F370683

General Info

Members Datasets Scaffolds Average Seq Length
261 213 522 363

Family's Representative Sequence

Representative Sequence 3300050493|nmdc:mga0k408_45110_c1|nmdc:mga0k408_45110_c1_315_1649
Length 433
Sequence MRARWQAPRNPGTLPQPDRPAPDYAALHPGYYGSNNHKSLLCASAGAAIPFAVKAGGYWGSLRSQMKLRLWENPWRLMLAVIVAVFVGAYLHKISLPPYVPYIHLLVDYHFGFTKRALIGAIVSLFDAKVPVWLAFALSGTVWLITAGLFVQLFRRTFGFDEKNLPLFVFMAASPFFLKNFMHTLGHFDIYGCLFAICLLLIPARSLGYVLLAALLSHHIHLLMYVPTIAVIVVLRYYLMQGVNRQNAAVGIASLAAVGVLFIAAQFYGTMAVPETEFVAYLQGRMADPSRTDLLSFGYVWYQPLSKEIRDTWQRLPHNLLGVPAFALLIWLHAPLWRYFRNLVDVLSIDAHRRIVPAAIIIVSLGYLIMFAIVFDYSRWISNWAVCLFLILHAVKMLPASKGVPPISADDRKTLAFGWIITLIPRVGIVRPY

Samples

Sample ID Description Type Environment
1 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
35 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
36 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
37 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
38 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
54 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
55 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
58 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
61 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
90 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
91 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
95 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
96 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
97 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
98 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
99 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
100 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
101 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
102 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
103 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
104 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
105 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
106 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
107 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
111 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
112 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
113 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
114 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
115 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
116 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
117 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
118 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
119 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
120 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
121 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
122 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
123 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
124 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
125 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
126 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
127 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
128 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
129 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
130 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
131 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
132 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
133 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
134 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
135 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
136 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
137 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
138 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
139 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
140 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
141 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
142 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
143 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
144 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
145 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
146 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
147 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
148 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
149 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
150 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
151 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
152 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
153 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
154 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
155 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
156 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
157 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
158 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
159 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
160 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
161 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
162 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
163 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
164 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
165 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
166 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
167 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
168 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
169 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
170 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
171 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
172 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
173 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
174 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
175 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
176 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
177 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
178 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
179 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
180 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
181 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
182 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
183 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
184 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
185 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
186 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
187 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
188 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
189 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
190 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
191 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
192 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
193 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
194 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
195 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
196 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
197 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
198 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
199 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
200 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
201 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
202 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
203 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
204 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
205 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
206 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
207 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
208 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
209 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
210 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
211 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
212 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
213 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.97
Metatranscriptomes 0
Isolates 13.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.43
Nodule 9.58
Rhizoplane 3.83
Rhizosphere 68.58
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0k408_45110_c1 3300050493 Bacteria 2543
2 JGI25406J46586_10000026 3300003203 Bacteria 70727
3 Ga0065165_1009889 3300005262 Bacteria 4205
4 Ga0070658_10053528 3300005327 Bacteria 3276
5 Ga0070683_100008779 3300005329 Bacteria 8593
6 Ga0068869_100171008 3300005334 Bacteria 1697
7 Ga0070680_100021698 3300005336 Bacteria 5107
8 Ga0070660_100002843 3300005339 Bacteria 11922
9 Ga0070661_100060132 3300005344 Bacteria 2788
10 Ga0070669_100112019 3300005353 Bacteria 2072
11 Ga0070667_100071178 3300005367 Bacteria 2961
12 Ga0070700_100034786 3300005441 Bacteria 3044
13 Ga0070662_100145536 3300005457 Bacteria 1840
14 Ga0070681_10048927 3300005458 Bacteria 4223
15 Ga0070698_100292021 3300005471 Bacteria 1561
16 Ga0070699_100196773 3300005518 Bacteria 1792
17 Ga0070679_100041621 3300005530 Bacteria 4572
18 Ga0070684_100006680 3300005535 Bacteria 8942
19 Ga0068853_100002454 3300005539 Bacteria 13873
20 Ga0070665_100022177 3300005548 Bacteria 6388
21 Ga0070704_100200958 3300005549 Bacteria 1609
22 Ga0068855_100006336 3300005563 Bacteria 14418
23 Ga0068855_100074325 3300005563 Bacteria 3948
24 Ga0068857_100017087 3300005577 Bacteria 6355
25 Ga0068857_100031684 3300005577 Bacteria 4673
26 Ga0068854_100003752 3300005578 Bacteria 9498
27 Ga0068854_100175090 3300005578 Bacteria 1672
28 Ga0070702_100094586 3300005615 Bacteria 1819
29 Ga0068852_100040747 3300005616 Bacteria 3921
30 Ga0068861_100067679 3300005719 Bacteria 2757
31 Ga0068851_10000408 3300005834 Bacteria 19412
32 Ga0068860_100252086 3300005843 Bacteria 1719
33 Ga0068862_100095534 3300005844 Bacteria 2593
34 Ga0081540_1015921 3300005983 Bacteria 4739
35 Ga0081539_10000140 3300005985 Bacteria 166746
36 Ga0070712_100033417 3300006175 Bacteria 3481
37 Ga0075362_10013703 3300006177 Bacteria 3252
38 Ga0075369_10063755 3300006186 Bacteria 1613
39 Ga0075366_10062655 3300006195 Bacteria 2210
40 Ga0099825_1024325 3300006941 Bacteria 3562
41 Ga0105250_10036541 3300009092 Bacteria 1971
42 Ga0105240_10003692 3300009093 Bacteria 23676
43 Ga0105240_10019831 3300009093 Bacteria 8981
44 Ga0105240_10059068 3300009093 Bacteria 4787
45 Ga0105245_10303038 3300009098 Bacteria 1568
46 Ga0114129_10298268 3300009147 Bacteria 2149
47 Ga0105243_10168868 3300009148 Bacteria 1893
48 Ga0105242_10356407 3300009176 Bacteria 1353
49 Ga0105248_10074328 3300009177 Bacteria 3820
50 Ga0105237_10008146 3300009545 Bacteria 11379
51 Ga0105237_10376034 3300009545 Bacteria 1425
52 Ga0105238_10029581 3300009551 Bacteria 5579
53 Ga0105238_10035767 3300009551 Bacteria 5049
54 Ga0105239_10023840 3300010375 Bacteria 6739
55 Ga0157370_10078503 3300013104 Bacteria 3109
56 Ga0157369_10001511 3300013105 Bacteria 28540
57 Ga0157374_10108347 3300013296 Bacteria 2670
58 Ga0157378_10267162 3300013297 Bacteria 1644
59 Ga0163162_10295110 3300013306 Bacteria 1753
60 Ga0213876_10077268 3300021384 Bacteria 1758
61 Ga0213871_10013857 3300021441 Bacteria 1902
62 Ga0209677_105370 3300025253 Bacteria 3361
63 Ga0209148_1000282 3300025254 Bacteria 78016
64 Ga0209233_1003764 3300025261 Bacteria 5301
65 Ga0209455_1001040 3300025272 Bacteria 13815
66 Ga0209455_1002000 3300025272 Bacteria 8365
67 Ga0209564_1016458 3300025295 Bacteria 2942
68 Ga0209758_1000635 3300025297 Bacteria 53736
69 Ga0209758_1016527 3300025297 Bacteria 3741
70 Ga0207656_10055911 3300025321 Bacteria 1719
71 Ga0207684_10392005 3300025910 Bacteria 1194
72 Ga0207654_10000058 3300025911 Bacteria 75628
73 Ga0207707_10004287 3300025912 Bacteria 12624
74 Ga0207695_10000453 3300025913 Bacteria 89314
75 Ga0207695_10015308 3300025913 Bacteria 9037
76 Ga0207671_10009240 3300025914 Bacteria 8259
77 Ga0207671_10162668 3300025914 Bacteria 1729
78 Ga0207693_10019140 3300025915 Bacteria 5449
79 Ga0207663_10180126 3300025916 Bacteria 1508
80 Ga0207660_10001366 3300025917 Bacteria 16351
81 Ga0207657_10001686 3300025919 Bacteria 23826
82 Ga0207649_10030607 3300025920 Bacteria 3190
83 Ga0207652_10001889 3300025921 Bacteria 18142
84 Ga0207652_10122654 3300025921 Bacteria 2313
85 Ga0207681_10155012 3300025923 Bacteria 1720
86 Ga0207694_10001512 3300025924 Bacteria 19799
87 Ga0207686_10195569 3300025934 Bacteria 1445
88 Ga0207709_10128576 3300025935 Bacteria 1723
89 Ga0207665_10020313 3300025939 Bacteria 4364
90 Ga0207691_10128186 3300025940 Bacteria 2243
91 Ga0207689_10056391 3300025942 Bacteria 3233
92 Ga0207661_10007064 3300025944 Bacteria 7970
93 Ga0207667_10002324 3300025949 Bacteria 23814
94 Ga0207667_10007600 3300025949 Bacteria 12999
95 Ga0207712_10099750 3300025961 Bacteria 2157
96 Ga0207668_10113776 3300025972 Bacteria 2035
97 Ga0207640_10007128 3300025981 Bacteria 6160
98 Ga0207640_10038241 3300025981 Bacteria 3026
99 Ga0207639_10018895 3300026041 Bacteria 4906
100 Ga0207708_10016686 3300026075 Bacteria 5526
101 Ga0207702_10000004 3300026078 Bacteria 422182
102 Ga0207702_10001701 3300026078 Bacteria 21732
103 Ga0207674_10012685 3300026116 Bacteria 9415
104 Ga0207674_10042259 3300026116 Bacteria 4710
105 Ga0209389_1000182 3300027296 Bacteria 48705
106 Ga0209489_100209 3300027361 Bacteria 96349
107 Ga0209700_100011 3300027363 Bacteria 362159
108 Ga0268266_10181829 3300028379 Bacteria 1915
109 Ga0268264_10182986 3300028381 Bacteria 1905
110 Ga0268264_10343126 3300028381 Bacteria 1419
111 Ga0265325_10007580 3300031241 Bacteria 6488
112 Ga0265339_10001062 3300031249 Bacteria 20880
113 Ga0265339_10058404 3300031249 Bacteria 2083
114 Ga0307516_10205556 3300031730 Bacteria 1686
115 Ga0307405_10204874 3300031731 Bacteria 1436
116 Ga0315911_1000008 3300033442 Bacteria 381285
117 Ga0373923_0035062 3300035111 Bacteria 2040
118 Ga0373923_0046474 3300035111 Bacteria 1806
119 Ga0373953_0019552 3300035117 Bacteria 2521
120 Ga0373954_0001748 3300035118 Bacteria 8920
121 Ga0373956_0002617 3300035119 Bacteria 7295
122 Ga0373924_0004886 3300035410 Bacteria 4710
123 Ga0373927_0050555 3300035695 Bacteria 2688
124 Ga0373933_0001638 3300035724 Bacteria 13046
125 Ga0373947_0015676 3300035725 Bacteria 4354
126 Ga0373937_0024271 3300036401 Bacteria 5466
127 Ga0373925_0016468 3300037068 Bacteria 5356
128 Ga0395900_0003383 3300037418 Bacteria 17226
129 Ga0395898_0019808 3300037466 Bacteria 6842
130 Ga0395901_0111924 3300038443 Bacteria 2867
131 Ga0436365_0949897 3300039437 Bacteria 15199
132 Ga0436360_0158687 3300039438 Bacteria 3060
133 Ga0436361_0036770 3300039447 Bacteria 2094
134 Ga0436361_0348492 3300039447 Bacteria 2705
135 Ga0466969_0053580 3300044656 Bacteria 1978
136 Ga0466969_0072174 3300044656 Bacteria 1659
137 Ga0466966_0067001 3300044684 Bacteria 2256
138 Ga0466966_0093871 3300044684 Bacteria 1860
139 Ga0466963_0111780 3300044694 Bacteria 1876
140 Ga0466967_0080769 3300045976 Bacteria 2935
141 Ga0495592_0015319 3300046454 Bacteria 5819
142 Ga0495592_0155590 3300046454 Bacteria 1577
143 Ga0495590_0034524 3300046457 Bacteria 1766
144 Ga0495629_0001972 3300046459 Bacteria 15994
145 Ga0495629_0012646 3300046459 Bacteria 6113
146 Ga0495651_0007786 3300046462 Bacteria 8195
147 Ga0495653_0002188 3300046463 Bacteria 15461
148 Ga0495653_0100046 3300046463 Bacteria 2102
149 Ga0495580_0029615 3300046472 Bacteria 3972
150 Ga0495580_0121568 3300046472 Bacteria 1813
151 Ga0495606_0004206 3300046507 Bacteria 14566
152 Ga0495608_0002745 3300046511 Bacteria 12639
153 Ga0495618_0115108 3300046514 Bacteria 1722
154 Ga0495618_0132088 3300046514 Bacteria 1597
155 Ga0495628_0006025 3300046516 Bacteria 10598
156 Ga0495628_0041630 3300046516 Bacteria 3667
157 Ga0495648_0000286 3300046524 Bacteria 57430
158 Ga0495648_0062807 3300046524 Bacteria 2197
159 Ga0495652_0035518 3300046529 Bacteria 4338
160 Ga0495652_0054760 3300046529 Bacteria 3395
161 Ga0495640_0010574 3300046533 Bacteria 7118
162 Ga0495640_0027351 3300046533 Bacteria 4113
163 Ga0495640_0058070 3300046533 Bacteria 2640
164 Ga0495587_0005284 3300046536 Bacteria 8442
165 Ga0495597_0093716 3300046542 Bacteria 1272
166 Ga0495645_0133919 3300046543 Bacteria 1734
167 Ga0495667_0002652 3300046559 Bacteria 11945
168 Ga0495634_0054169 3300046642 Bacteria 2686
169 Ga0495625_0104008 3300046660 Bacteria 1947
170 Ga0495635_0001078 3300046663 Bacteria 18109
171 Ga0495635_0005472 3300046663 Bacteria 8833
172 Ga0495659_0011645 3300046664 Bacteria 2834
173 Ga0495657_0003417 3300046675 Bacteria 12959
174 Ga0495657_0013299 3300046675 Bacteria 6077
175 Ga0495657_0083889 3300046675 Bacteria 2056
176 Ga0495599_0001153 3300046678 Bacteria 14977
177 Ga0495646_0023490 3300046680 Bacteria 3880
178 Ga0495613_0024419 3300046689 Bacteria 4504
179 Ga0495613_0147597 3300046689 Bacteria 1678
180 Ga0495624_0157625 3300046690 Bacteria 1387
181 Ga0495600_0000311 3300046809 Bacteria 25806
182 Ga0495600_0019133 3300046809 Bacteria 4368
183 Ga0495604_0004906 3300047317 Bacteria 10603
184 Ga0495604_0009050 3300047317 Bacteria 7878
185 Ga0495604_0146046 3300047317 Bacteria 1685
186 Ga0495674_0010066 3300047319 Bacteria 8964
187 Ga0495676_0011847 3300047321 Bacteria 7866
188 Ga0495680_0009513 3300047322 Bacteria 8734
189 Ga0495680_0025482 3300047322 Bacteria 4893
190 Ga0495687_007560 3300047443 Bacteria 6376
191 Ga0495675_0001437 3300047444 Bacteria 14419
192 Ga0495675_0177015 3300047444 Bacteria 1307
193 Ga0495684_0011974 3300047471 Bacteria 6689
194 Ga0495593_0000693 3300047673 Bacteria 19452
195 Ga0495602_0002384 3300048088 Bacteria 19072
196 Ga0495602_0182596 3300048088 Bacteria 1616
197 Ga0495602_0253813 3300048088 Bacteria 1309
198 Ga0496100_0123471 3300048903 Bacteria 1815
199 Ga0496101_0155243 3300048904 Bacteria 1753
200 Ga0496104_0007292 3300048907 Bacteria 9757
201 Ga0496105_0000935 3300048908 Bacteria 19915
202 Ga0496108_0211391 3300048911 Bacteria 1684
203 Ga0496110_0009500 3300048913 Bacteria 7871
204 Ga0496112_0000004 3300048915 Bacteria 553294
205 Ga0496113_0173056 3300048916 Bacteria 1710
206 Ga0496114_0267241 3300048917 Bacteria 1507
207 Ga0496114_0307145 3300048917 Bacteria 1401
208 Ga0496119_0120300 3300048922 Bacteria 1444
209 Ga0496120_0008642 3300048923 Bacteria 7353
210 Ga0496121_0228305 3300048924 Bacteria 1306
211 Ga0496124_0047264 3300048927 Bacteria 3683
212 Ga0496124_0106109 3300048927 Bacteria 2268
213 Ga0496125_0042012 3300048928 Bacteria 3901
214 Ga0496125_0163641 3300048928 Bacteria 1507
215 Ga0496126_0009570 3300048929 Bacteria 10278
216 Ga0495682_0063306 3300049460 Bacteria 1334
217 nmdc:mga03683_98519_c1 3300050489 Bacteria 1283
218 nmdc:mga0k408_31683_c1 3300050493 Bacteria 3020
219 nmdc:mga0k408_62865_c1 3300050493 Bacteria 2159
220 Ga0495601_0003746 3300053077 Bacteria 8751
221 Ga0495619_0000330 3300053085 Bacteria 33168
222 Ga0500643_000063 3300053087 Bacteria 122135
223 Ga0500566_0003924 3300053094 Bacteria 8868
224 Ga0500595_000265 3300053119 Bacteria 34660
225 Ga0500622_0088281 3300053156 Bacteria 1542
226 Ga0500637_0002081 3300053178 Bacteria 8764
227 Ga0500601_000456 3300053737 Bacteria 6640
228 2513644149 2513237094 Bacteria 8789602
229 2513651531 2513237095 Bacteria 8976980
230 2524537069 2524023228 Bacteria 10118060
231 2818237634 2816332527 Bacteria 8933356
232 2824655174 2824653114 Bacteria 8493680
233 2824676640 2824671348 Bacteria 8369588
234 2824694738 2824687955 Bacteria 8360029
235 2824752559 2824746037 Bacteria 7911610
236 2841965419 2841957949 Bacteria 8652217
237 2842043525 2842038055 Bacteria 8002051
238 2842052485 2842045827 Bacteria 8006841
239 2847931057 2847930680 Bacteria 9342022
240 2849083020 2849076700 Bacteria 7039503
241 2874613451 2874612657 Bacteria 8252029
242 2876768912 2876761206 Bacteria 10111113
243 2879085891 2879083081 Bacteria 8587928
244 2885376155 2885374607 Bacteria 8927485
245 2888379609 2888378607 Bacteria 9652610
246 2903748970 2903748898 Bacteria 9972761
247 2906628972 2906626472 Bacteria 8826946
248 2906649394 2906643746 Bacteria 8722424
249 2908747428 2908739725 Bacteria 8628932
250 2932794332 2932794094 Bacteria 7915132
251 2935962621 2935959822 Bacteria 7869783
252 2941535530 2941531003 Bacteria 7653939
253 3005486883 3005483717 Bacteria 7877331
254 3005509175 3005506211 Bacteria 6943378
255 3005718288 3005718088 Bacteria 8283608
256 8006927875 8006926726 Bacteria 6749210
257 8006990907 8006984368 Bacteria 9651211
258 8016606583 8016603502 Bacteria 8731218
259 8056675728 8056673599 Bacteria 7871253
260 8056693387 8056689827 Bacteria 6712655
261 8056971273 8056967851 Bacteria 9038162
262 nmdc:mga0k408_45110_c1
263 JGI25406J46586_10000026
264 Ga0065165_1009889
265 Ga0070658_10053528
266 Ga0070683_100008779
267 Ga0068869_100171008
268 Ga0070680_100021698
269 Ga0070660_100002843
270 Ga0070661_100060132
271 Ga0070669_100112019
272 Ga0070667_100071178
273 Ga0070700_100034786
274 Ga0070662_100145536
275 Ga0070681_10048927
276 Ga0070698_100292021
277 Ga0070699_100196773
278 Ga0070679_100041621
279 Ga0070684_100006680
280 Ga0068853_100002454
281 Ga0070665_100022177
282 Ga0070704_100200958
283 Ga0068855_100006336
284 Ga0068855_100074325
285 Ga0068857_100017087
286 Ga0068857_100031684
287 Ga0068854_100003752
288 Ga0068854_100175090
289 Ga0070702_100094586
290 Ga0068852_100040747
291 Ga0068861_100067679
292 Ga0068851_10000408
293 Ga0068860_100252086
294 Ga0068862_100095534
295 Ga0081540_1015921
296 Ga0081539_10000140
297 Ga0070712_100033417
298 Ga0075362_10013703
299 Ga0075369_10063755
300 Ga0075366_10062655
301 Ga0099825_1024325
302 Ga0105250_10036541
303 Ga0105240_10003692
304 Ga0105240_10019831
305 Ga0105240_10059068
306 Ga0105245_10303038
307 Ga0114129_10298268
308 Ga0105243_10168868
309 Ga0105242_10356407
310 Ga0105248_10074328
311 Ga0105237_10008146
312 Ga0105237_10376034
313 Ga0105238_10029581
314 Ga0105238_10035767
315 Ga0105239_10023840
316 Ga0157370_10078503
317 Ga0157369_10001511
318 Ga0157374_10108347
319 Ga0157378_10267162
320 Ga0163162_10295110
321 Ga0213876_10077268
322 Ga0213871_10013857
323 Ga0209677_105370
324 Ga0209148_1000282
325 Ga0209233_1003764
326 Ga0209455_1001040
327 Ga0209455_1002000
328 Ga0209564_1016458
329 Ga0209758_1000635
330 Ga0209758_1016527
331 Ga0207656_10055911
332 Ga0207684_10392005
333 Ga0207654_10000058
334 Ga0207707_10004287
335 Ga0207695_10000453
336 Ga0207695_10015308
337 Ga0207671_10009240
338 Ga0207671_10162668
339 Ga0207693_10019140
340 Ga0207663_10180126
341 Ga0207660_10001366
342 Ga0207657_10001686
343 Ga0207649_10030607
344 Ga0207652_10001889
345 Ga0207652_10122654
346 Ga0207681_10155012
347 Ga0207694_10001512
348 Ga0207686_10195569
349 Ga0207709_10128576
350 Ga0207665_10020313
351 Ga0207691_10128186
352 Ga0207689_10056391
353 Ga0207661_10007064
354 Ga0207667_10002324
355 Ga0207667_10007600
356 Ga0207712_10099750
357 Ga0207668_10113776
358 Ga0207640_10007128
359 Ga0207640_10038241
360 Ga0207639_10018895
361 Ga0207708_10016686
362 Ga0207702_10000004
363 Ga0207702_10001701
364 Ga0207674_10012685
365 Ga0207674_10042259
366 Ga0209389_1000182
367 Ga0209489_100209
368 Ga0209700_100011
369 Ga0268266_10181829
370 Ga0268264_10182986
371 Ga0268264_10343126
372 Ga0265325_10007580
373 Ga0265339_10001062
374 Ga0265339_10058404
375 Ga0307516_10205556
376 Ga0307405_10204874
377 Ga0315911_1000008
378 Ga0373923_0035062
379 Ga0373923_0046474
380 Ga0373953_0019552
381 Ga0373954_0001748
382 Ga0373956_0002617
383 Ga0373924_0004886
384 Ga0373927_0050555
385 Ga0373933_0001638
386 Ga0373947_0015676
387 Ga0373937_0024271
388 Ga0373925_0016468
389 Ga0395900_0003383
390 Ga0395898_0019808
391 Ga0395901_0111924
392 Ga0436365_0949897
393 Ga0436360_0158687
394 Ga0436361_0036770
395 Ga0436361_0348492
396 Ga0466969_0053580
397 Ga0466969_0072174
398 Ga0466966_0067001
399 Ga0466966_0093871
400 Ga0466963_0111780
401 Ga0466967_0080769
402 Ga0495592_0015319
403 Ga0495592_0155590
404 Ga0495590_0034524
405 Ga0495629_0001972
406 Ga0495629_0012646
407 Ga0495651_0007786
408 Ga0495653_0002188
409 Ga0495653_0100046
410 Ga0495580_0029615
411 Ga0495580_0121568
412 Ga0495606_0004206
413 Ga0495608_0002745
414 Ga0495618_0115108
415 Ga0495618_0132088
416 Ga0495628_0006025
417 Ga0495628_0041630
418 Ga0495648_0000286
419 Ga0495648_0062807
420 Ga0495652_0035518
421 Ga0495652_0054760
422 Ga0495640_0010574
423 Ga0495640_0027351
424 Ga0495640_0058070
425 Ga0495587_0005284
426 Ga0495597_0093716
427 Ga0495645_0133919
428 Ga0495667_0002652
429 Ga0495634_0054169
430 Ga0495625_0104008
431 Ga0495635_0001078
432 Ga0495635_0005472
433 Ga0495659_0011645
434 Ga0495657_0003417
435 Ga0495657_0013299
436 Ga0495657_0083889
437 Ga0495599_0001153
438 Ga0495646_0023490
439 Ga0495613_0024419
440 Ga0495613_0147597
441 Ga0495624_0157625
442 Ga0495600_0000311
443 Ga0495600_0019133
444 Ga0495604_0004906
445 Ga0495604_0009050
446 Ga0495604_0146046
447 Ga0495674_0010066
448 Ga0495676_0011847
449 Ga0495680_0009513
450 Ga0495680_0025482
451 Ga0495687_007560
452 Ga0495675_0001437
453 Ga0495675_0177015
454 Ga0495684_0011974
455 Ga0495593_0000693
456 Ga0495602_0002384
457 Ga0495602_0182596
458 Ga0495602_0253813
459 Ga0496100_0123471
460 Ga0496101_0155243
461 Ga0496104_0007292
462 Ga0496105_0000935
463 Ga0496108_0211391
464 Ga0496110_0009500
465 Ga0496112_0000004
466 Ga0496113_0173056
467 Ga0496114_0267241
468 Ga0496114_0307145
469 Ga0496119_0120300
470 Ga0496120_0008642
471 Ga0496121_0228305
472 Ga0496124_0047264
473 Ga0496124_0106109
474 Ga0496125_0042012
475 Ga0496125_0163641
476 Ga0496126_0009570
477 Ga0495682_0063306
478 nmdc:mga03683_98519_c1
479 nmdc:mga0k408_31683_c1
480 nmdc:mga0k408_62865_c1
481 Ga0495601_0003746
482 Ga0495619_0000330
483 Ga0500643_000063
484 Ga0500566_0003924
485 Ga0500595_000265
486 Ga0500622_0088281
487 Ga0500637_0002081
488 Ga0500601_000456
489 2513644149
490 2513651531
491 2524537069
492 2818237634
493 2824655174
494 2824676640
495 2824694738
496 2824752559
497 2841965419
498 2842043525
499 2842052485
500 2847931057
501 2849083020
502 2874613451
503 2876768912
504 2879085891
505 2885376155
506 2888379609
507 2903748970
508 2906628972
509 2906649394
510 2908747428
511 2932794332
512 2935962621
513 2941535530
514 3005486883
515 3005509175
516 3005718288
517 8006927875
518 8006990907
519 8016606583
520 8056675728
521 8056693387
522 8056971273

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5f15-assembly1.cif.gz_A crystal structure of arnt from cupriavidus metallidurans bound to undecaprenyl phosphate 0.2469 15 325
8ipr-assembly2.cif.gz_E cryo-em structure of heme transporter cyddc from mycobacterium smegmatis in the outward facing atp bound state 0.2418 151 349
5f15-assembly1.cif.gz_A crystal structure of arnt from cupriavidus metallidurans bound to undecaprenyl phosphate 0.2219 15 325
4tl3-assembly1.cif.gz_A mechanistic insights from the crystal structure of an inward proton-transporting anabaena sensory rhodopsin mutant 0.212 70 324
8ji2-assembly1.cif.gz_B crystal structure of aetd in complex with 5,7-dibromo-l-tryptophan 0.2071 150 331
ID Description Score Start End Superfamily
af_Q54BP0_1_180_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.3526 152 322 1.20.1070.10
af_A0A0K3AQR5_1_183_1.25.40.180 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat; 0.2819 151 247 1.25.40.180
af_A0A0M9JJ79_1_312_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.2778 152 323 1.20.1070.10
af_O53645_615_925_1.20.1560.10 Mainly Alpha;Up-down Bundle;ABC transporter transmembrane region fold;ABC transporter type 1, transmembrane domain 0.2757 150 319 1.20.1560.10
af_Q10MN2_27_239_1.20.1420.10 Mainly Alpha;Up-down Bundle;A middle domain of Talin 1;Talin, central domain 0.2674 152 325 1.20.1420.10
ID Description Score Start End GO Terms
AF-A0A537SK85-F1-model_v4 Uncharacterized protein 0.8716 214 360 GO:0016020
AF-A0A537SK85-F1-model_v4 Uncharacterized protein 0.8606 214 360 GO:0016020
AF-A0A1J5Q6X9-F1-model_v4 Glycosyltransferase RgtA/B/C/D-like domain-containing protein 0.8399 72 360 GO:0016020
AF-A0A0A1Q2M8-F1-model_v4 Glycosyltransferase RgtA/B/C/D-like domain-containing protein 0.8172 11 360 GO:0016020
AF-A0A0D7PF57-F1-model_v4 EpsG family protein 0.8163 1 360 GO:0016020

Map