteria 2937
132 Ga0307414_10299240 3300032004 Bacteria 1360
133 Ga0307411_10062802 3300032005 Bacteria 2479
134 Ga0307411_10269200 3300032005 Bacteria 1350
135 Ga0307415_100000019 3300032126 Bacteria 70406
136 Ga0307415_100022277 3300032126 Bacteria 3907
137 Ga0307415_100072306 3300032126 Bacteria 2428
138 Ga0307415_100138809 3300032126 Bacteria 1853
139 Ga0307415_100337594 3300032126 Bacteria 1263
140 Ga0307507_10049345 3300033179 Bacteria 4080
141 Ga0307510_10289981 3300033180 Bacteria 1103
142 Ga0373948_0003736 3300034817 Bacteria 2363
143 Ga0373950_0006217 3300034818 Bacteria 1813
144 Ga0373951_0000647 3300035091 Bacteria 9579
145 Ga0373939_0083228 3300035114 Bacteria 1067
146 Ga0373941_0023586 3300035115 Bacteria 1758
147 Ga0373946_0078953 3300035171 Bacteria 1437
148 Ga0373962_0035408 3300035242 Bacteria 1386
149 Ga0373925_0101932 3300037068 Bacteria 2208
150 Ga0395899_0002858 3300037312 Bacteria 13886
151 Ga0395900_0001388 3300037418 Bacteria 29031
152 Ga0395900_0053581 3300037418 Bacteria 4152
153 Ga0395898_0007474 3300037466 Bacteria 11603
154 Ga0395898_0086256 3300037466 Bacteria 3026
155 Ga0395905_0001885 3300037471 Bacteria 24168
156 Ga0395905_0114488 3300037471 Bacteria 2534
157 Ga0395901_0001402 3300038443 Bacteria 25176
158 Ga0395901_0026591 3300038443 Bacteria 5942
159 Ga0451853_0563363 3300041512 Bacteria 3395
160 Ga0450920_033361 3300042122 Unclassified 1017
161 Ga0466963_0150031 3300044694 Bacteria 1618
162 Ga0466957_0124775 3300044842 Bacteria 1644
163 Ga0466960_0121253 3300044901 Bacteria 1370
164 Ga0451576_0214585 3300045051 Unclassified 2010
165 Ga0495629_0015166 3300046459 Bacteria 5539
166 Ga0495594_0013871 3300046499 Bacteria 4215
167 Ga0495594_0018508 3300046499 Bacteria 3691
168 Ga0495606_0001354 3300046507 Bacteria 33260
169 Ga0495668_0000872 3300046616 Bacteria 33998
170 Ga0495625_0001540 3300046660 Bacteria 27551
171 Ga0495683_0091177 3300047323 Bacteria 1476
172 Ga0495593_0037355 3300047673 Bacteria 2628
173 Ga0495626_0000116 3300048091 Bacteria 104938
174 Ga0496104_0023870 3300048907 Bacteria 5624
175 Ga0496105_0016938 3300048908 Bacteria 5831
176 Ga0496105_0052137 3300048908 Bacteria 3378
177 Ga0496108_0000019 3300048911 Bacteria 234657
178 Ga0496108_0008890 3300048911 Bacteria 8143
179 Ga0496109_0017888 3300048912 Bacteria 6220
180 Ga0496110_0001540 3300048913 Bacteria 16770
181 Ga0496111_0062410 3300048914 Bacteria 2702
182 Ga0496112_0002106 3300048915 Bacteria 15786
183 Ga0496112_0035356 3300048915 Bacteria 4866
184 Ga0496112_0304240 3300048915 Bacteria 1540
185 Ga0496112_0324911 3300048915 Bacteria 1482
186 Ga0496112_0433264 3300048915 Bacteria 1253
187 Ga0496113_0013661 3300048916 Bacteria 5512
188 Ga0496113_0104808 3300048916 Bacteria 2195
189 Ga0496114_0005500 3300048917 Bacteria 9918
190 Ga0501047_0161348 3300049581 Bacteria 2113
191 Ga0501070_0283777 3300049586 Bacteria 1351
192 nmdc:mga05p37_1684_c1 3300050507 Bacteria 25717
193 nmdc:mga05p37_204453_c1 3300050507 Bacteria 2390
194 nmdc:mga05p37_314178_c1 3300050507 Bacteria 1856
195 nmdc:mga05p37_3785_c1 3300050507 Bacteria 17712
196 nmdc:mga05p37_8100_c1 3300050507 Bacteria 12421
197 nmdc:mga09592_247443_c1 3300050508 Bacteria 1545
198 nmdc:mga09592_62_c1 3300050508 Bacteria 60818
199 nmdc:mga09592_7441_c1 3300050508 Bacteria 8898
200 nmdc:mga09592_9038_c1 3300050508 Bacteria 8098
201 nmdc:mga0qj67_1407_c1 3300050509 Bacteria 16843
202 nmdc:mga0qj67_6584_c1 3300050509 Bacteria 8534
203 nmdc:mga06r32_1433_c1 3300050510 Bacteria 21539
204 nmdc:mga06r32_17514_c1 3300050510 Bacteria 6540
205 nmdc:mga06r32_273037_c1 3300050510 Bacteria 1678
206 Ga0495619_0064518 3300053085 Bacteria 2442
207 Ga0500644_0049238 3300053088 Bacteria 1437
208 Ga0500644_0081909 3300053088 Bacteria 1188
209 Ga0500646_0000140 3300053090 Bacteria 21197
210 Ga0500651_0323646 3300053093 Bacteria 880
211 Ga0500654_086508 3300053099 Bacteria 1425
212 Ga0500660_048475 3300053100 Bacteria 2116
213 Ga0500588_0045481 3300053146 Bacteria 1345
214 Ga0501084_0161917 3300054114 Bacteria 1888
215 Ga0501084_0223182 3300054114 Bacteria 1590
216 2501945465 2501939600 Bacteria 6907073
217 2515495527 2515154088 Bacteria 5526283
218 2515720286 2515154129 Bacteria 5584369
219 2515755968 2515154137 Bacteria 5711575
220 2516084385 2515154202 Bacteria 5471270
221 2516089694 2515154203 Bacteria 5458536
222 2623585188 2622736626 Bacteria 7181580
223 2676484908 2675903059 Bacteria 8644972
224 2753272234 2751185782 Bacteria 11227053
225 2772645530 2772190715 Bacteria 6959372
226 2831937065 2831935698 Bacteria 5963223
227 2832010232 2832004796 Bacteria 6538017
228 2855673899 2855670206 Bacteria 7120389
229 2855679497 2855676851 Bacteria 7063653
230 2855688736 2855683550 Bacteria 7134265
231 2856859021 2856858025 Bacteria 7255264
232 2857289427 2857288857 Bacteria 7189066
233 2858851939 2858848962 Bacteria 6963058
234 2858868574 2858868258 Bacteria 7683772
235 2858887961 2858882152 Bacteria 7230291
236 2858895368 2858888857 Bacteria 7060307
237 2858900126 2858895516 Bacteria 7378898
238 2858902806 2858902515 Bacteria 7086037
239 2866068356 2866065130 Bacteria 6518152
240 2867306153 2867302475 Bacteria 7087181
241 2867317348 2867312974 Bacteria 7058875
242 2867323165 2867319477 Bacteria 7069771
243 2867510766 2867507094 Bacteria 6506033
244 2869051487 2869048445 Bacteria 6875584
245 2869067010 2869061728 Bacteria 7112407
246 2869071720 2869068681 Bacteria 7205615
247 2880495052 2880489317 Bacteria 7096270
248 2880497277 2880495981 Bacteria 7340502
249 2887486912 2887478801 Bacteria 8972725
250 2902584191 2902582711 Bacteria 6187705
251 2929225845 2929219909 Bacteria 6984360
252 2929231166 2929226422 Bacteria 7248583
253 2996222148 2996221748 Bacteria 6799777
254 3001892232 3001889506 Bacteria 2975194
255 649813018 649633069 Bacteria 6962533
256 8001785277 8001781756 Bacteria 9586736
257 8003836333 8003830390 Bacteria 6541657
258 8003859699 8003856774 Bacteria 7675274
259 8003870825 8003870546 Bacteria 7396674
260 8054710383 8054704163 Bacteria 7247792
261 8054731506 8054727385 Bacteria 7558670
262 8054736144 8054734606 Bacteria 6947278
263 8055418463 8055412473 Bacteria 6257500
264 Ga0081539_10008025
265 JGI25406J46586_10015463
266 JGI25406J46586_10029108
267 Ga0070683_100143816
268 Ga0070682_100140052
269 Ga0070689_100134796
270 Ga0070668_100002088
271 Ga0070668_100267213
272 Ga0070675_100240652
273 Ga0070675_100410901
274 Ga0070667_100084735
275 Ga0070709_10039816
276 Ga0070714_100252209
277 Ga0070711_100044867
278 Ga0070711_100072381
279 Ga0070698_100218478
280 Ga0070679_100220516
281 Ga0070664_100447843
282 Ga0068857_100055007
283 Ga0068857_100186005
284 Ga0068857_100423192
285 Ga0068856_100005173
286 Ga0068856_100352276
287 Ga0068859_100079889
288 Ga0068864_100003646
289 Ga0068864_100077688
290 Ga0068864_100591260
291 Ga0068863_100008790
292 Ga0068863_100037714
293 Ga0068863_100245190
294 Ga0068858_100067599
295 Ga0068860_100094613
296 Ga0068862_100047554
297 Ga0081540_1013035
298 Ga0081539_10000094
299 Ga0081539_10000362
300 Ga0081539_10003779
301 Ga0081539_10010146
302 Ga0081539_10052348
303 Ga0075428_100000285
304 Ga0075428_100001086
305 Ga0075428_100029819
306 Ga0075428_100668163
307 Ga0075430_100004937
308 Ga0075430_100011110
309 Ga0075430_100018929
310 Ga0075430_100166215
311 Ga0075430_100526776
312 Ga0075431_100010461
313 Ga0075431_100039635
314 Ga0075431_100215723
315 Ga0075434_100230804
316 Ga0075429_100000714
317 Ga0075429_100011961
318 Ga0075429_100023738
319 Ga0075429_100248067
320 Ga0097620_100079891
321 Ga0114129_10000278
322 Ga0114129_10000585
323 Ga0114129_10002476
324 Ga0114129_10029095
325 Ga0114129_10167678
326 Ga0114129_10343865
327 Ga0114129_10765054
328 Ga0105248_10009836
329 Ga0105248_10240734
330 Ga0157378_10097998
331 Ga0163162_10200277
332 Ga0163163_10139992
333 Ga0163163_10146537
334 Ga0157379_10085481
335 Ga0157379_10178274
336 Ga0157379_10438384
337 Ga0157376_10241281
338 Ga0207692_10022584
339 Ga0207654_10272491
340 Ga0207652_10113119
341 Ga0207700_10003757
342 Ga0207664_10422363
343 Ga0207670_10301922
344 Ga0207661_10265006
345 Ga0207668_10006028
346 Ga0207658_10127916
347 Ga0207703_10011442
348 Ga0207703_10098710
349 Ga0207641_10013718
350 Ga0207641_10407919
351 Ga0207676_10009004
352 Ga0207674_10111903
353 Ga0207683_10164030
354 Ga0268266_10215771
355 Ga0268265_10094464
356 Ga0268264_10068996
357 Ga0307517_10080278
358 Ga0307517_10111021
359 Ga0307515_10000119
360 Ga0307515_10033588
361 Ga0307515_10090130
362 Ga0307512_10003144
363 Ga0307512_10003620
364 Ga0307513_10025619
365 Ga0307513_10070815
366 Ga0307509_10017954
367 Ga0307408_100395926
368 Ga0307508_10002658
369 Ga0307508_10019356
370 Ga0307508_10084795
371 Ga0307516_10000149
372 Ga0307516_10099558
373 Ga0307516_10234184
374 Ga0307405_10012018
375 Ga0307405_10046579
376 Ga0307405_10086870
377 Ga0307405_10127171
378 Ga0307413_10108821
379 Ga0307413_10484191
380 Ga0307410_10304872
381 Ga0307406_10001142
382 Ga0307406_10008662
383 Ga0307406_10008801
384 Ga0307406_10098705
385 Ga0307406_10159548
386 Ga0307407_10104059
387 Ga0307412_10057897
388 Ga0307409_100000561
389 Ga0307409_100003817
390 Ga0307409_100327827
391 Ga0307409_100528586
392 Ga0307416_100002704
393 Ga0307416_100005302
394 Ga0307416_100068241
395 Ga0307414_10299240
396 Ga0307411_10062802
397 Ga0307411_10269200
398 Ga0307415_100000019
399 Ga0307415_100022277
400 Ga0307415_100072306
401 Ga0307415_100138809
402 Ga0307415_100337594
403 Ga0307507_10049345
404 Ga0307510_10289981
405 Ga0373948_0003736
406 Ga0373950_0006217
407 Ga0373951_0000647
408 Ga0373939_0083228
409 Ga0373941_0023586
410 Ga0373946_0078953
411 Ga0373962_0035408
412 Ga0373925_0101932
413 Ga0395899_0002858
414 Ga0395900_0001388
415 Ga0395900_0053581
416 Ga0395898_0007474
417 Ga0395898_0086256
418 Ga0395905_0001885
419 Ga0395905_0114488
420 Ga0395901_0001402
421 Ga0395901_0026591
422 Ga0451853_0563363
423 Ga0450920_033361
424 Ga0466963_0150031
425 Ga0466957_0124775
426 Ga0466960_0121253
427 Ga0451576_0214585
428 Ga0495629_0015166
429 Ga0495594_0013871
430 Ga0495594_0018508
431 Ga0495606_0001354
432 Ga0495668_0000872
433 Ga0495625_0001540
434 Ga0495683_0091177
435 Ga0495593_0037355
436 Ga0495626_0000116
437 Ga0496104_0023870
438 Ga0496105_0016938
439 Ga0496105_0052137
440 Ga0496108_0000019
441 Ga0496108_0008890
442 Ga0496109_0017888
443 Ga0496110_0001540
444 Ga0496111_0062410
445 Ga0496112_0002106
446 Ga0496112_0035356
447 Ga0496112_0304240
448 Ga0496112_0324911
449 Ga0496112_0433264
450 Ga0496113_0013661
451 Ga0496113_0104808
452 Ga0496114_0005500
453 Ga0501047_0161348
454 Ga0501070_0283777
455 nmdc:mga05p37_1684_c1
456 nmdc:mga05p37_204453_c1
457 nmdc:mga05p37_314178_c1
458 nmdc:mga05p37_3785_c1
459 nmdc:mga05p37_8100_c1
460 nmdc:mga09592_247443_c1
461 nmdc:mga09592_62_c1
462 nmdc:mga09592_7441_c1
463 nmdc:mga09592_9038_c1
464 nmdc:mga0qj67_1407_c1
465 nmdc:mga0qj67_6584_c1
466 nmdc:mga06r32_1433_c1
467 nmdc:mga06r32_17514_c1
468 nmdc:mga06r32_273037_c1
469 Ga0495619_0064518
470 Ga0500644_0049238
471 Ga0500644_0081909
472 Ga0500646_0000140
473 Ga0500651_0323646
474 Ga0500654_086508
475 Ga0500660_048475
476 Ga0500588_0045481
477 Ga0501084_0161917
478 Ga0501084_0223182
479 2501945465
480 2515495527
481 2515720286
482 2515755968
483 2516084385
484 2516089694
485 2623585188
486 2676484908
487 2753272234
488 2772645530
489 2831937065
490 2832010232
491 2855673899
492 2855679497
493 2855688736
494 2856859021
495 2857289427
496 2858851939
497 2858868574
498 2858887961
499 2858895368
500 2858900126
501 2858902806
502 2866068356
503 2867306153
504 2867317348
505 2867323165
506 2867510766
507 2869051487
508 2869067010
509 2869071720
510 2880495052
511 2880497277
512 2887486912
513 2902584191
514 2929225845
515 2929231166
516 2996222148
517 3001892232
518 649813018
519 8001785277
520 8003836333
521 8003859699
522 8003870825
523 8054710383
524 8054731506
525 8054736144
526 8055418463

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01379

Porphobil_deam

Porphobilinogen deaminase, dipyromethane cofactor binding domain

19

226

0.96

PF03900

Porphobil_deamC

Porphobilinogen deaminase, C-terminal domain

238

321

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5h6o-assembly1.cif.gz_A porphobilinogen deaminase from vibrio cholerae 0.9606 3 312
5h6o-assembly1.cif.gz_A porphobilinogen deaminase from vibrio cholerae 0.9539 3 312
4mlq-assembly1.cif.gz_A crystal structure of bacillus megaterium porphobilinogen deaminase 0.9467 4 313
2ypn-assembly1.cif.gz_A hydroxymethylbilane synthase 0.9436 5 312
5ov5-assembly1.cif.gz_A bacillus megaterium porphobilinogen deaminase d82e mutant 0.9431 4 313
ID Description Score Start End Superfamily
1ah5A02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9602 96 197 3.40.190.10
1ah5A02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.951 96 197 3.40.190.10
5ov6A03 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Porphobilinogen deaminase, C-terminal domain 0.9472 219 313 3.30.160.40
af_O34090_221_303_3.30.160.40 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Porphobilinogen deaminase, C-terminal domain 0.9378 221 314 3.30.160.40
5h6oA03 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Porphobilinogen deaminase, C-terminal domain 0.9376 219 312 3.30.160.40
ID Description Score Start End GO Terms
AF-W1UVL9-F1-model_v4 deleted 0.9691 54 313
AF-A0A7C1C622-F1-model_v4 Hydroxymethylbilane synthase (EC 2.5.1.61) 0.9668 85 312 GO:0004418
GO:0005737
GO:0006782
AF-A0A351FP63-F1-model_v4 Hydroxymethylbilane synthase (EC 2.5.1.61) 0.9666 79 313 GO:0004418
GO:0005737
GO:0006783
AF-A0A3M1RID1-F1-model_v4 Hydroxymethylbilane synthase (EC 2.5.1.61) 0.9653 79 312 GO:0004418
GO:0005737
GO:0006783
AF-A0A370H6H6-F1-model_v4 Porphobilinogen deaminase (PBG) (EC 2.5.1.61) (Hydroxymethylbilane synthase) (HMBS) (Pre-uroporphyrinogen synthase) 0.9611 1 316 GO:0004418
GO:0005737
GO:0006782

Map