F371412

General Info

Members Datasets Scaffolds Average Seq Length
262 200 524 345

Family's Representative Sequence

Representative Sequence 3300049574|Ga0501038_0168693|Ga0501038_0168693_392_1543
Length 383
Sequence MVSPDAVSTPRAPNRTAAAPLTTLASAAGRTDGAGAAVTPVLAGLAAAFPPAVAQSTLWTDFFAEHYRDVRSAGRIFAHAGVERRHPAVDPLVEDVSTMGTGDRMRRYLTEALPLGRSAVTAALADAGLSVRDPGLLAVASCTGYVTPGVDIRLAAELGLPDDVQRLLIGHMGCYAALPGLAAVADFVAVHRRPAVLLCVELTSLHLQPASRDLSQVVAHALFSDAAVAAVLRPAEATRPVPGLAVVDVAATTDVTTADQMTWDVTDHGFRMGLSARVPDTLAGQLPGTVATLLRRHGLTVADVAHWAVHPGGPRILDVVQERLGLSDAALEPSRATLRDHGNCSSGTVLAVLQELPVRPGERTVALAFGPGLTLYAVLLRAV

Samples

Sample ID Description Type Environment
1 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
101 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
102 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
103 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
104 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
105 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
106 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
107 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
108 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
109 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
110 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
111 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
112 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
115 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
116 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
117 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
118 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
119 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
120 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
121 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
122 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
123 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
124 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
125 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
126 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
127 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
128 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
129 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
130 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
131 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
132 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
133 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
134 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
135 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
136 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
137 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
138 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
139 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
140 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
141 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
142 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
143 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
144 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
145 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
146 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
147 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
148 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
149 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
153 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
154 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
155 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
156 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
157 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
158 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
159 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
160 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
161 2501939600 Micromonospora sp. L5 Isolate Unclassified
162 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
163 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
164 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
165 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
166 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
167 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
168 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
169 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
170 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
171 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
172 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
173 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
174 2855683550 Micromonospora sp. RP3T Isolate Unclassified
175 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
176 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
177 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
178 2858882152 Micromonospora noduli MED15 Isolate Nodule
179 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
180 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
181 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
182 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
183 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
184 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
185 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
186 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
187 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
188 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
189 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
190 2902582711 Micromonospora sp. AP08 Isolate Unclassified
191 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
192 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
193 649633069 Micromonospora sp. L5 Isolate Unclassified
194 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
195 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
196 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
197 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
198 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
199 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
200 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.97
Metatranscriptomes 0.76
Isolates 15.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.38
Nodule 1.91
Rhizoplane 6.87
Rhizosphere 76.72
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501038_0168693 3300049574 Bacteria 1774
2 JGI24752J21851_1004717 3300001976 Bacteria 1784
3 Ga0070683_100044616 3300005329 Bacteria 4089
4 Ga0070670_100345049 3300005331 Bacteria 1307
5 Ga0068869_100007483 3300005334 Bacteria 6986
6 Ga0070680_100037733 3300005336 Bacteria 3905
7 Ga0068868_100025855 3300005338 Bacteria 4469
8 Ga0070689_100008622 3300005340 Bacteria 7190
9 Ga0070691_10021379 3300005341 Bacteria 2994
10 Ga0070692_10014039 3300005345 Bacteria 3750
11 Ga0070668_100004610 3300005347 Bacteria 10208
12 Ga0070675_100033368 3300005354 Bacteria 4173
13 Ga0070671_100000852 3300005355 Bacteria 22215
14 Ga0070688_100053822 3300005365 Bacteria 2519
15 Ga0070659_100171764 3300005366 Bacteria 1776
16 Ga0070667_100086689 3300005367 Bacteria 2687
17 Ga0070667_100242670 3300005367 Bacteria 1609
18 Ga0070709_10027473 3300005434 Bacteria 3384
19 Ga0070714_100029895 3300005435 Bacteria 4533
20 Ga0070713_100001939 3300005436 Bacteria 13356
21 Ga0070663_100001441 3300005455 Bacteria 13039
22 Ga0070678_100010268 3300005456 Bacteria 5712
23 Ga0070681_10015977 3300005458 Bacteria 7484
24 Ga0070679_100026693 3300005530 Bacteria 5678
25 Ga0070684_100109226 3300005535 Bacteria 2479
26 Ga0070672_100056910 3300005543 Bacteria 3068
27 Ga0070665_100360079 3300005548 Bacteria 1461
28 Ga0070664_100300113 3300005564 Bacteria 1451
29 Ga0068856_100001452 3300005614 Bacteria 24864
30 Ga0068856_100047191 3300005614 Bacteria 4243
31 Ga0070702_100003125 3300005615 Bacteria 7337
32 Ga0068852_100023581 3300005616 Bacteria 4955
33 Ga0068859_100086205 3300005617 Bacteria 3186
34 Ga0068864_100046968 3300005618 Bacteria 3707
35 Ga0068864_100074065 3300005618 Bacteria 2970
36 Ga0068870_10000665 3300005840 Bacteria 13087
37 Ga0068863_100004712 3300005841 Bacteria 13443
38 Ga0068858_100423973 3300005842 Bacteria 1280
39 Ga0068860_100066179 3300005843 Bacteria 3432
40 Ga0068862_100285904 3300005844 Bacteria 1513
41 Ga0081455_10001676 3300005937 Bacteria 26867
42 Ga0081539_10000205 3300005985 Bacteria 137262
43 Ga0081539_10000256 3300005985 Bacteria 122838
44 Ga0081539_10002834 3300005985 Bacteria 23134
45 Ga0081539_10014725 3300005985 Bacteria 5753
46 Ga0070717_10038120 3300006028 Bacteria 3906
47 Ga0070712_100102739 3300006175 Bacteria 2118
48 Ga0097621_100315346 3300006237 Bacteria 1384
49 Ga0075431_100038138 3300006847 Bacteria 4948
50 Ga0075431_100131808 3300006847 Bacteria 2578
51 Ga0075431_100290425 3300006847 Bacteria 1654
52 Ga0075431_100316622 3300006847 Bacteria 1574
53 Ga0075433_10075334 3300006852 Bacteria 2970
54 Ga0075436_100004433 3300006914 Bacteria 9634
55 Ga0097620_100086206 3300006931 Bacteria 3186
56 Ga0075435_100023692 3300007076 Bacteria 4752
57 Ga0105251_10049061 3300009011 Bacteria 2022
58 Ga0105240_10071870 3300009093 Bacteria 4278
59 Ga0105245_10144058 3300009098 Bacteria 2247
60 Ga0114129_10146733 3300009147 Bacteria 3231
61 Ga0105241_10001374 3300009174 Bacteria 18553
62 Ga0105248_10025952 3300009177 Bacteria 6516
63 Ga0105237_10128707 3300009545 Bacteria 2526
64 Ga0105239_10368038 3300010375 Bacteria 1624
65 Ga0105246_10003825 3300011119 Bacteria 9125
66 Ga0157371_10019138 3300013102 Bacteria 5055
67 Ga0157370_10103808 3300013104 Bacteria 2660
68 Ga0157374_10036032 3300013296 Bacteria 4530
69 Ga0163163_10386882 3300014325 Bacteria 1456
70 Ga0182008_10016425 3300014497 Bacteria 3846
71 Ga0157379_10151280 3300014968 Bacteria 2093
72 Ga0206354_11490498 3300020081 Bacteria 2052
73 Ga0206353_10701281 3300020082 Bacteria 1946
74 Ga0207656_10003818 3300025321 Bacteria 5219
75 Ga0207688_10001279 3300025901 Bacteria 13034
76 Ga0207643_10000310 3300025908 Bacteria 33671
77 Ga0207705_10009454 3300025909 Bacteria 7090
78 Ga0207654_10022674 3300025911 Bacteria 3353
79 Ga0207660_10009899 3300025917 Bacteria 6176
80 Ga0207662_10020356 3300025918 Bacteria 3785
81 Ga0207657_10084514 3300025919 Bacteria 2660
82 Ga0207649_10007517 3300025920 Bacteria 5923
83 Ga0207652_10013662 3300025921 Bacteria 6565
84 Ga0207652_10129034 3300025921 Bacteria 2254
85 Ga0207652_10190316 3300025921 Bacteria 1845
86 Ga0207694_10081014 3300025924 Bacteria 2549
87 Ga0207650_10003746 3300025925 Bacteria 10403
88 Ga0207659_10023107 3300025926 Bacteria 4146
89 Ga0207687_10130392 3300025927 Bacteria 1894
90 Ga0207644_10008315 3300025931 Bacteria 6800
91 Ga0207690_10064448 3300025932 Bacteria 2502
92 Ga0207690_10072357 3300025932 Bacteria 2381
93 Ga0207706_10056478 3300025933 Bacteria 3461
94 Ga0207689_10001338 3300025942 Bacteria 23720
95 Ga0207661_10187831 3300025944 Bacteria 1810
96 Ga0207679_10005318 3300025945 Bacteria 8071
97 Ga0207668_10001735 3300025972 Bacteria 12771
98 Ga0207640_10081086 3300025981 Bacteria 2217
99 Ga0207658_10142415 3300025986 Bacteria 1942
100 Ga0207658_10152437 3300025986 Bacteria 1885
101 Ga0207677_10021696 3300026023 Bacteria 3929
102 Ga0207678_10000370 3300026067 Bacteria 40947
103 Ga0207708_10006904 3300026075 Bacteria 8399
104 Ga0207702_10006529 3300026078 Bacteria 10035
105 Ga0207702_10007022 3300026078 Bacteria 9632
106 Ga0207641_10111915 3300026088 Bacteria 2421
107 Ga0207676_10002253 3300026095 Bacteria 13848
108 Ga0207676_10103231 3300026095 Bacteria 2369
109 Ga0207675_100064601 3300026118 Bacteria 3421
110 Ga0207683_10004546 3300026121 Bacteria 11957
111 Ga0207698_10004170 3300026142 Bacteria 8789
112 Ga0207428_10010279 3300027907 Bacteria 8364
113 Ga0268266_10008694 3300028379 Bacteria 9004
114 Ga0268266_10175125 3300028379 Bacteria 1950
115 Ga0268264_10157501 3300028381 Bacteria 2042
116 Ga0307515_10016217 3300028794 Bacteria 13655
117 Ga0307515_10030629 3300028794 Bacteria 9019
118 Ga0307515_10061036 3300028794 Bacteria 5360
119 Ga0307512_10113799 3300030522 Bacteria 1769
120 Ga0307513_10089879 3300031456 Bacteria 3134
121 Ga0307509_10137860 3300031507 Bacteria 2382
122 Ga0307509_10156313 3300031507 Bacteria 2186
123 Ga0307408_100095177 3300031548 Bacteria 2257
124 Ga0307408_100139778 3300031548 Bacteria 1900
125 Ga0307508_10006134 3300031616 Bacteria 11340
126 Ga0307508_10097311 3300031616 Bacteria 2535
127 Ga0307516_10004740 3300031730 Bacteria 16611
128 Ga0307405_10030104 3300031731 Bacteria 3180
129 Ga0307405_10070131 3300031731 Bacteria 2250
130 Ga0307413_10075893 3300031824 Bacteria 2135
131 Ga0307413_10208577 3300031824 Bacteria 1417
132 Ga0307410_10058052 3300031852 Bacteria 2637
133 Ga0307410_10078024 3300031852 Bacteria 2317
134 Ga0307406_10137262 3300031901 Bacteria 1726
135 Ga0307406_10141927 3300031901 Bacteria 1701
136 Ga0307407_10007230 3300031903 Bacteria 5014
137 Ga0307407_10034263 3300031903 Bacteria 2778
138 Ga0307407_10045850 3300031903 Bacteria 2473
139 Ga0307407_10079815 3300031903 Bacteria 1975
140 Ga0307409_100110264 3300031995 Bacteria 2306
141 Ga0307409_100151293 3300031995 Bacteria 2015
142 Ga0307409_100173371 3300031995 Bacteria 1901
143 Ga0307409_100180364 3300031995 Bacteria 1869
144 Ga0307409_100239228 3300031995 Bacteria 1651
145 Ga0307409_100421552 3300031995 Bacteria 1280
146 Ga0307416_100016537 3300032002 Bacteria 5131
147 Ga0307416_100020664 3300032002 Bacteria 4705
148 Ga0307416_100055402 3300032002 Bacteria 3193
149 Ga0307416_100061233 3300032002 Bacteria 3070
150 Ga0307416_100076595 3300032002 Bacteria 2804
151 Ga0307416_100332152 3300032002 Bacteria 1528
152 Ga0307414_10102604 3300032004 Bacteria 2156
153 Ga0307414_10163736 3300032004 Bacteria 1770
154 Ga0307414_10202620 3300032004 Bacteria 1615
155 Ga0307414_10245180 3300032004 Bacteria 1486
156 Ga0307415_100006478 3300032126 Bacteria 6321
157 Ga0307415_100066396 3300032126 Bacteria 2517
158 Ga0373940_0023031 3300035088 Bacteria 1604
159 Ga0373942_0000404 3300035207 Bacteria 12007
160 Ga0373931_0044731 3300035691 Bacteria 2336
161 Ga0395900_0019414 3300037418 Bacteria 6930
162 Ga0395901_0006128 3300038443 Bacteria 12185
163 Ga0439448_0015858 3300042005 Bacteria 2287
164 Ga0466972_0008080 3300044658 Bacteria 5273
165 Ga0466961_0023634 3300044693 Bacteria 3955
166 Ga0466963_0054041 3300044694 Bacteria 2668
167 Ga0466963_0074287 3300044694 Bacteria 2292
168 Ga0466971_0038460 3300044719 Bacteria 2147
169 Ga0466971_0123524 3300044719 Bacteria 1199
170 Ga0466970_0099128 3300044765 Bacteria 1586
171 Ga0466957_0058014 3300044842 Bacteria 2371
172 Ga0466960_0007266 3300044901 Bacteria 4489
173 Ga0466960_0025281 3300044901 Bacteria 2686
174 Ga0466960_0049320 3300044901 Bacteria 2026
175 Ga0466960_0152168 3300044901 Bacteria 1236
176 Ga0466959_0055602 3300045049 Bacteria 2889
177 Ga0466967_0008100 3300045976 Bacteria 7665
178 Ga0466967_0019010 3300045976 Bacteria 5513
179 Ga0466967_0070447 3300045976 Bacteria 3128
180 Ga0466967_0085381 3300045976 Bacteria 2858
181 Ga0466967_0141088 3300045976 Bacteria 2244
182 Ga0466967_0183793 3300045976 Bacteria 1973
183 Ga0466967_0240697 3300045976 Bacteria 1726
184 Ga0495629_0053548 3300046459 Bacteria 2823
185 Ga0495594_0016733 3300046499 Bacteria 3866
186 Ga0495596_0072970 3300046500 Bacteria 1333
187 Ga0495632_0021164 3300046519 Bacteria 3508
188 Ga0496101_0050506 3300048904 Bacteria 2994
189 Ga0496102_0031553 3300048905 Bacteria 4754
190 Ga0496103_0090299 3300048906 Bacteria 1933
191 Ga0496104_0020533 3300048907 Bacteria 6055
192 Ga0496105_0001341 3300048908 Bacteria 17253
193 Ga0496106_0008388 3300048909 Bacteria 7645
194 Ga0496108_0000089 3300048911 Bacteria 97102
195 Ga0496108_0051530 3300048911 Bacteria 3448
196 Ga0496109_0008041 3300048912 Bacteria 8938
197 Ga0496109_0173023 3300048912 Bacteria 2026
198 Ga0496110_0022159 3300048913 Bacteria 5389
199 Ga0496111_0006123 3300048914 Bacteria 7780
200 Ga0496112_0051682 3300048915 Bacteria 4031
201 Ga0496112_0091002 3300048915 Bacteria 3019
202 Ga0496112_0112772 3300048915 Bacteria 2689
203 Ga0496112_0346277 3300048915 Bacteria 1429
204 Ga0496113_0022119 3300048916 Bacteria 4492
205 Ga0496114_0207280 3300048917 Bacteria 1719
206 Ga0496126_0000007 3300048929 Bacteria 787364
207 Ga0496126_0019225 3300048929 Bacteria 6733
208 Ga0496126_0414710 3300048929 Bacteria 1090
209 Ga0501031_0081403 3300049568 Bacteria 2111
210 Ga0501039_0078043 3300049575 Bacteria 2576
211 Ga0501046_0026740 3300049580 Bacteria 4713
212 Ga0501074_0010959 3300049590 Bacteria 6582
213 Ga0501045_0224301 3300049824 Bacteria 1399
214 nmdc:mga06r32_12197_c2 3300050510 Bacteria 5369
215 nmdc:mga06r32_242786_c1 3300050510 Bacteria 1788
216 nmdc:mga06r32_329322_c1 3300050510 Bacteria 1512
217 nmdc:mga08y16_11208_c1 3300050511 Bacteria 9417
218 nmdc:mga0n895_7858_c1 3300050512 Bacteria 9194
219 nmdc:mga0rr50_5293_c1 3300050513 Bacteria 7675
220 nmdc:mga0a205_40215_c1 3300050515 Bacteria 4501
221 Ga0500568_0002380 3300053139 Bacteria 11121
222 Ga0466962_0075323 3300061719 Bacteria 1613
223 2501943503 2501939600 Bacteria 6907073
224 2515498097 2515154088 Bacteria 5526283
225 2515720354 2515154129 Bacteria 5584369
226 2515759204 2515154137 Bacteria 5711575
227 2516084589 2515154202 Bacteria 5471270
228 2516090943 2515154203 Bacteria 5458536
229 2623497958 2622736605 Bacteria 4992138
230 2623585397 2622736626 Bacteria 7181580
231 2676485070 2675903059 Bacteria 8644972
232 2772645326 2772190715 Bacteria 6959372
233 2832005790 2832004796 Bacteria 6538017
234 2855675874 2855670206 Bacteria 7120389
235 2855677195 2855676851 Bacteria 7063653
236 2855687890 2855683550 Bacteria 7134265
237 2856859313 2856858025 Bacteria 7255264
238 2857291468 2857288857 Bacteria 7189066
239 2858850229 2858848962 Bacteria 6963058
240 2858884749 2858882152 Bacteria 7230291
241 2858893298 2858888857 Bacteria 7060307
242 2858900348 2858895516 Bacteria 7378898
243 2861525708 2861520306 Bacteria 8348283
244 2866068833 2866065130 Bacteria 6518152
245 2867317157 2867312974 Bacteria 7058875
246 2867322979 2867319477 Bacteria 7069771
247 2869048765 2869048445 Bacteria 6875584
248 2869066905 2869061728 Bacteria 7112407
249 2869072211 2869068681 Bacteria 7205615
250 2880494822 2880489317 Bacteria 7096270
251 2880497492 2880495981 Bacteria 7340502
252 2902584381 2902582711 Bacteria 6187705
253 2929226055 2929219909 Bacteria 6984360
254 2929232720 2929226422 Bacteria 7248583
255 649812823 649633069 Bacteria 6962533
256 8003833998 8003830390 Bacteria 6541657
257 8003861146 8003856774 Bacteria 7675274
258 8003872531 8003870546 Bacteria 7396674
259 8054704189 8054704163 Bacteria 7247792
260 8054732342 8054727385 Bacteria 7558670
261 8054739305 8054734606 Bacteria 6947278
262 8057570213 8057568493 Bacteria 7221719
263 Ga0501038_0168693
264 JGI24752J21851_1004717
265 Ga0070683_100044616
266 Ga0070670_100345049
267 Ga0068869_100007483
268 Ga0070680_100037733
269 Ga0068868_100025855
270 Ga0070689_100008622
271 Ga0070691_10021379
272 Ga0070692_10014039
273 Ga0070668_100004610
274 Ga0070675_100033368
275 Ga0070671_100000852
276 Ga0070688_100053822
277 Ga0070659_100171764
278 Ga0070667_100086689
279 Ga0070667_100242670
280 Ga0070709_10027473
281 Ga0070714_100029895
282 Ga0070713_100001939
283 Ga0070663_100001441
284 Ga0070678_100010268
285 Ga0070681_10015977
286 Ga0070679_100026693
287 Ga0070684_100109226
288 Ga0070672_100056910
289 Ga0070665_100360079
290 Ga0070664_100300113
291 Ga0068856_100001452
292 Ga0068856_100047191
293 Ga0070702_100003125
294 Ga0068852_100023581
295 Ga0068859_100086205
296 Ga0068864_100046968
297 Ga0068864_100074065
298 Ga0068870_10000665
299 Ga0068863_100004712
300 Ga0068858_100423973
301 Ga0068860_100066179
302 Ga0068862_100285904
303 Ga0081455_10001676
304 Ga0081539_10000205
305 Ga0081539_10000256
306 Ga0081539_10002834
307 Ga0081539_10014725
308 Ga0070717_10038120
309 Ga0070712_100102739
310 Ga0097621_100315346
311 Ga0075431_100038138
312 Ga0075431_100131808
313 Ga0075431_100290425
314 Ga0075431_100316622
315 Ga0075433_10075334
316 Ga0075436_100004433
317 Ga0097620_100086206
318 Ga0075435_100023692
319 Ga0105251_10049061
320 Ga0105240_10071870
321 Ga0105245_10144058
322 Ga0114129_10146733
323 Ga0105241_10001374
324 Ga0105248_10025952
325 Ga0105237_10128707
326 Ga0105239_10368038
327 Ga0105246_10003825
328 Ga0157371_10019138
329 Ga0157370_10103808
330 Ga0157374_10036032
331 Ga0163163_10386882
332 Ga0182008_10016425
333 Ga0157379_10151280
334 Ga0206354_11490498
335 Ga0206353_10701281
336 Ga0207656_10003818
337 Ga0207688_10001279
338 Ga0207643_10000310
339 Ga0207705_10009454
340 Ga0207654_10022674
341 Ga0207660_10009899
342 Ga0207662_10020356
343 Ga0207657_10084514
344 Ga0207649_10007517
345 Ga0207652_10013662
346 Ga0207652_10129034
347 Ga0207652_10190316
348 Ga0207694_10081014
349 Ga0207650_10003746
350 Ga0207659_10023107
351 Ga0207687_10130392
352 Ga0207644_10008315
353 Ga0207690_10064448
354 Ga0207690_10072357
355 Ga0207706_10056478
356 Ga0207689_10001338
357 Ga0207661_10187831
358 Ga0207679_10005318
359 Ga0207668_10001735
360 Ga0207640_10081086
361 Ga0207658_10142415
362 Ga0207658_10152437
363 Ga0207677_10021696
364 Ga0207678_10000370
365 Ga0207708_10006904
366 Ga0207702_10006529
367 Ga0207702_10007022
368 Ga0207641_10111915
369 Ga0207676_10002253
370 Ga0207676_10103231
371 Ga0207675_100064601
372 Ga0207683_10004546
373 Ga0207698_10004170
374 Ga0207428_10010279
375 Ga0268266_10008694
376 Ga0268266_10175125
377 Ga0268264_10157501
378 Ga0307515_10016217
379 Ga0307515_10030629
380 Ga0307515_10061036
381 Ga0307512_10113799
382 Ga0307513_10089879
383 Ga0307509_10137860
384 Ga0307509_10156313
385 Ga0307408_100095177
386 Ga0307408_100139778
387 Ga0307508_10006134
388 Ga0307508_10097311
389 Ga0307516_10004740
390 Ga0307405_10030104
391 Ga0307405_10070131
392 Ga0307413_10075893
393 Ga0307413_10208577
394 Ga0307410_10058052
395 Ga0307410_10078024
396 Ga0307406_10137262
397 Ga0307406_10141927
398 Ga0307407_10007230
399 Ga0307407_10034263
400 Ga0307407_10045850
401 Ga0307407_10079815
402 Ga0307409_100110264
403 Ga0307409_100151293
404 Ga0307409_100173371
405 Ga0307409_100180364
406 Ga0307409_100239228
407 Ga0307409_100421552
408 Ga0307416_100016537
409 Ga0307416_100020664
410 Ga0307416_100055402
411 Ga0307416_100061233
412 Ga0307416_100076595
413 Ga0307416_100332152
414 Ga0307414_10102604
415 Ga0307414_10163736
416 Ga0307414_10202620
417 Ga0307414_10245180
418 Ga0307415_100006478
419 Ga0307415_100066396
420 Ga0373940_0023031
421 Ga0373942_0000404
422 Ga0373931_0044731
423 Ga0395900_0019414
424 Ga0395901_0006128
425 Ga0439448_0015858
426 Ga0466972_0008080
427 Ga0466961_0023634
428 Ga0466963_0054041
429 Ga0466963_0074287
430 Ga0466971_0038460
431 Ga0466971_0123524
432 Ga0466970_0099128
433 Ga0466957_0058014
434 Ga0466960_0007266
435 Ga0466960_0025281
436 Ga0466960_0049320
437 Ga0466960_0152168
438 Ga0466959_0055602
439 Ga0466967_0008100
440 Ga0466967_0019010
441 Ga0466967_0070447
442 Ga0466967_0085381
443 Ga0466967_0141088
444 Ga0466967_0183793
445 Ga0466967_0240697
446 Ga0495629_0053548
447 Ga0495594_0016733
448 Ga0495596_0072970
449 Ga0495632_0021164
450 Ga0496101_0050506
451 Ga0496102_0031553
452 Ga0496103_0090299
453 Ga0496104_0020533
454 Ga0496105_0001341
455 Ga0496106_0008388
456 Ga0496108_0000089
457 Ga0496108_0051530
458 Ga0496109_0008041
459 Ga0496109_0173023
460 Ga0496110_0022159
461 Ga0496111_0006123
462 Ga0496112_0051682
463 Ga0496112_0091002
464 Ga0496112_0112772
465 Ga0496112_0346277
466 Ga0496113_0022119
467 Ga0496114_0207280
468 Ga0496126_0000007
469 Ga0496126_0019225
470 Ga0496126_0414710
471 Ga0501031_0081403
472 Ga0501039_0078043
473 Ga0501046_0026740
474 Ga0501074_0010959
475 Ga0501045_0224301
476 nmdc:mga06r32_12197_c2
477 nmdc:mga06r32_242786_c1
478 nmdc:mga06r32_329322_c1
479 nmdc:mga08y16_11208_c1
480 nmdc:mga0n895_7858_c1
481 nmdc:mga0rr50_5293_c1
482 nmdc:mga0a205_40215_c1
483 Ga0500568_0002380
484 Ga0466962_0075323
485 2501943503
486 2515498097
487 2515720354
488 2515759204
489 2516084589
490 2516090943
491 2623497958
492 2623585397
493 2676485070
494 2772645326
495 2832005790
496 2855675874
497 2855677195
498 2855687890
499 2856859313
500 2857291468
501 2858850229
502 2858884749
503 2858893298
504 2858900348
505 2861525708
506 2866068833
507 2867317157
508 2867322979
509 2869048765
510 2869066905
511 2869072211
512 2880494822
513 2880497492
514 2902584381
515 2929226055
516 2929232720
517 649812823
518 8003833998
519 8003861146
520 8003872531
521 8054704189
522 8054732342
523 8054739305
524 8057570213

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08541

ACP_syn_III_C

3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal

294

382

0.93

PF02797

Chal_sti_synt_C

Chalcone and stilbene synthases, C-terminal domain

247

383

0.91

PF00195

Chal_sti_synt_N

Chalcone and stilbene synthases, N-terminal domain

84

235

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4jd3-assembly2.cif.gz_C crystal structure of mycobacterium tuberculosis pks11 reveals intermediates in the synthesis of methyl-branched alkylpyrones 0.9458 5 347
1u0m-assembly1.cif.gz_B crystal structure of 1,3,6,8-tetrahydroxynaphthalene synthase (thns) from streptomyces coelicolor a3(2): a bacterial type iii polyketide synthase (pks) provides insights into enzymatic control of reactive polyketide intermediates 0.9437 5 347
2h84-assembly1.cif.gz_B crystal structure of the c-terminal type iii polyketide synthase (pks iii) domain of 'steely1' (a type i/iii pks hybrid from dictyostelium) 0.9409 3 346
5wx5-assembly3.cif.gz_F alkylquinolone synthase y215v mutant from evodia rutaecarpa 0.9379 1 347
4wum-assembly2.cif.gz_D x-ray crystal structure of chalcone synthase from freesia hybrida 0.9379 3 347
ID Description Score Start End Superfamily
1tedA02 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9515 204 346 3.40.47.10
af_A0A0R0EFL7_291_413_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9482 261 347 3.40.47.10
1u0mB02 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.94 203 347 3.40.47.10
af_A0A0P0V4Z5_2_163_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9362 60 195 3.40.47.10
4jaoA02 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.936 202 347 3.40.47.10
ID Description Score Start End GO Terms
AF-A0A522YFU9-F1-model_v4 deleted 0.9921 6 155
AF-A0A1I3Z7N4-F1-model_v4 Predicted naringenin-chalcone synthase 0.9853 3 347 GO:0016747
GO:0030639
AF-A0A1I3Z7N4-F1-model_v4 Predicted naringenin-chalcone synthase 0.9796 3 347 GO:0016747
GO:0030639
AF-A0A7X6D161-F1-model_v4 Type III polyketide synthase 0.9772 1 346 GO:0016747
GO:0030639
AF-A0A810KZZ7-F1-model_v4 Naringenin-chalcone synthase 0.9758 2 347 GO:0016747
GO:0030639

Map