F371102

General Info

Members Datasets Scaffolds Average Seq Length
262 202 524 127

Family's Representative Sequence

Representative Sequence 3300014968|Ga0157379_10359740|Ga0157379_103597403
Length 156
Sequence VRLPPVAPIPSAPFIDPHRILAMTLHIVRLGTPRLAHEGTRIGTVRRPPRGVPKSRFASDDWYDVWFPLLSPSAELVKLALAAQQDDSAEGRRQWAGFVRDFRKEMRAPEAAHALDLLAALSHHGDFSVGCYCEDEARCHRSVLRELFVERGARIA

Samples

Sample ID Description Type Environment
1 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
105 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
106 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
107 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
108 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
109 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
110 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
111 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
112 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
113 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
114 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
115 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
116 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
117 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
120 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
121 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
122 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
123 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
124 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
125 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
126 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
127 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
128 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
129 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
130 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
131 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
132 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
133 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
134 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
135 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
136 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
137 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
138 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
139 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
140 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
141 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
142 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
143 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
144 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
145 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
146 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
147 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
148 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
149 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
150 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
151 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
152 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
153 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
154 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
155 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
156 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
157 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
158 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
159 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
160 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
161 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
162 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
163 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
164 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
165 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
166 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
167 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
168 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
169 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
170 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
178 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
179 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
180 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
181 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
182 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
183 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
184 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
185 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
186 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
187 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
188 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
189 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
190 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
191 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
192 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
193 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
194 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
195 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
196 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
197 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
198 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
199 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
200 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
201 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
202 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.62
Metatranscriptomes 0.38
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.49
Nodule 0
Rhizoplane 2.67
Rhizosphere 89.69
Stem 0
Stem Tuber 0
Unclassified 4.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157379_10359740 3300014968 Bacteria 1334
2 Ga0065712_10027306 3300005290 Bacteria 1215
3 Ga0065715_10446983 3300005293 Bacteria 808
4 Ga0070658_10412195 3300005327 Bacteria 1161
5 Ga0070676_10137197 3300005328 Bacteria 1553
6 Ga0070683_100520001 3300005329 Bacteria 1137
7 Ga0070690_100369920 3300005330 Bacteria 1045
8 Ga0070670_100294655 3300005331 Unclassified 1418
9 Ga0070677_10013742 3300005333 Bacteria 2838
10 Ga0068869_100148939 3300005334 Bacteria 1813
11 Ga0070666_10403450 3300005335 Bacteria 983
12 Ga0070689_101581434 3300005340 Bacteria 595
13 Ga0070661_100000496 3300005344 Bacteria 30227
14 Ga0070692_10390785 3300005345 Bacteria 875
15 Ga0070675_100042616 3300005354 Bacteria 3709
16 Ga0070688_100094259 3300005365 Bacteria 1962
17 Ga0070659_100131884 3300005366 Bacteria 2030
18 Ga0070710_10682101 3300005437 Bacteria 723
19 Ga0070701_10330729 3300005438 Bacteria 946
20 Ga0070700_100019186 3300005441 Bacteria 3944
21 Ga0070663_100186003 3300005455 Bacteria 1614
22 Ga0070678_100360689 3300005456 Bacteria 1252
23 Ga0070681_10157270 3300005458 Bacteria 2197
24 Ga0068867_100016517 3300005459 Bacteria 5242
25 Ga0068867_100034368 3300005459 Bacteria 3674
26 Ga0070685_10087826 3300005466 Bacteria 1877
27 Ga0070679_100024768 3300005530 Bacteria 5882
28 Ga0068853_100007133 3300005539 Bacteria 8938
29 Ga0070672_100090734 3300005543 Bacteria 2465
30 Ga0070686_100224992 3300005544 Bacteria 1358
31 Ga0070686_100934549 3300005544 Bacteria 707
32 Ga0070693_100218157 3300005547 Bacteria 1248
33 Ga0070665_100057881 3300005548 Bacteria 3886
34 Ga0070665_100754257 3300005548 Bacteria 986
35 Ga0070704_100525299 3300005549 Bacteria 1031
36 Ga0068855_100034170 3300005563 Bacteria 6066
37 Ga0070664_100001472 3300005564 Bacteria 18781
38 Ga0068857_100001207 3300005577 Bacteria 20142
39 Ga0068857_100068259 3300005577 Bacteria 3165
40 Ga0068856_100027947 3300005614 Bacteria 5504
41 Ga0068856_100623237 3300005614 Bacteria 1099
42 Ga0068852_100002527 3300005616 Bacteria 12600
43 Ga0068861_100005158 3300005719 Bacteria 8814
44 Ga0068861_100076023 3300005719 Bacteria 2616
45 Ga0068851_10022745 3300005834 Bacteria 3058
46 Ga0068851_10613311 3300005834 Bacteria 663
47 Ga0068858_100022830 3300005842 Bacteria 5835
48 Ga0068858_100109492 3300005842 Bacteria 2579
49 Ga0068860_100004201 3300005843 Bacteria 14760
50 Ga0075369_10183575 3300006186 Bacteria 963
51 Ga0075369_10447285 3300006186 Bacteria 612
52 Ga0075366_10028730 3300006195 Bacteria 3265
53 Ga0075366_10118711 3300006195 Bacteria 1593
54 Ga0075366_10131455 3300006195 Bacteria 1511
55 Ga0097621_100699741 3300006237 Bacteria 933
56 Ga0068865_100003091 3300006881 Bacteria 9960
57 Ga0075436_100220364 3300006914 Bacteria 1346
58 Ga0075436_101009827 3300006914 Unclassified 624
59 Ga0075435_100011793 3300007076 Bacteria 6450
60 Ga0075435_100427892 3300007076 Unclassified 1140
61 Ga0075435_100705236 3300007076 Bacteria 877
62 Ga0075435_101570236 3300007076 Bacteria 577
63 Ga0111539_10306078 3300009094 Bacteria 1849
64 Ga0105245_11192327 3300009098 Unclassified 809
65 Ga0105241_10049614 3300009174 Bacteria 3197
66 Ga0105242_11262682 3300009176 Bacteria 761
67 Ga0105242_11995907 3300009176 Bacteria 622
68 Ga0105242_12245425 3300009176 Bacteria 591
69 Ga0105248_11019495 3300009177 Bacteria 935
70 Ga0105237_10092739 3300009545 Bacteria 3010
71 Ga0105238_11144408 3300009551 Bacteria 802
72 Ga0105249_10044664 3300009553 Bacteria 4029
73 Ga0105239_10087348 3300010375 Bacteria 3437
74 Ga0105239_12200216 3300010375 Bacteria 641
75 Ga0157370_10018697 3300013104 Bacteria 6967
76 Ga0157369_10060892 3300013105 Bacteria 4070
77 Ga0157378_10002071 3300013297 Bacteria 17952
78 Ga0163162_10050059 3300013306 Bacteria 4189
79 Ga0157372_10049777 3300013307 Bacteria 4661
80 Ga0157375_10347706 3300013308 Bacteria 1648
81 Ga0163163_10484406 3300014325 Bacteria 1298
82 Ga0163163_11002609 3300014325 Bacteria 898
83 Ga0182008_10304974 3300014497 Bacteria 834
84 Ga0157377_10729697 3300014745 Bacteria 723
85 Ga0157379_10124572 3300014968 Bacteria 2318
86 Ga0157379_10170688 3300014968 Bacteria 1964
87 Ga0206356_11173333 3300020070 Bacteria 538
88 Ga0209677_103773 3300025253 Bacteria 4714
89 Ga0209051_1018491 3300025303 Bacteria 3082
90 Ga0209051_1040964 3300025303 Bacteria 1654
91 Ga0207697_10179666 3300025315 Bacteria 927
92 Ga0207645_10143683 3300025907 Bacteria 1555
93 Ga0207643_10885137 3300025908 Bacteria 579
94 Ga0207705_10329691 3300025909 Bacteria 1174
95 Ga0207654_11145994 3300025911 Bacteria 567
96 Ga0207707_11071051 3300025912 Bacteria 658
97 Ga0207660_10906069 3300025917 Bacteria 719
98 Ga0207649_10124371 3300025920 Bacteria 1743
99 Ga0207652_10136438 3300025921 Bacteria 2191
100 Ga0207681_10478134 3300025923 Bacteria 1017
101 Ga0207694_10029880 3300025924 Bacteria 4160
102 Ga0207650_10851633 3300025925 Bacteria 773
103 Ga0207659_10662787 3300025926 Bacteria 892
104 Ga0207690_10357433 3300025932 Bacteria 1156
105 Ga0207686_10073504 3300025934 Bacteria 2206
106 Ga0207686_11208181 3300025934 Bacteria 619
107 Ga0207704_10007178 3300025938 Bacteria 5245
108 Ga0207691_10069742 3300025940 Bacteria 3175
109 Ga0207711_10676366 3300025941 Bacteria 963
110 Ga0207711_11175980 3300025941 Bacteria 708
111 Ga0207689_10263244 3300025942 Bacteria 1427
112 Ga0207661_10985915 3300025944 Bacteria 776
113 Ga0207667_10080049 3300025949 Bacteria 3385
114 Ga0207712_10023373 3300025961 Bacteria 4078
115 Ga0207703_10078009 3300026035 Bacteria 2751
116 Ga0207678_10132463 3300026067 Bacteria 2127
117 Ga0207708_10025947 3300026075 Bacteria 4433
118 Ga0207708_10194149 3300026075 Bacteria 1617
119 Ga0207702_10555065 3300026078 Bacteria 1124
120 Ga0207641_11144948 3300026088 Bacteria 777
121 Ga0207648_10000432 3300026089 Bacteria 46265
122 Ga0207674_10000046 3300026116 Bacteria 122047
123 Ga0207674_10080254 3300026116 Bacteria 3266
124 Ga0207674_10083631 3300026116 Bacteria 3191
125 Ga0207675_100012122 3300026118 Bacteria 8054
126 Ga0207683_10223793 3300026121 Bacteria 1715
127 Ga0207698_10070502 3300026142 Bacteria 2769
128 Ga0207428_10017802 3300027907 Bacteria 6093
129 Ga0268265_10030478 3300028380 Bacteria 3885
130 Ga0268264_10032350 3300028381 Bacteria 4291
131 Ga0265318_10183606 3300028577 Bacteria 766
132 Ga0265323_10046098 3300028653 Bacteria 1564
133 Ga0307515_10296100 3300028794 Bacteria 1308
134 Ga0265330_10174843 3300031235 Bacteria 910
135 Ga0307408_100006469 3300031548 Bacteria 7767
136 Ga0307408_100084570 3300031548 Bacteria 2380
137 Ga0307408_100248629 3300031548 Bacteria 1465
138 Ga0307408_101145355 3300031548 Unclassified 723
139 Ga0265313_10016585 3300031595 Bacteria 4228
140 Ga0265342_10115013 3300031712 Bacteria 1519
141 Ga0307405_10003785 3300031731 Bacteria 7029
142 Ga0307405_10016722 3300031731 Bacteria 4007
143 Ga0307405_10191399 3300031731 Bacteria 1478
144 Ga0307405_10713046 3300031731 Unclassified 832
145 Ga0307413_10066163 3300031824 Bacteria 2254
146 Ga0307413_11857304 3300031824 Bacteria 540
147 Ga0307410_10014860 3300031852 Bacteria 4597
148 Ga0307410_10037700 3300031852 Bacteria 3160
149 Ga0307406_10003155 3300031901 Bacteria 8970
150 Ga0307406_10036871 3300031901 Bacteria 3015
151 Ga0307406_10680753 3300031901 Bacteria 857
152 Ga0307406_11021069 3300031901 Bacteria 710
153 Ga0307407_10007581 3300031903 Bacteria 4923
154 Ga0307407_11188297 3300031903 Bacteria 595
155 Ga0307412_10004790 3300031911 Bacteria 7549
156 Ga0307409_100037645 3300031995 Bacteria 3568
157 Ga0307409_100458352 3300031995 Bacteria 1232
158 Ga0307416_100002112 3300032002 Bacteria 11226
159 Ga0307416_101794028 3300032002 Bacteria 717
160 Ga0307414_10270247 3300032004 Bacteria 1423
161 Ga0307411_10004288 3300032005 Bacteria 6805
162 Ga0307411_10461017 3300032005 Bacteria 1065
163 Ga0307415_100003659 3300032126 Bacteria 7860
164 Ga0307415_100676731 3300032126 Bacteria 928
165 Ga0307415_101821403 3300032126 Unclassified 589
166 Ga0373939_0219927 3300035114 Bacteria 727
167 Ga0373937_1186978 3300036401 Bacteria 712
168 Ga0439439_0142245 3300041406 Bacteria 678
169 Ga0439453_0003377 3300041408 Bacteria 2293
170 Ga0451802_0207535 3300041460 Bacteria 531
171 Ga0451845_0906109 3300041501 Bacteria 725
172 Ga0439431_0020189 3300041997 Bacteria 1590
173 Ga0439441_024527 3300042001 Unclassified 1133
174 Ga0439451_066874 3300042009 Unclassified 719
175 Ga0439462_0010176 3300042015 Bacteria 2381
176 Ga0450912_003179 3300042116 Bacteria 1156
177 Ga0450920_001749 3300042122 Bacteria 3643
178 Ga0450923_000801 3300042125 Bacteria 3778
179 Ga0450923_003864 3300042125 Bacteria 2305
180 Ga0450895_001449 3300042132 Bacteria 1644
181 Ga0450896_000200 3300042133 Bacteria 5224
182 Ga0450898_025082 3300042134 Bacteria 1068
183 Ga0450898_082103 3300042134 Bacteria 656
184 Ga0450906_031973 3300042145 Bacteria 930
185 Ga0450906_036413 3300042145 Bacteria 868
186 Ga0450907_025952 3300042146 Bacteria 991
187 Ga0439446_0002532 3300042156 Bacteria 4396
188 Ga0450908_001092 3300042184 Bacteria 5267
189 Ga0439434_0002789 3300042435 Bacteria 5096
190 Ga0439434_0124624 3300042435 Bacteria 842
191 Ga0439435_0000323 3300042436 Bacteria 7215
192 Ga0439444_0000950 3300042437 Bacteria 3550
193 Ga0439460_0018866 3300042461 Unclassified 1862
194 Ga0450916_052633 3300042530 Bacteria 645
195 Ga0450918_026865 3300042531 Bacteria 1011
196 Ga0466966_0002639 3300044684 Bacteria 11740
197 Ga0466963_0264286 3300044694 Bacteria 1208
198 Ga0466964_0549979 3300044706 Bacteria 626
199 Ga0466971_0006285 3300044719 Bacteria 5159
200 Ga0466970_0044840 3300044765 Bacteria 2354
201 Ga0466957_0001863 3300044842 Bacteria 11149
202 Ga0451576_0006861 3300045051 Bacteria 13805
203 Ga0451576_0011236 3300045051 Bacteria 10200
204 Ga0451576_0833264 3300045051 Bacteria 968
205 Ga0466958_0144159 3300045836 Bacteria 1500
206 Ga0495664_0020493 3300046477 Bacteria 3814
207 Ga0495583_0000350 3300046506 Bacteria 72716
208 Ga0495610_0201371 3300046512 Bacteria 815
209 Ga0495628_0968061 3300046516 Bacteria 587
210 Ga0495648_0495957 3300046524 Bacteria 525
211 Ga0495586_0071072 3300046535 Bacteria 1901
212 Ga0495599_0031044 3300046678 Bacteria 3354
213 Ga0495649_0004041 3300046694 Bacteria 9660
214 Ga0495589_0011467 3300046794 Bacteria 4602
215 Ga0496105_0296803 3300048908 Bacteria 1300
216 Ga0496106_0512006 3300048909 Bacteria 964
217 Ga0496106_1052844 3300048909 Bacteria 639
218 Ga0496108_0291365 3300048911 Bacteria 1421
219 Ga0496108_1453996 3300048911 Bacteria 572
220 Ga0496114_0804207 3300048917 Bacteria 819
221 Ga0496122_0214761 3300048925 Bacteria 1110
222 Ga0501033_0692332 3300049570 Bacteria 694
223 Ga0501036_0387365 3300049572 Bacteria 1166
224 Ga0501036_1064004 3300049572 Bacteria 661
225 Ga0501037_0334419 3300049573 Bacteria 1047
226 Ga0501040_0065022 3300049576 Bacteria 2512
227 Ga0501040_0992573 3300049576 Bacteria 609
228 Ga0501042_0039557 3300049578 Bacteria 3351
229 Ga0501046_0405596 3300049580 Bacteria 984
230 Ga0501046_0941517 3300049580 Bacteria 601
231 Ga0501048_0179263 3300049582 Bacteria 1502
232 Ga0501067_0027497 3300049583 Bacteria 3152
233 Ga0501068_0307627 3300049584 Bacteria 1015
234 Ga0501068_1156630 3300049584 Bacteria 512
235 Ga0501069_0158778 3300049585 Bacteria 1302
236 Ga0501071_0006124 3300049587 Bacteria 7796
237 Ga0501072_0016908 3300049588 Bacteria 5604
238 Ga0501073_0803625 3300049589 Bacteria 648
239 Ga0501075_0022334 3300049591 Bacteria 4621
240 Ga0501076_0011440 3300049592 Bacteria 6610
241 Ga0501076_0751636 3300049592 Bacteria 805
242 Ga0501225_0014315 3300049705 Bacteria 2216
243 Ga0501079_0039496 3300049741 Bacteria 3640
244 Ga0501081_0108722 3300049743 Bacteria 1967
245 Ga0501083_0494271 3300049744 Bacteria 796
246 Ga0501045_0168482 3300049824 Bacteria 1631
247 nmdc:mga0k408_121975_c1 3300050493 Bacteria 1544
248 nmdc:mga0k408_364828_c1 3300050493 Unclassified 861
249 nmdc:mga08y16_208493_c1 3300050511 Bacteria 2024
250 nmdc:mga0rr50_298088_c1 3300050513 Bacteria 1348
251 nmdc:mga0rr50_459030_c1 3300050513 Unclassified 1080
252 nmdc:mga0rr50_72263_c1 3300050513 Bacteria 2634
253 nmdc:mga08x19_205149_c1 3300050514 Bacteria 1352
254 nmdc:mga0sz30_65203_c1 3300050516 Bacteria 1561
255 Ga0500569_043140 3300053109 Bacteria 1331
256 Ga0500572_146911 3300053111 Bacteria 769
257 Ga0500608_171596 3300053122 Bacteria 929
258 Ga0500616_0032164 3300053153 Bacteria 2869
259 Ga0500622_0012164 3300053156 Bacteria 4669
260 Ga0500636_0030534 3300053177 Bacteria 3187
261 Ga0501082_1212043 3300060353 Bacteria 659
262 Ga0466962_0007334 3300061719 Bacteria 5291
263 Ga0157379_10359740
264 Ga0065712_10027306
265 Ga0065715_10446983
266 Ga0070658_10412195
267 Ga0070676_10137197
268 Ga0070683_100520001
269 Ga0070690_100369920
270 Ga0070670_100294655
271 Ga0070677_10013742
272 Ga0068869_100148939
273 Ga0070666_10403450
274 Ga0070689_101581434
275 Ga0070661_100000496
276 Ga0070692_10390785
277 Ga0070675_100042616
278 Ga0070688_100094259
279 Ga0070659_100131884
280 Ga0070710_10682101
281 Ga0070701_10330729
282 Ga0070700_100019186
283 Ga0070663_100186003
284 Ga0070678_100360689
285 Ga0070681_10157270
286 Ga0068867_100016517
287 Ga0068867_100034368
288 Ga0070685_10087826
289 Ga0070679_100024768
290 Ga0068853_100007133
291 Ga0070672_100090734
292 Ga0070686_100224992
293 Ga0070686_100934549
294 Ga0070693_100218157
295 Ga0070665_100057881
296 Ga0070665_100754257
297 Ga0070704_100525299
298 Ga0068855_100034170
299 Ga0070664_100001472
300 Ga0068857_100001207
301 Ga0068857_100068259
302 Ga0068856_100027947
303 Ga0068856_100623237
304 Ga0068852_100002527
305 Ga0068861_100005158
306 Ga0068861_100076023
307 Ga0068851_10022745
308 Ga0068851_10613311
309 Ga0068858_100022830
310 Ga0068858_100109492
311 Ga0068860_100004201
312 Ga0075369_10183575
313 Ga0075369_10447285
314 Ga0075366_10028730
315 Ga0075366_10118711
316 Ga0075366_10131455
317 Ga0097621_100699741
318 Ga0068865_100003091
319 Ga0075436_100220364
320 Ga0075436_101009827
321 Ga0075435_100011793
322 Ga0075435_100427892
323 Ga0075435_100705236
324 Ga0075435_101570236
325 Ga0111539_10306078
326 Ga0105245_11192327
327 Ga0105241_10049614
328 Ga0105242_11262682
329 Ga0105242_11995907
330 Ga0105242_12245425
331 Ga0105248_11019495
332 Ga0105237_10092739
333 Ga0105238_11144408
334 Ga0105249_10044664
335 Ga0105239_10087348
336 Ga0105239_12200216
337 Ga0157370_10018697
338 Ga0157369_10060892
339 Ga0157378_10002071
340 Ga0163162_10050059
341 Ga0157372_10049777
342 Ga0157375_10347706
343 Ga0163163_10484406
344 Ga0163163_11002609
345 Ga0182008_10304974
346 Ga0157377_10729697
347 Ga0157379_10124572
348 Ga0157379_10170688
349 Ga0206356_11173333
350 Ga0209677_103773
351 Ga0209051_1018491
352 Ga0209051_1040964
353 Ga0207697_10179666
354 Ga0207645_10143683
355 Ga0207643_10885137
356 Ga0207705_10329691
357 Ga0207654_11145994
358 Ga0207707_11071051
359 Ga0207660_10906069
360 Ga0207649_10124371
361 Ga0207652_10136438
362 Ga0207681_10478134
363 Ga0207694_10029880
364 Ga0207650_10851633
365 Ga0207659_10662787
366 Ga0207690_10357433
367 Ga0207686_10073504
368 Ga0207686_11208181
369 Ga0207704_10007178
370 Ga0207691_10069742
371 Ga0207711_10676366
372 Ga0207711_11175980
373 Ga0207689_10263244
374 Ga0207661_10985915
375 Ga0207667_10080049
376 Ga0207712_10023373
377 Ga0207703_10078009
378 Ga0207678_10132463
379 Ga0207708_10025947
380 Ga0207708_10194149
381 Ga0207702_10555065
382 Ga0207641_11144948
383 Ga0207648_10000432
384 Ga0207674_10000046
385 Ga0207674_10080254
386 Ga0207674_10083631
387 Ga0207675_100012122
388 Ga0207683_10223793
389 Ga0207698_10070502
390 Ga0207428_10017802
391 Ga0268265_10030478
392 Ga0268264_10032350
393 Ga0265318_10183606
394 Ga0265323_10046098
395 Ga0307515_10296100
396 Ga0265330_10174843
397 Ga0307408_100006469
398 Ga0307408_100084570
399 Ga0307408_100248629
400 Ga0307408_101145355
401 Ga0265313_10016585
402 Ga0265342_10115013
403 Ga0307405_10003785
404 Ga0307405_10016722
405 Ga0307405_10191399
406 Ga0307405_10713046
407 Ga0307413_10066163
408 Ga0307413_11857304
409 Ga0307410_10014860
410 Ga0307410_10037700
411 Ga0307406_10003155
412 Ga0307406_10036871
413 Ga0307406_10680753
414 Ga0307406_11021069
415 Ga0307407_10007581
416 Ga0307407_11188297
417 Ga0307412_10004790
418 Ga0307409_100037645
419 Ga0307409_100458352
420 Ga0307416_100002112
421 Ga0307416_101794028
422 Ga0307414_10270247
423 Ga0307411_10004288
424 Ga0307411_10461017
425 Ga0307415_100003659
426 Ga0307415_100676731
427 Ga0307415_101821403
428 Ga0373939_0219927
429 Ga0373937_1186978
430 Ga0439439_0142245
431 Ga0439453_0003377
432 Ga0451802_0207535
433 Ga0451845_0906109
434 Ga0439431_0020189
435 Ga0439441_024527
436 Ga0439451_066874
437 Ga0439462_0010176
438 Ga0450912_003179
439 Ga0450920_001749
440 Ga0450923_000801
441 Ga0450923_003864
442 Ga0450895_001449
443 Ga0450896_000200
444 Ga0450898_025082
445 Ga0450898_082103
446 Ga0450906_031973
447 Ga0450906_036413
448 Ga0450907_025952
449 Ga0439446_0002532
450 Ga0450908_001092
451 Ga0439434_0002789
452 Ga0439434_0124624
453 Ga0439435_0000323
454 Ga0439444_0000950
455 Ga0439460_0018866
456 Ga0450916_052633
457 Ga0450918_026865
458 Ga0466966_0002639
459 Ga0466963_0264286
460 Ga0466964_0549979
461 Ga0466971_0006285
462 Ga0466970_0044840
463 Ga0466957_0001863
464 Ga0451576_0006861
465 Ga0451576_0011236
466 Ga0451576_0833264
467 Ga0466958_0144159
468 Ga0495664_0020493
469 Ga0495583_0000350
470 Ga0495610_0201371
471 Ga0495628_0968061
472 Ga0495648_0495957
473 Ga0495586_0071072
474 Ga0495599_0031044
475 Ga0495649_0004041
476 Ga0495589_0011467
477 Ga0496105_0296803
478 Ga0496106_0512006
479 Ga0496106_1052844
480 Ga0496108_0291365
481 Ga0496108_1453996
482 Ga0496114_0804207
483 Ga0496122_0214761
484 Ga0501033_0692332
485 Ga0501036_0387365
486 Ga0501036_1064004
487 Ga0501037_0334419
488 Ga0501040_0065022
489 Ga0501040_0992573
490 Ga0501042_0039557
491 Ga0501046_0405596
492 Ga0501046_0941517
493 Ga0501048_0179263
494 Ga0501067_0027497
495 Ga0501068_0307627
496 Ga0501068_1156630
497 Ga0501069_0158778
498 Ga0501071_0006124
499 Ga0501072_0016908
500 Ga0501073_0803625
501 Ga0501075_0022334
502 Ga0501076_0011440
503 Ga0501076_0751636
504 Ga0501225_0014315
505 Ga0501079_0039496
506 Ga0501081_0108722
507 Ga0501083_0494271
508 Ga0501045_0168482
509 nmdc:mga0k408_121975_c1
510 nmdc:mga0k408_364828_c1
511 nmdc:mga08y16_208493_c1
512 nmdc:mga0rr50_298088_c1
513 nmdc:mga0rr50_459030_c1
514 nmdc:mga0rr50_72263_c1
515 nmdc:mga08x19_205149_c1
516 nmdc:mga0sz30_65203_c1
517 Ga0500569_043140
518 Ga0500572_146911
519 Ga0500608_171596
520 Ga0500616_0032164
521 Ga0500622_0012164
522 Ga0500636_0030534
523 Ga0501082_1212043
524 Ga0466962_0007334

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22751

DUF488-N3a

Active DUF488-N3 subclade

25

152

0.96

PF04343

DUF488

Domain of unknown function DUF488

26

148

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2eka-assembly1.cif.gz_B structural study of project id ph0725 from pyrococcus horikoshii ot3 (l202m) 0.5945 1 128
2el0-assembly1.cif.gz_B structural study of project id ph0725 from pyrococcus horikoshii ot3 (l21m) 0.5682 1 130
2ehl-assembly1.cif.gz_B crystal structure of thr146 to arg mutant of diphthine synthase 0.5641 1 128
2ejj-assembly1.cif.gz_B mutant k129m structure of ph0725 from pyrococcus horikoshii ot3 0.5611 1 128
2pcm-assembly1.cif.gz_B crystal structure of ph0725 from pyrococcus horikoshii ot3 0.5592 1 130
ID Description Score Start End Superfamily
af_K7MIR4_1_151_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.5773 53 92 1.25.40.10
af_Q9N4E0_171_311_3.40.50.12670 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.5278 84 123 3.40.50.12670
5n5fB00 Special;Helix non-globular;Helix Hairpins; 0.5147 53 95 6.10.140.1960
af_Q2FVM0_1_122_3.40.1010.10 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.4809 79 128 3.40.1010.10
af_I1K4U3_1_326_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.473 54 95 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A157ZQZ9-F1-model_v4 DUF488 domain-containing protein 0.9947 1 128
AF-A0A375J012-F1-model_v4 DUF488 domain-containing protein 0.9941 1 128
AF-A0A375BAR4-F1-model_v4 deleted 0.9938 1 128
AF-Q2IDM1-F1-model_v4 DUF488 domain-containing protein 0.9934 1 128
AF-A0A7L6AB11-F1-model_v4 DUF488 family protein 0.9922 1 124

Map