F370720

General Info

Members Datasets Scaffolds Average Seq Length
261 201 200 330

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221635|2644198725
Length 358
Sequence EHAPDPHGAPDAHGAPDADGAPDHAADTLGAVGELAALARIIPRLPPSAVTELGPGDDAAVLAAPDGRFVVTTDMMIHGPDFRLAWSSMHDLGWKAAATNLSDVAAMGARPTSLVVALAAPAETPVADLEAFADGLADACAALAPGCGVVGGDLSVSHTLTIAVTAFGDLEGRPPVRRDGARPGDVVAVSGPLGLAAQGLALLFERGVDATGAPDASAAARLRSEHPVPIAAQLAPRPPIADGPAAAIAGATAMLDLSDGLALDARRVARASGVVIDLDGRALAAHGTGALALTGGEDHSLLATFPPTVPLPAGFERVGLVVALDERAGGRPAVLVDGHVVDERGGWDPFAGWSGEAD

Samples

Sample ID Description Type Environment
1 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
2 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
3 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
4 2643221546 Microbacterium sp. Root53 Isolate Unclassified
5 2643221549 Agromyces sp. Root1464 Isolate Unclassified
6 2643221566 Microbacterium sp. Root166 Isolate Unclassified
7 2643221572 Leifsonia sp. Root60 Isolate Unclassified
8 2643221575 Microbacterium sp. Root61 Isolate Unclassified
9 2643221597 Microbacterium sp. Root180 Isolate Unclassified
10 2643221616 Leifsonia sp. Root227 Isolate Unclassified
11 2643221619 Agromyces sp. Root81 Isolate Unclassified
12 2643221630 Microbacterium sp. Root322 Isolate Unclassified
13 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
14 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
15 2643221649 Leifsonia sp. Root4 Isolate Unclassified
16 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
17 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
18 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
19 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
20 2773857759 Microbacterium sp. 1294 Isolate Unclassified
21 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
22 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
23 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
24 2808606372 Agromyces sp. 23-23 Isolate Unclassified
25 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
26 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
27 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
28 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
29 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
30 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
31 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
32 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
33 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
34 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
35 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
36 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
37 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
38 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
39 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
40 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
41 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
42 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
43 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
44 2919069694 Microbacterium sp. 1154 Isolate Unclassified
45 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
46 2928153084 Leifsonia sp. 563 Isolate Unclassified
47 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
48 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
49 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
50 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
51 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
52 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
53 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
54 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
55 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
56 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
57 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
58 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
59 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
60 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
61 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
62 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
63 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
64 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
65 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
66 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
67 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
68 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
69 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
70 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
73 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
74 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
79 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
100 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
101 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
104 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
131 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
132 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
133 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
137 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
138 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
139 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
140 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
141 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
142 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
143 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
144 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
145 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
146 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
147 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
148 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
149 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
150 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
151 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
152 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
153 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
154 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
155 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
156 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
157 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
158 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
159 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
160 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
161 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
162 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
163 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
164 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
165 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
178 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
179 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
180 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
181 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
184 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
185 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
186 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
187 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
188 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
189 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
190 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
191 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
192 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
193 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
194 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
195 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
196 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
197 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
198 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
199 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
200 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere
201 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 75.48
Metatranscriptomes 1.15
Isolates 23.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.58
Nodule 0
Rhizoplane 5.75
Rhizosphere 54.02
Stem 0
Stem Tuber 0.38
Unclassified 30.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25164J39214_1000778 3300002772 Bacteria 11545
2 JGI25165J46597_1000002 3300003214 Bacteria 765387
3 Ga0006562J51391_1048816 3300003578 Bacteria 1344
4 Ga0070658_10010448 3300005327 Bacteria 7445
5 Ga0070658_10031201 3300005327 Bacteria 4279
6 Ga0068869_100194836 3300005334 Bacteria 1595
7 Ga0068868_100048856 3300005338 Bacteria 3320
8 Ga0068868_100136991 3300005338 Bacteria 2007
9 Ga0070660_100002036 3300005339 Bacteria 13937
10 Ga0070668_100027547 3300005347 Bacteria 4315
11 Ga0070671_100272702 3300005355 Bacteria 1438
12 Ga0070667_100027631 3300005367 Bacteria 4721
13 Ga0070710_10020543 3300005437 Bacteria 3428
14 Ga0070685_10011808 3300005466 Bacteria 4579
15 Ga0068853_100021211 3300005539 Bacteria 5411
16 Ga0070672_100030594 3300005543 Bacteria 4046
17 Ga0068855_100013037 3300005563 Bacteria 10027
18 Ga0068855_100148457 3300005563 Bacteria 2667
19 Ga0068857_100018114 3300005577 Bacteria 6178
20 Ga0068856_100132763 3300005614 Bacteria 2495
21 Ga0068856_100221446 3300005614 Bacteria 1907
22 Ga0068852_100005756 3300005616 Bacteria 8897
23 Ga0068859_100117295 3300005617 Bacteria 2727
24 Ga0068861_100076965 3300005719 Bacteria 2601
25 Ga0068851_10000001 3300005834 Bacteria 495512
26 Ga0068863_100046416 3300005841 Bacteria 4123
27 Ga0068863_100134279 3300005841 Bacteria 2364
28 Ga0075364_10019620 3300006051 Bacteria 4244
29 Ga0075367_10000349 3300006178 Bacteria 16510
30 Ga0097620_100117295 3300006931 Bacteria 2727
31 Ga0105244_10008974 3300009036 Bacteria 6187
32 Ga0105240_10007382 3300009093 Bacteria 15989
33 Ga0105245_10005854 3300009098 Bacteria 10797
34 Ga0105245_10204260 3300009098 Bacteria 1899
35 Ga0105247_10093325 3300009101 Bacteria 1913
36 Ga0105243_10349664 3300009148 Bacteria 1357
37 Ga0105241_10000453 3300009174 Bacteria 30818
38 Ga0105248_10000326 3300009177 Bacteria 56477
39 Ga0105248_10043680 3300009177 Bacteria 5026
40 Ga0105237_10000341 3300009545 Bacteria 65672
41 Ga0157369_10189365 3300013105 Bacteria 2162
42 Ga0171462_1003 3300013250 Bacteria 853796
43 Ga0163162_10215615 3300013306 Bacteria 2050
44 Ga0157372_10315581 3300013307 Bacteria 1820
45 Ga0163163_10030359 3300014325 Bacteria 5208
46 Ga0157380_10006032 3300014326 Bacteria 8487
47 Ga0157379_10039156 3300014968 Bacteria 4229
48 Ga0157376_10373488 3300014969 Bacteria 1371
49 Ga0206354_10663781 3300020081 Bacteria 10305
50 Ga0206353_11560231 3300020082 Bacteria 22870
51 Ga0207427_100034 3300025231 Bacteria 320342
52 Ga0209437_100486 3300025233 Bacteria 29316
53 Ga0209677_100321 3300025253 Bacteria 30989
54 Ga0209148_1000608 3300025254 Bacteria 32066
55 Ga0209148_1012099 3300025254 Bacteria 1585
56 Ga0209233_1000001 3300025261 Bacteria 2992747
57 Ga0207656_10000002 3300025321 Bacteria 792178
58 Ga0207655_1002891 3300025728 Bacteria 13252
59 Ga0207655_1013383 3300025728 Bacteria 4716
60 Ga0207692_10014665 3300025898 Bacteria 3429
61 Ga0207705_10029243 3300025909 Bacteria 3928
62 Ga0207654_10000001 3300025911 Bacteria 1816198
63 Ga0207695_10003239 3300025913 Bacteria 23182
64 Ga0207695_10003445 3300025913 Bacteria 22306
65 Ga0207671_10000002 3300025914 Bacteria 1144816
66 Ga0207657_10028314 3300025919 Bacteria 5113
67 Ga0207694_10000395 3300025924 Bacteria 40665
68 Ga0207687_10033337 3300025927 Bacteria 3493
69 Ga0207687_10039017 3300025927 Bacteria 3249
70 Ga0207690_10000874 3300025932 Bacteria 19271
71 Ga0207709_10149347 3300025935 Bacteria 1616
72 Ga0207691_10048951 3300025940 Bacteria 3873
73 Ga0207711_10004685 3300025941 Bacteria 11617
74 Ga0207711_10066148 3300025941 Bacteria 3126
75 Ga0207689_10188070 3300025942 Bacteria 1703
76 Ga0207667_10000384 3300025949 Bacteria 59816
77 Ga0207667_10005731 3300025949 Bacteria 15151
78 Ga0207668_10029348 3300025972 Bacteria 3605
79 Ga0207658_10026993 3300025986 Bacteria 4031
80 Ga0207677_10099597 3300026023 Bacteria 2135
81 Ga0207703_10000982 3300026035 Bacteria 27446
82 Ga0207639_10228887 3300026041 Bacteria 1610
83 Ga0207702_10074047 3300026078 Bacteria 2938
84 Ga0207702_10331989 3300026078 Bacteria 1451
85 Ga0207702_10345397 3300026078 Bacteria 1422
86 Ga0207641_10027408 3300026088 Bacteria 4705
87 Ga0207641_10165980 3300026088 Bacteria 2011
88 Ga0207674_10005088 3300026116 Bacteria 15698
89 Ga0207674_10069526 3300026116 Bacteria 3541
90 Ga0207675_100194588 3300026118 Bacteria 1946
91 Ga0207698_10000372 3300026142 Bacteria 26230
92 Ga0207698_10045429 3300026142 Bacteria 3309
93 Ga0207698_10061871 3300026142 Bacteria 2920
94 Ga0307513_10139732 3300031456 Bacteria 2351
95 Ga0307514_10003887 3300031649 Bacteria 14003
96 Ga0307514_10068653 3300031649 Bacteria 2670
97 Ga0307406_10000217 3300031901 Bacteria 34729
98 Ga0307409_100065559 3300031995 Bacteria 2859
99 Ga0307409_100105901 3300031995 Bacteria 2346
100 Ga0307416_100079499 3300032002 Bacteria 2764
101 Ga0307416_100104765 3300032002 Bacteria 2474
102 Ga0307415_100167124 3300032126 Bacteria 1712
103 Ga0395899_0014625 3300037312 Bacteria 5990
104 Ga0395901_0030011 3300038443 Bacteria 5601
105 Ga0451791_1439961 3300041451 Bacteria 1410
106 Ga0466965_0012786 3300044683 Bacteria 3951
107 Ga0466968_0030315 3300044735 Bacteria 2240
108 Ga0495627_000401 3300046453 Bacteria 38376
109 Ga0495650_0000989 3300046471 Bacteria 32345
110 Ga0495645_0086131 3300046543 Bacteria 2248
111 Ga0495672_0004208 3300047320 Bacteria 11921
112 Ga0495686_0010659 3300047472 Bacteria 6527
113 Ga0496101_0362486 3300048904 Bacteria 1139
114 Ga0496102_0279663 3300048905 Bacteria 1573
115 Ga0496103_0002306 3300048906 Bacteria 12060
116 Ga0496104_0063521 3300048907 Bacteria 3502
117 Ga0496104_0126415 3300048907 Bacteria 2455
118 Ga0496104_0296455 3300048907 Bacteria 1529
119 Ga0496105_0008276 3300048908 Bacteria 8088
120 Ga0496105_0250510 3300048908 Bacteria 1435
121 Ga0496107_0516981 3300048910 Bacteria 885
122 Ga0496108_0025667 3300048911 Bacteria 4858
123 Ga0496112_0233622 3300048915 Bacteria 1793
124 Ga0496114_0054111 3300048917 Bacteria 3346
125 Ga0496114_0061219 3300048917 Bacteria 3148
126 Ga0496115_0086287 3300048918 Bacteria 2561
127 Ga0496117_0000053 3300048920 Bacteria 279396
128 Ga0496117_0006271 3300048920 Bacteria 12116
129 Ga0496117_0027283 3300048920 Bacteria 4452
130 Ga0496118_0004656 3300048921 Bacteria 16093
131 Ga0496118_0082056 3300048921 Bacteria 2261
132 Ga0496119_0000462 3300048922 Bacteria 55546
133 Ga0496119_0001888 3300048922 Bacteria 24099
134 Ga0496119_0005508 3300048922 Bacteria 12085
135 Ga0496119_0005568 3300048922 Bacteria 11985
136 Ga0496119_0021562 3300048922 Bacteria 4650
137 Ga0496120_0000882 3300048923 Bacteria 42252
138 Ga0496120_0004461 3300048923 Bacteria 11730
139 Ga0496120_0006705 3300048923 Bacteria 8764
140 Ga0496120_0010457 3300048923 Bacteria 6473
141 Ga0496120_0014656 3300048923 Bacteria 5214
142 Ga0496120_0089666 3300048923 Bacteria 1645
143 Ga0496122_0000031 3300048925 Bacteria 329726
144 Ga0496122_0002058 3300048925 Bacteria 29852
145 Ga0496122_0004113 3300048925 Bacteria 18414
146 Ga0496122_0046142 3300048925 Bacteria 3378
147 Ga0496122_0054084 3300048925 Bacteria 3019
148 Ga0496123_0000013 3300048926 Bacteria 439694
149 Ga0496123_0006537 3300048926 Bacteria 11257
150 Ga0496123_0020341 3300048926 Bacteria 5195
151 Ga0496123_0110977 3300048926 Bacteria 1568
152 Ga0496124_0012952 3300048927 Bacteria 8178
153 Ga0496124_0013529 3300048927 Bacteria 7958
154 Ga0496125_0000077 3300048928 Bacteria 232629
155 Ga0496125_0001794 3300048928 Bacteria 29677
156 Ga0496125_0002215 3300048928 Bacteria 25912
157 Ga0496125_0029205 3300048928 Bacteria 4960
158 Ga0496125_0064916 3300048928 Bacteria 2896
159 Ga0496125_0071923 3300048928 Bacteria 2699
160 Ga0496126_0008871 3300048929 Bacteria 10775
161 Ga0496126_0121476 3300048929 Bacteria 2264
162 Ga0496126_0193364 3300048929 Bacteria 1722
163 Ga0501032_0010368 3300049569 Bacteria 6718
164 Ga0501033_0006594 3300049570 Bacteria 9080
165 Ga0501034_0007513 3300049571 Bacteria 11594
166 Ga0501034_0011379 3300049571 Bacteria 9227
167 Ga0501036_0018848 3300049572 Bacteria 5788
168 Ga0501037_0002320 3300049573 Bacteria 13751
169 Ga0501038_0006429 3300049574 Bacteria 10874
170 Ga0501039_0066572 3300049575 Bacteria 2796
171 Ga0501042_0049144 3300049578 Bacteria 3009
172 Ga0501043_0005974 3300049579 Bacteria 9783
173 Ga0501046_0002107 3300049580 Bacteria 18856
174 Ga0501047_0055384 3300049581 Bacteria 3835
175 Ga0501048_0001960 3300049582 Bacteria 15648
176 Ga0501068_0015426 3300049584 Bacteria 4387
177 Ga0501069_0068636 3300049585 Bacteria 1984
178 Ga0501070_0000133 3300049586 Bacteria 67036
179 Ga0501070_0009644 3300049586 Bacteria 8161
180 Ga0501073_0017209 3300049589 Bacteria 5236
181 Ga0501035_0035725 3300049822 Bacteria 4509
182 Ga0501035_0044860 3300049822 Bacteria 3978
183 Ga0501044_0017141 3300049823 Bacteria 7773
184 Ga0501045_0027001 3300049824 Bacteria 4133
185 nmdc:mga06z11_4581_c1 3300050494 Bacteria 5453
186 Ga0500635_0000023 3300053080 Bacteria 108024
187 Ga0500643_000913 3300053087 Bacteria 18624
188 Ga0500651_0000170 3300053093 Bacteria 42448
189 Ga0500556_0000001 3300053104 Bacteria 1135060
190 Ga0500568_0000003 3300053139 Bacteria 863587
191 Ga0500568_0004245 3300053139 Bacteria 7702
192 Ga0500568_0010972 3300053139 Bacteria 4223
193 Ga0500573_0006616 3300053140 Bacteria 6288
194 Ga0500573_0064563 3300053140 Bacteria 2094
195 Ga0500577_0021758 3300053142 Bacteria 2117
196 Ga0500590_037923 3300053148 Bacteria 2488
197 Ga0500616_0000205 3300053153 Bacteria 96713
198 Ga0500616_0001099 3300053153 Bacteria 28063
199 Ga0500620_000289 3300053155 Bacteria 9710
200 Ga0501082_0263356 3300060353 Bacteria 1500

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048905 Ga0496102_0279663 Ga0496102_0279663_13_852 259
2 3300048910 Ga0496107_0516981 Ga0496107_0516981_14_859 261
3 3300048926 Ga0496123_0020341 Ga0496123_0020341_53_931 269
4 3300048925 Ga0496122_0002058 Ga0496122_0002058_25000_26055 277
5 3300048926 Ga0496123_0006537 Ga0496123_0006537_5233_6288 277
6 3300032002 Ga0307416_100104765 Ga0307416_1001047653 278
7 3300047320 Ga0495672_0004208 Ga0495672_0004208_885_1829 280
8 3300049585 Ga0501069_0068636 Ga0501069_0068636_13_1011 281
9 3300060353 Ga0501082_0263356 Ga0501082_0263356_472_1470 281
10 3300046471 Ga0495650_0000989 Ga0495650_0000989_24013_25056 288
11 3300005563 Ga0068855_100013037 Ga0068855_1000130375 289
12 3300025949 Ga0207667_10005731 Ga0207667_100057315 289
13 3300049569 Ga0501032_0010368 Ga0501032_0010368_2263_3327 289
14 3300049570 Ga0501033_0006594 Ga0501033_0006594_4290_5354 289
15 3300049571 Ga0501034_0007513 Ga0501034_0007513_10281_11345 289
16 3300049572 Ga0501036_0018848 Ga0501036_0018848_3721_4785 289
17 3300049573 Ga0501037_0002320 Ga0501037_0002320_11156_12220 289
18 3300049574 Ga0501038_0006429 Ga0501038_0006429_5386_6450 289
19 3300049575 Ga0501039_0066572 Ga0501039_0066572_543_1607 289
20 3300049578 Ga0501042_0049144 Ga0501042_0049144_925_1989 289
21 3300049579 Ga0501043_0005974 Ga0501043_0005974_1964_3028 289
22 3300049580 Ga0501046_0002107 Ga0501046_0002107_592_1656 289
23 3300049581 Ga0501047_0055384 Ga0501047_0055384_2650_3714 289
24 3300049582 Ga0501048_0001960 Ga0501048_0001960_11300_12364 289
25 3300049584 Ga0501068_0015426 Ga0501068_0015426_12_1076 289
26 3300049822 Ga0501035_0044860 Ga0501035_0044860_2793_3857 289
27 3300049823 Ga0501044_0017141 Ga0501044_0017141_3403_4467 289
28 3300049824 Ga0501045_0027001 Ga0501045_0027001_2894_3958 289
29 3300032002 Ga0307416_100079499 Ga0307416_1000794991 290
30 3300048922 Ga0496119_0001888 Ga0496119_0001888_5081_6076 291
31 3300048925 Ga0496122_0004113 Ga0496122_0004113_11592_12587 292
32 3300053087 Ga0500643_000913 Ga0500643_000913_2163_3128 292
33 3300005437 Ga0070710_10020543 Ga0070710_100205435 293
34 3300025898 Ga0207692_10014665 Ga0207692_100146652 293
35 3300031649 Ga0307514_10003887 Ga0307514_1000388715 293
36 3300046543 Ga0495645_0086131 Ga0495645_0086131_1026_2018 293
37 3300053080 Ga0500635_0000023 Ga0500635_0000023_9812_10813 293
38 3300048928 Ga0496125_0002215 Ga0496125_0002215_4147_5142 294
39 3300031995 Ga0307409_100105901 Ga0307409_1001059013 295
40 3300031456 Ga0307513_10139732 Ga0307513_101397322 296
41 3300049822 Ga0501035_0035725 Ga0501035_0035725_1007_2002 298
42 iso_pu_bacteria 2773857763 2774399282 298
43 3300053153 Ga0500616_0001099 Ga0500616_0001099_19487_20680 299
44 3300006178 Ga0075367_10000349 Ga0075367_1000034910 300
45 3300049589 Ga0501073_0017209 Ga0501073_0017209_3077_4045 300
46 3300050494 nmdc:mga06z11_4581_c1 nmdc:mga06z11_4581_c1_673_1668 300
47 iso_pu_bacteria 2852643534 2852646052 300
48 iso_pu_bacteria 8004212874 8004213905 300
49 3300005334 Ga0068869_100194836 Ga0068869_1001948362 301
50 3300005347 Ga0070668_100027547 Ga0070668_1000275474 301
51 3300005719 Ga0068861_100076965 Ga0068861_1000769652 301
52 3300009148 Ga0105243_10349664 Ga0105243_103496641 301
53 3300014326 Ga0157380_10006032 Ga0157380_100060323 301
54 3300025935 Ga0207709_10149347 Ga0207709_101493472 301
55 3300025942 Ga0207689_10188070 Ga0207689_101880702 301
56 3300025972 Ga0207668_10029348 Ga0207668_100293482 301
57 3300026118 Ga0207675_100194588 Ga0207675_1001945882 301
58 iso_pu_bacteria 2773857759 2774384270 301
59 iso_pu_bacteria 2857733635 2857734012 301
60 iso_pu_bacteria 2977251589 2977254144 301
61 iso_pu_bacteria 2808606447 2809227613 302
62 iso_pu_bacteria 2852632344 2852634377 302
63 3300048920 Ga0496117_0006271 Ga0496117_0006271_9860_10825 303
64 iso_pu_bacteria 2643221572 2643875628 303
65 iso_pu_bacteria 2643221669 2644382683 303
66 iso_pu_bacteria 2757320536 2758225858 303
67 iso_pu_bacteria 2895660088 2895661686 303
68 iso_pu_bacteria 8016254467 8016257342 303
69 3300048920 Ga0496117_0000053 Ga0496117_0000053_91367_92359 304
70 3300048922 Ga0496119_0005568 Ga0496119_0005568_299_1291 304
71 3300048922 Ga0496119_0021562 Ga0496119_0021562_2656_3648 304
72 3300048923 Ga0496120_0004461 Ga0496120_0004461_3749_4741 304
73 3300048923 Ga0496120_0089666 Ga0496120_0089666_23_1015 304
74 3300048925 Ga0496122_0054084 Ga0496122_0054084_714_1706 304
75 3300048927 Ga0496124_0012952 Ga0496124_0012952_5563_6558 304
76 3300048928 Ga0496125_0064916 Ga0496125_0064916_714_1706 304
77 3300048929 Ga0496126_0008871 Ga0496126_0008871_5447_6439 304
78 iso_pu_bacteria 2643221542 2643733887 304
79 iso_pu_bacteria 2643221597 2643996108 304
80 iso_pu_bacteria 2643221630 2644170468 304
81 iso_pu_bacteria 2773857758 2774380164 304
82 iso_pu_bacteria 2811994872 2812323422 304
83 iso_pu_bacteria 2852663356 2852665051 304
84 iso_pu_bacteria 2857723135 2857723573 304
85 iso_pu_bacteria 2870622029 2870624308 304
86 iso_pu_bacteria 2904509784 2904511782 304
87 iso_pu_bacteria 2908678064 2908680708 304
88 iso_pu_bacteria 2919069694 2919071741 304
89 iso_pu_bacteria 2939657138 2939658791 304
90 iso_pu_bacteria 2946041624 2946043958 304
91 iso_pu_bacteria 2974294766 2974297366 304
92 iso_pu_bacteria 2974324384 2974326396 304
93 iso_pu_bacteria 2977228692 2977231621 304
94 iso_pu_bacteria 2977236895 2977236976 304
95 iso_pu_bacteria 2977264416 2977266844 304
96 iso_pu_bacteria 8004182704 8004185364 304
97 3300013105 Ga0157369_10189365 Ga0157369_101893651 305
98 3300013306 Ga0163162_10215615 Ga0163162_102156152 305
99 3300048904 Ga0496101_0362486 Ga0496101_0362486_86_1072 305
100 3300048906 Ga0496103_0002306 Ga0496103_0002306_3214_4200 305
101 3300048907 Ga0496104_0296455 Ga0496104_0296455_498_1484 305
102 3300048915 Ga0496112_0233622 Ga0496112_0233622_291_1277 305
103 3300048917 Ga0496114_0054111 Ga0496114_0054111_1864_2850 305
104 3300048920 Ga0496117_0027283 Ga0496117_0027283_858_1844 305
105 3300048921 Ga0496118_0004656 Ga0496118_0004656_8850_9836 305
106 3300048921 Ga0496118_0082056 Ga0496118_0082056_637_1608 305
107 3300048922 Ga0496119_0005508 Ga0496119_0005508_2535_3521 305
108 3300048923 Ga0496120_0006705 Ga0496120_0006705_4222_5208 305
109 3300048925 Ga0496122_0000031 Ga0496122_0000031_129626_130612 305
110 3300048926 Ga0496123_0000013 Ga0496123_0000013_129636_130622 305
111 3300048927 Ga0496124_0013529 Ga0496124_0013529_631_1617 305
112 3300048928 Ga0496125_0001794 Ga0496125_0001794_19288_20274 305
113 3300048929 Ga0496126_0121476 Ga0496126_0121476_868_1854 305
114 3300049571 Ga0501034_0011379 Ga0501034_0011379_2053_3021 305
115 3300053104 Ga0500556_0000001 Ga0500556_0000001_824365_825330 305
116 3300053139 Ga0500568_0000003 Ga0500568_0000003_798597_799562 305
117 3300053153 Ga0500616_0000205 Ga0500616_0000205_212_1183 305
118 iso_pu_bacteria 2643221566 2643848610 305
119 iso_pu_bacteria 2808606368 2808885826 305
120 iso_pu_bacteria 2833709550 2833711171 305
121 3300006051 Ga0075364_10019620 Ga0075364_100196201 306
122 3300031901 Ga0307406_10000217 Ga0307406_100002178 306
123 3300048907 Ga0496104_0063521 Ga0496104_0063521_857_1846 306
124 3300048908 Ga0496105_0008276 Ga0496105_0008276_1116_2105 306
125 3300048908 Ga0496105_0250510 Ga0496105_0250510_261_1253 306
126 3300048911 Ga0496108_0025667 Ga0496108_0025667_361_1350 306
127 3300048917 Ga0496114_0061219 Ga0496114_0061219_1171_2163 306
128 3300048918 Ga0496115_0086287 Ga0496115_0086287_368_1357 306
129 iso_pu_bacteria 2643221546 2643753288 306
130 iso_pu_bacteria 2643221575 2643885683 306
131 iso_pu_bacteria 2808606306 2808630982 306
132 iso_pu_bacteria 2821268502 2821270215 306
133 iso_pu_bacteria 2857720070 2857720116 306
134 iso_pu_bacteria 2870628048 2870630561 306
135 iso_pu_bacteria 8045830549 8045831794 306
136 iso_pu_bacteria 2808606372 2808901723 307
137 iso_pu_bacteria 2919443155 2919446523 307
138 3300005355 Ga0070671_100272702 Ga0070671_1002727021 308
139 3300005543 Ga0070672_100030594 Ga0070672_1000305943 308
140 3300009036 Ga0105244_10008974 Ga0105244_100089743 308
141 3300013250 Ga0171462_1003 Ga0171462_1003189 308
142 3300014325 Ga0163163_10030359 Ga0163163_100303592 308
143 3300025728 Ga0207655_1002891 Ga0207655_100289113 308
144 3300025728 Ga0207655_1013383 Ga0207655_10133833 308
145 3300025940 Ga0207691_10048951 Ga0207691_100489512 308
146 3300026088 Ga0207641_10165980 Ga0207641_101659802 308
147 3300032126 Ga0307415_100167124 Ga0307415_1001671242 308
148 3300041451 Ga0451791_1439961 Ga0451791_1439961_175_1170 308
149 3300044683 Ga0466965_0012786 Ga0466965_0012786_1295_2290 308
150 3300044735 Ga0466968_0030315 Ga0466968_0030315_924_1919 308
151 3300046453 Ga0495627_000401 Ga0495627_000401_8193_9188 308
152 3300048925 Ga0496122_0046142 Ga0496122_0046142_1657_2652 308
153 3300048928 Ga0496125_0000077 Ga0496125_0000077_62390_63373 308
154 3300048928 Ga0496125_0029205 Ga0496125_0029205_348_1343 308
155 3300048928 Ga0496125_0071923 Ga0496125_0071923_378_1373 308
156 3300048929 Ga0496126_0193364 Ga0496126_0193364_669_1664 308
157 3300049586 Ga0501070_0009644 Ga0501070_0009644_5662_6657 308
158 3300053140 Ga0500573_0064563 Ga0500573_0064563_91_1065 308
159 3300053142 Ga0500577_0021758 Ga0500577_0021758_265_1239 308
160 iso_pu_bacteria 2585428157 2588108938 308
161 3300005327 Ga0070658_10010448 Ga0070658_100104486 309
162 3300005327 Ga0070658_10031201 Ga0070658_100312014 309
163 3300005338 Ga0068868_100048856 Ga0068868_1000488564 309
164 3300005339 Ga0070660_100002036 Ga0070660_10000203614 309
165 3300005367 Ga0070667_100027631 Ga0070667_1000276315 309
166 3300005466 Ga0070685_10011808 Ga0070685_100118083 309
167 3300005539 Ga0068853_100021211 Ga0068853_1000212116 309
168 3300005563 Ga0068855_100148457 Ga0068855_1001484573 309
169 3300005577 Ga0068857_100018114 Ga0068857_1000181144 309
170 3300005614 Ga0068856_100221446 Ga0068856_1002214462 309
171 3300005616 Ga0068852_100005756 Ga0068852_1000057563 309
172 3300005617 Ga0068859_100117295 Ga0068859_1001172953 309
173 3300005834 Ga0068851_10000001 Ga0068851_10000001424 309
174 3300006931 Ga0097620_100117295 Ga0097620_1001172952 309
175 3300009098 Ga0105245_10204260 Ga0105245_102042602 309
176 3300009545 Ga0105237_10000341 Ga0105237_1000034126 309
177 3300014968 Ga0157379_10039156 Ga0157379_100391563 309
178 3300014969 Ga0157376_10373488 Ga0157376_103734881 309
179 3300025321 Ga0207656_10000002 Ga0207656_10000002505 309
180 3300025909 Ga0207705_10029243 Ga0207705_100292433 309
181 3300025913 Ga0207695_10003239 Ga0207695_1000323915 309
182 3300025914 Ga0207671_10000002 Ga0207671_10000002799 309
183 3300025919 Ga0207657_10028314 Ga0207657_100283144 309
184 3300025924 Ga0207694_10000395 Ga0207694_1000039510 309
185 3300025927 Ga0207687_10039017 Ga0207687_100390172 309
186 3300025932 Ga0207690_10000874 Ga0207690_1000087412 309
187 3300025949 Ga0207667_10000384 Ga0207667_1000038418 309
188 3300025986 Ga0207658_10026993 Ga0207658_100269933 309
189 3300026035 Ga0207703_10000982 Ga0207703_1000098225 309
190 3300026041 Ga0207639_10228887 Ga0207639_102288872 309
191 3300026078 Ga0207702_10345397 Ga0207702_103453972 309
192 3300026116 Ga0207674_10005088 Ga0207674_100050885 309
193 3300026142 Ga0207698_10000372 Ga0207698_1000037224 309
194 3300026142 Ga0207698_10045429 Ga0207698_100454292 309
195 3300026142 Ga0207698_10061871 Ga0207698_100618712 309
196 3300047472 Ga0495686_0010659 Ga0495686_0010659_3246_4256 309
197 3300053093 Ga0500651_0000170 Ga0500651_0000170_12032_13063 309
198 3300053139 Ga0500568_0004245 Ga0500568_0004245_5353_6342 309
199 3300053139 Ga0500568_0010972 Ga0500568_0010972_1262_2245 309
200 3300053140 Ga0500573_0006616 Ga0500573_0006616_2809_3798 309
201 3300053148 Ga0500590_037923 Ga0500590_037923_879_1910 309
202 3300053155 Ga0500620_000289 Ga0500620_000289_8025_9059 309
203 iso_pu_bacteria 2643221632 2644183020 309
204 iso_pu_bacteria 2857737099 2857738893 309
205 3300005841 Ga0068863_100134279 Ga0068863_1001342793 310
206 3300038443 Ga0395901_0030011 Ga0395901_0030011_159_1175 310
207 iso_pu_bacteria 2585428094 2587863262 310
208 iso_pu_bacteria 2643221549 2643768042 310
209 iso_pu_bacteria 2643221619 2644111429 310
210 iso_pu_bacteria 2643221649 2644277153 310
211 iso_pu_bacteria 8046352972 8046353164 310
212 3300031649 Ga0307514_10068653 Ga0307514_100686533 311
213 3300031995 Ga0307409_100065559 Ga0307409_1000655593 311
214 iso_pu_bacteria 2643221616 2644095703 311
215 iso_pu_bacteria 2844841374 2844842086 311
216 iso_pu_bacteria 2884763398 2884765075 311
217 iso_pu_bacteria 2919055335 2919057726 311
218 iso_pu_bacteria 2928153084 2928155701 311
219 iso_pu_bacteria 2935409751 2935411140 311
220 iso_pu_bacteria 8057345674 8057348132 311
221 3300048923 Ga0496120_0010457 Ga0496120_0010457_1295_2371 312
222 3300005338 Ga0068868_100136991 Ga0068868_1001369913 313
223 3300005841 Ga0068863_100046416 Ga0068863_1000464163 313
224 3300009093 Ga0105240_10007382 Ga0105240_1000738214 313
225 3300009098 Ga0105245_10005854 Ga0105245_100058545 313
226 3300009101 Ga0105247_10093325 Ga0105247_100933252 313
227 3300009174 Ga0105241_10000453 Ga0105241_1000045324 313
228 3300009177 Ga0105248_10000326 Ga0105248_1000032620 313
229 3300009177 Ga0105248_10043680 Ga0105248_100436803 313
230 3300025254 Ga0209148_1000608 Ga0209148_100060827 313
231 3300025254 Ga0209148_1012099 Ga0209148_10120992 313
232 3300025911 Ga0207654_10000001 Ga0207654_100000011357 313
233 3300025913 Ga0207695_10003445 Ga0207695_100034456 313
234 3300025927 Ga0207687_10033337 Ga0207687_100333373 313
235 3300025941 Ga0207711_10004685 Ga0207711_100046857 313
236 3300025941 Ga0207711_10066148 Ga0207711_100661483 313
237 3300026023 Ga0207677_10099597 Ga0207677_100995973 313
238 3300026078 Ga0207702_10074047 Ga0207702_100740473 313
239 3300026088 Ga0207641_10027408 Ga0207641_100274084 313
240 3300026116 Ga0207674_10069526 Ga0207674_100695262 313
241 3300048907 Ga0496104_0126415 Ga0496104_0126415_1300_2295 313
242 3300048923 Ga0496120_0014656 Ga0496120_0014656_3726_4769 313
243 3300048926 Ga0496123_0110977 Ga0496123_0110977_161_1507 313
244 3300049586 Ga0501070_0000133 Ga0501070_0000133_9914_10909 313
245 iso_pu_bacteria 2721755702 2723641731 313
246 3300048922 Ga0496119_0000462 Ga0496119_0000462_22552_23607 314
247 3300048923 Ga0496120_0000882 Ga0496120_0000882_32007_33062 314
248 3300002772 JGI25164J39214_1000778 JGI25164J39214_10007786 315
249 3300003214 JGI25165J46597_1000002 JGI25165J46597_1000002360 315
250 3300003578 Ga0006562J51391_1048816 Ga0006562J51391_10488161 315
251 3300005614 Ga0068856_100132763 Ga0068856_1001327631 315
252 3300013307 Ga0157372_10315581 Ga0157372_103155811 315
253 3300020081 Ga0206354_10663781 Ga0206354_1066378110 315
254 3300020082 Ga0206353_11560231 Ga0206353_1156023110 315
255 3300025231 Ga0207427_100034 Ga0207427_100034288 315
256 3300025233 Ga0209437_100486 Ga0209437_1004863 315
257 3300025253 Ga0209677_100321 Ga0209677_1003214 315
258 3300025261 Ga0209233_1000001 Ga0209233_10000012445 315
259 3300026078 Ga0207702_10331989 Ga0207702_103319892 315
260 3300037312 Ga0395899_0014625 Ga0395899_0014625_364_1410 315
261 iso_pu_bacteria 2643221635 2644198725 315

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00586

AIRS

AIR synthase related protein, N-terminal domain

56

170

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2yye-assembly1.cif.gz_A crystal structure of selenophosphate synthetase from aquifex aeolicus complexed with ampcpp 0.8254 21 242
3c9s-assembly1.cif.gz_B aathil complexed with amppcp 0.7938 7 296
2yye-assembly1.cif.gz_B crystal structure of selenophosphate synthetase from aquifex aeolicus complexed with ampcpp 0.7891 21 242
1vqv-assembly1.cif.gz_B crystal structure of thiamine monophosphate kinase (thil) from aquifex aeolicus 0.7874 12 300
2yxz-assembly2.cif.gz_D crystal structure of tt0281 from thermus thermophilus hb8 0.7855 12 298
ID Description Score Start End Superfamily
af_Q60337_1_142_3.30.1330.10 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;PurM-like, N-terminal domain 0.8744 16 152 3.30.1330.10
2yyeA01 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;PurM-like, N-terminal domain 0.8589 16 160 3.30.1330.10
1yawA01 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;PurM-like, N-terminal domain 0.8559 12 160 3.30.1330.10
1yawA01 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;PurM-like, N-terminal domain 0.85 12 160 3.30.1330.10
2zodA01 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;PurM-like, N-terminal domain 0.8404 22 160 3.30.1330.10
ID Description Score Start End GO Terms
AF-X0UCJ9-F1-model_v4 PurM-like N-terminal domain-containing protein 0.9254 12 147 GO:0009030
GO:0009228
AF-A0A7X9IZ05-F1-model_v4 Thiamine-phosphate kinase 0.9173 16 169 GO:0009030
GO:0009228
AF-A0A7C5I442-F1-model_v4 Thiamine-monophosphate kinase 0.9089 16 189 GO:0009030
GO:0009228
AF-A0A6L6EH42-F1-model_v4 Thiamine-phosphate kinase 0.9067 12 148 GO:0009030
GO:0009228
AF-X0UCJ9-F1-model_v4 PurM-like N-terminal domain-containing protein 0.9061 12 147 GO:0009030
GO:0009228

Feature Viewer

pLDDT pTM Quality
82.31 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map