F370601

General Info

Members Datasets Scaffolds Average Seq Length
261 193 522 184

Family's Representative Sequence

Representative Sequence 3300046642|Ga0495634_0396457|Ga0495634_0396457_134_733
Length 199
Sequence VRTIHTNRKEDKEEEKMIDPEQYTPGPASGAQVRKDGEKWTLILVRELRHSPEKVWQALTDPEHLVEWAPFVVDGSLGTVGATVNLTWVGAPKPIETTVTRADAFKVLEYNDTRWELEALGGGTRLTLWATIDRRFISMGAAGWHISFDVLDRLLSGTPIPRIAGGDATKFAGWQRLNAEYAEQFGVKPPSWPPNAAKQ

Samples

Sample ID Description Type Environment
1 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
67 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
68 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
108 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
109 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
110 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
111 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
112 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
113 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
114 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
116 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
117 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
118 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
119 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
120 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
121 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
122 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
123 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
124 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
125 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
126 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
127 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
128 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
129 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
130 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
131 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
132 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
133 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
134 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
135 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
136 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
137 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
138 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
139 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
140 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
141 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
142 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
143 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
144 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
145 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
146 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
147 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
148 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
149 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
150 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
151 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
152 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
153 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
154 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
155 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
156 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
170 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
171 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
172 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
173 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
174 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
175 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
176 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
177 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
178 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
179 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
180 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
181 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
184 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
185 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
186 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
187 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
188 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
189 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
190 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
191 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
192 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
193 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.62
Metatranscriptomes 0.38
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.15
Rhizosphere 96.55
Stem 0
Stem Tuber 0
Unclassified 6.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495634_0396457 3300046642 Bacteria 820
2 Ga0065707_10023412 3300005295 Bacteria 1609
3 Ga0065707_10117652 3300005295 Unclassified 2206
4 Ga0065707_10292712 3300005295 Unclassified 1021
5 Ga0070658_10059521 3300005327 Bacteria 3110
6 Ga0070676_10002055 3300005328 Bacteria 10238
7 Ga0070690_100002885 3300005330 Bacteria 9271
8 Ga0068869_100324404 3300005334 Bacteria 1249
9 Ga0070666_10067410 3300005335 Bacteria 2430
10 Ga0070680_100075348 3300005336 Unclassified 2777
11 Ga0070680_100397598 3300005336 Bacteria 1174
12 Ga0068868_100026498 3300005338 Bacteria 4419
13 Ga0070687_100133673 3300005343 Bacteria 1435
14 Ga0070668_100017760 3300005347 Bacteria 5334
15 Ga0070669_100105431 3300005353 Bacteria 2132
16 Ga0070674_100026371 3300005356 Bacteria 3795
17 Ga0070673_100013177 3300005364 Bacteria 5707
18 Ga0070673_100044713 3300005364 Bacteria 3430
19 Ga0070688_100032790 3300005365 Bacteria 3136
20 Ga0070688_100067590 3300005365 Bacteria 2277
21 Ga0070688_100102701 3300005365 Bacteria 1887
22 Ga0070667_100198652 3300005367 Bacteria 1779
23 Ga0070667_100910410 3300005367 Bacteria 819
24 Ga0070714_100006772 3300005435 Bacteria 8882
25 Ga0070714_100050771 3300005435 Bacteria 3535
26 Ga0070713_100001096 3300005436 Bacteria 17297
27 Ga0070713_100005908 3300005436 Bacteria 8415
28 Ga0070713_100618795 3300005436 Bacteria 1030
29 Ga0070710_10262107 3300005437 Bacteria 1115
30 Ga0070701_10003667 3300005438 Bacteria 6121
31 Ga0070711_100535706 3300005439 Bacteria 970
32 Ga0070700_100029651 3300005441 Bacteria 3264
33 Ga0070694_100122786 3300005444 Bacteria 1866
34 Ga0070678_100882406 3300005456 Bacteria 817
35 Ga0070662_100043025 3300005457 Bacteria 3229
36 Ga0070681_10360608 3300005458 Bacteria 1364
37 Ga0068867_100044865 3300005459 Bacteria 3240
38 Ga0070685_10127069 3300005466 Bacteria 1590
39 Ga0070685_10459962 3300005466 Bacteria 893
40 Ga0070679_100493140 3300005530 Unclassified 1169
41 Ga0070697_100209128 3300005536 Bacteria 1660
42 Ga0070672_100009597 3300005543 Bacteria 6678
43 Ga0070672_100188445 3300005543 Bacteria 1721
44 Ga0070686_100026723 3300005544 Bacteria 3486
45 Ga0068855_100011368 3300005563 Bacteria 10747
46 Ga0068855_100027700 3300005563 Bacteria 6779
47 Ga0068856_100247685 3300005614 Bacteria 1797
48 Ga0068852_100057493 3300005616 Bacteria 3366
49 Ga0068859_100343206 3300005617 Bacteria 1588
50 Ga0068859_101128593 3300005617 Bacteria 863
51 Ga0068864_100656193 3300005618 Bacteria 1022
52 Ga0068866_10335603 3300005718 Bacteria 956
53 Ga0068861_100036307 3300005719 Bacteria 3656
54 Ga0068858_100473247 3300005842 Bacteria 1209
55 Ga0068860_101019873 3300005843 Bacteria 846
56 Ga0068862_100135653 3300005844 Bacteria 2181
57 Ga0070717_10078734 3300006028 Bacteria 2763
58 Ga0070717_10335633 3300006028 Bacteria 1349
59 Ga0070717_10780167 3300006028 Unclassified 869
60 Ga0070716_100379688 3300006173 Bacteria 1010
61 Ga0070716_100540869 3300006173 Bacteria 867
62 Ga0070712_100053669 3300006175 Bacteria 2815
63 Ga0097621_100429665 3300006237 Bacteria 1187
64 Ga0075428_101106948 3300006844 Unclassified 836
65 Ga0075431_100162899 3300006847 Bacteria 2293
66 Ga0075433_10025539 3300006852 Bacteria 4994
67 Ga0075434_100130017 3300006871 Bacteria 2536
68 Ga0075429_100659063 3300006880 Bacteria 917
69 Ga0068865_100003999 3300006881 Bacteria 8852
70 Ga0097620_100343206 3300006931 Bacteria 1588
71 Ga0097620_101128508 3300006931 Bacteria 863
72 Ga0075435_100046864 3300007076 Bacteria 3469
73 Ga0075435_100281833 3300007076 Bacteria 1419
74 Ga0111539_10002123 3300009094 Bacteria 26497
75 Ga0111539_10555624 3300009094 Bacteria 1337
76 Ga0111539_10944953 3300009094 Bacteria 1002
77 Ga0114129_10600920 3300009147 Bacteria 1425
78 Ga0105243_10032335 3300009148 Bacteria 4041
79 Ga0105241_10803705 3300009174 Bacteria 867
80 Ga0157369_10005305 3300013105 Bacteria 15024
81 Ga0157369_10319723 3300013105 Bacteria 1613
82 Ga0157374_10746629 3300013296 Bacteria 993
83 Ga0157378_10351998 3300013297 Bacteria 1439
84 Ga0163162_10657783 3300013306 Bacteria 1171
85 Ga0157372_10287609 3300013307 Unclassified 1912
86 Ga0163163_10035659 3300014325 Bacteria 4827
87 Ga0206350_10077709 3300020080 Bacteria 1842
88 Ga0213874_10142824 3300021377 Bacteria 830
89 Ga0213876_10021791 3300021384 Bacteria 3389
90 Ga0207697_10255004 3300025315 Bacteria 776
91 Ga0207642_10025337 3300025899 Bacteria 2398
92 Ga0207680_10026147 3300025903 Bacteria 3231
93 Ga0207699_10330248 3300025906 Bacteria 1072
94 Ga0207645_10004025 3300025907 Bacteria 10954
95 Ga0207705_10056528 3300025909 Bacteria 2829
96 Ga0207705_10192017 3300025909 Bacteria 1545
97 Ga0207707_10248274 3300025912 Bacteria 1546
98 Ga0207660_10019136 3300025917 Bacteria 4574
99 Ga0207660_10355198 3300025917 Bacteria 1175
100 Ga0207662_10043084 3300025918 Bacteria 2662
101 Ga0207652_10150777 3300025921 Bacteria 2082
102 Ga0207681_10000891 3300025923 Bacteria 19510
103 Ga0207700_10001356 3300025928 Bacteria 13888
104 Ga0207700_10045929 3300025928 Bacteria 3227
105 Ga0207700_10562887 3300025928 Bacteria 1012
106 Ga0207664_10014369 3300025929 Bacteria 5715
107 Ga0207664_10066610 3300025929 Unclassified 2887
108 Ga0207706_10129859 3300025933 Bacteria 2216
109 Ga0207709_10088679 3300025935 Bacteria 2014
110 Ga0207670_10007079 3300025936 Bacteria 6246
111 Ga0207669_10019792 3300025937 Bacteria 3513
112 Ga0207704_10018263 3300025938 Bacteria 3658
113 Ga0207665_10107721 3300025939 Bacteria 1954
114 Ga0207691_10019127 3300025940 Bacteria 6484
115 Ga0207691_10065797 3300025940 Bacteria 3280
116 Ga0207689_10132557 3300025942 Bacteria 2051
117 Ga0207651_10083121 3300025960 Bacteria 2314
118 Ga0207651_10394622 3300025960 Bacteria 1175
119 Ga0207712_10206975 3300025961 Bacteria 1560
120 Ga0207668_10087337 3300025972 Bacteria 2280
121 Ga0207658_10032113 3300025986 Bacteria 3734
122 Ga0207703_10197633 3300026035 Bacteria 1785
123 Ga0207639_10710895 3300026041 Bacteria 933
124 Ga0207708_10001920 3300026075 Bacteria 15362
125 Ga0207702_10141550 3300026078 Bacteria 2177
126 Ga0207648_10186944 3300026089 Bacteria 1835
127 Ga0207675_100044445 3300026118 Bacteria 4151
128 Ga0207683_10594043 3300026121 Bacteria 1024
129 Ga0207698_10257976 3300026142 Unclassified 1600
130 Ga0209588_1002174 3300027671 Bacteria 5295
131 Ga0209998_10095010 3300027717 Unclassified 734
132 Ga0207428_10002461 3300027907 Bacteria 18494
133 Ga0207428_10942279 3300027907 Bacteria 609
134 Ga0268266_10092677 3300028379 Bacteria 2651
135 Ga0268265_10363673 3300028380 Bacteria 1325
136 Ga0268264_10857817 3300028381 Bacteria 910
137 Ga0265319_1021859 3300028563 Bacteria 2342
138 Ga0265320_10011385 3300031240 Bacteria 5236
139 Ga0265339_10259453 3300031249 Unclassified 839
140 Ga0307508_10073164 3300031616 Bacteria 3003
141 Ga0265314_10004447 3300031711 Bacteria 13012
142 Ga0307416_101154975 3300032002 Bacteria 880
143 Ga0373939_0302894 3300035114 Bacteria 638
144 Ga0373937_0441854 3300036401 Bacteria 1235
145 Ga0395900_0198943 3300037418 Bacteria 2029
146 Ga0395900_0430197 3300037418 Bacteria 1279
147 Ga0436364_1312132 3300037853 Bacteria 7828
148 Ga0436365_1372899 3300039437 Bacteria 5262
149 Ga0436363_0306532 3300039450 Bacteria 830
150 Ga0451797_1065295 3300041453 Bacteria 1340
151 Ga0451798_0231998 3300041458 Unclassified 918
152 Ga0451802_0996681 3300041460 Bacteria 739
153 Ga0451577_0800085 3300042876 Bacteria 852
154 Ga0453684_0248082 3300044712 Unclassified 2046
155 Ga0466959_0388865 3300045049 Bacteria 949
156 Ga0466958_0369889 3300045836 Bacteria 924
157 Ga0466967_1155764 3300045976 Unclassified 771
158 Ga0495592_0245342 3300046454 Bacteria 1186
159 Ga0495651_0019400 3300046462 Bacteria 5270
160 Ga0495580_0077287 3300046472 Bacteria 2322
161 Ga0495580_0111933 3300046472 Bacteria 1896
162 Ga0495664_0083617 3300046477 Bacteria 1915
163 Ga0495664_0108063 3300046477 Bacteria 1678
164 Ga0495594_0029276 3300046499 Bacteria 2975
165 Ga0495594_0043164 3300046499 Bacteria 2471
166 Ga0495608_0073707 3300046511 Bacteria 2226
167 Ga0495628_0031632 3300046516 Bacteria 4279
168 Ga0495630_0118473 3300046517 Bacteria 2008
169 Ga0495666_0072014 3300046526 Bacteria 1642
170 Ga0495652_0005289 3300046529 Bacteria 12170
171 Ga0495640_0058582 3300046533 Bacteria 2626
172 Ga0495640_0070706 3300046533 Bacteria 2344
173 Ga0495586_0085719 3300046535 Bacteria 1735
174 Ga0495587_0025713 3300046536 Bacteria 3596
175 Ga0495587_0486382 3300046536 Bacteria 683
176 Ga0495645_0004376 3300046543 Bacteria 9646
177 Ga0495667_0182428 3300046559 Bacteria 1347
178 Ga0495634_0009960 3300046642 Bacteria 6984
179 Ga0495635_0125875 3300046663 Bacteria 1747
180 Ga0495657_0203754 3300046675 Bacteria 1205
181 Ga0495599_0012136 3300046678 Bacteria 5304
182 Ga0495623_0023472 3300046679 Bacteria 3981
183 Ga0495647_0082331 3300046681 Bacteria 1307
184 Ga0495624_0205645 3300046690 Bacteria 1195
185 Ga0495600_0024267 3300046809 Bacteria 3903
186 Ga0495604_0163604 3300047317 Bacteria 1570
187 Ga0495674_0199944 3300047319 Bacteria 1658
188 Ga0495674_0222537 3300047319 Bacteria 1560
189 Ga0495672_0212673 3300047320 Bacteria 959
190 Ga0495680_0029148 3300047322 Bacteria 4522
191 Ga0495675_0092974 3300047444 Bacteria 1892
192 Ga0495684_0305452 3300047471 Bacteria 1142
193 Ga0495602_0060547 3300048088 Bacteria 3298
194 Ga0501031_0019622 3300049568 Bacteria 4403
195 Ga0501032_0037973 3300049569 Bacteria 3281
196 Ga0501032_0041683 3300049569 Bacteria 3116
197 Ga0501032_0140337 3300049569 Bacteria 1591
198 Ga0501033_0000734 3300049570 Bacteria 30114
199 Ga0501033_0002781 3300049570 Bacteria 14664
200 Ga0501034_0018795 3300049571 Bacteria 7082
201 Ga0501034_0231097 3300049571 Bacteria 1798
202 Ga0501036_0003617 3300049572 Bacteria 12357
203 Ga0501036_0028369 3300049572 Bacteria 4730
204 Ga0501036_0102086 3300049572 Bacteria 2426
205 Ga0501037_0009962 3300049573 Bacteria 6969
206 Ga0501037_0010500 3300049573 Bacteria 6800
207 Ga0501037_0021381 3300049573 Bacteria 4780
208 Ga0501038_0002303 3300049574 Bacteria 17757
209 Ga0501038_0010766 3300049574 Bacteria 8360
210 Ga0501038_0182035 3300049574 Bacteria 1695
211 Ga0501039_0028942 3300049575 Bacteria 4266
212 Ga0501039_0180242 3300049575 Bacteria 1661
213 Ga0501040_0064228 3300049576 Bacteria 2527
214 Ga0501043_0002504 3300049579 Bacteria 15532
215 Ga0501046_0300412 3300049580 Bacteria 1172
216 Ga0501047_0020162 3300049581 Bacteria 6400
217 Ga0501047_0289755 3300049581 Bacteria 1481
218 Ga0501047_0565432 3300049581 Unclassified 960
219 Ga0501047_1164664 3300049581 Bacteria 584
220 Ga0501048_0002543 3300049582 Bacteria 13959
221 Ga0501048_0243056 3300049582 Bacteria 1277
222 Ga0501067_0017662 3300049583 Bacteria 3949
223 Ga0501067_0274132 3300049583 Bacteria 939
224 Ga0501068_0003983 3300049584 Bacteria 8039
225 Ga0501068_0008433 3300049584 Bacteria 5734
226 Ga0501068_0307379 3300049584 Bacteria 1015
227 Ga0501069_0053532 3300049585 Bacteria 2247
228 Ga0501069_0085650 3300049585 Bacteria 1778
229 Ga0501069_0168151 3300049585 Bacteria 1264
230 Ga0501070_0014152 3300049586 Bacteria 6713
231 Ga0501071_0005202 3300049587 Bacteria 8334
232 Ga0501072_0132083 3300049588 Bacteria 1990
233 Ga0501072_0315034 3300049588 Bacteria 1243
234 Ga0501073_0048033 3300049589 Bacteria 2997
235 Ga0501073_0148684 3300049589 Unclassified 1623
236 Ga0501074_0007817 3300049590 Bacteria 7743
237 Ga0501074_0042438 3300049590 Bacteria 3291
238 Ga0501076_0027571 3300049592 Bacteria 4405
239 Ga0501079_0227662 3300049741 Bacteria 1456
240 Ga0501079_0299309 3300049741 Unclassified 1258
241 Ga0501080_0008237 3300049742 Bacteria 9439
242 Ga0501083_0012290 3300049744 Bacteria 5992
243 Ga0501083_0118497 3300049744 Bacteria 1737
244 Ga0501035_0000789 3300049822 Bacteria 33899
245 Ga0501035_0018288 3300049822 Bacteria 6456
246 Ga0501044_0243936 3300049823 Bacteria 1739
247 Ga0501045_0003433 3300049824 Bacteria 10841
248 Ga0501045_0460209 3300049824 Unclassified 945
249 nmdc:mga05p37_462345_c1 3300050507 Bacteria 1466
250 nmdc:mga09592_173986_c1 3300050508 Bacteria 1862
251 nmdc:mga09592_306460_c1 3300050508 Bacteria 1376
252 nmdc:mga06r32_102831_c1 3300050510 Bacteria 2805
253 nmdc:mga08y16_2187_c1 3300050511 Bacteria 20060
254 nmdc:mga0n895_141643_c1 3300050512 Bacteria 2433
255 nmdc:mga0rr50_15403_c1 3300050513 Bacteria 5046
256 Ga0495601_0051819 3300053077 Bacteria 2591
257 Ga0495619_0158260 3300053085 Bacteria 1564
258 Ga0501084_0067255 3300054114 Bacteria 2999
259 Ga0501084_0220510 3300054114 Bacteria 1600
260 Ga0501082_0030626 3300060353 Bacteria 4636
261 Ga0501082_0035548 3300060353 Bacteria 4294
262 Ga0495634_0396457
263 Ga0065707_10023412
264 Ga0065707_10117652
265 Ga0065707_10292712
266 Ga0070658_10059521
267 Ga0070676_10002055
268 Ga0070690_100002885
269 Ga0068869_100324404
270 Ga0070666_10067410
271 Ga0070680_100075348
272 Ga0070680_100397598
273 Ga0068868_100026498
274 Ga0070687_100133673
275 Ga0070668_100017760
276 Ga0070669_100105431
277 Ga0070674_100026371
278 Ga0070673_100013177
279 Ga0070673_100044713
280 Ga0070688_100032790
281 Ga0070688_100067590
282 Ga0070688_100102701
283 Ga0070667_100198652
284 Ga0070667_100910410
285 Ga0070714_100006772
286 Ga0070714_100050771
287 Ga0070713_100001096
288 Ga0070713_100005908
289 Ga0070713_100618795
290 Ga0070710_10262107
291 Ga0070701_10003667
292 Ga0070711_100535706
293 Ga0070700_100029651
294 Ga0070694_100122786
295 Ga0070678_100882406
296 Ga0070662_100043025
297 Ga0070681_10360608
298 Ga0068867_100044865
299 Ga0070685_10127069
300 Ga0070685_10459962
301 Ga0070679_100493140
302 Ga0070697_100209128
303 Ga0070672_100009597
304 Ga0070672_100188445
305 Ga0070686_100026723
306 Ga0068855_100011368
307 Ga0068855_100027700
308 Ga0068856_100247685
309 Ga0068852_100057493
310 Ga0068859_100343206
311 Ga0068859_101128593
312 Ga0068864_100656193
313 Ga0068866_10335603
314 Ga0068861_100036307
315 Ga0068858_100473247
316 Ga0068860_101019873
317 Ga0068862_100135653
318 Ga0070717_10078734
319 Ga0070717_10335633
320 Ga0070717_10780167
321 Ga0070716_100379688
322 Ga0070716_100540869
323 Ga0070712_100053669
324 Ga0097621_100429665
325 Ga0075428_101106948
326 Ga0075431_100162899
327 Ga0075433_10025539
328 Ga0075434_100130017
329 Ga0075429_100659063
330 Ga0068865_100003999
331 Ga0097620_100343206
332 Ga0097620_101128508
333 Ga0075435_100046864
334 Ga0075435_100281833
335 Ga0111539_10002123
336 Ga0111539_10555624
337 Ga0111539_10944953
338 Ga0114129_10600920
339 Ga0105243_10032335
340 Ga0105241_10803705
341 Ga0157369_10005305
342 Ga0157369_10319723
343 Ga0157374_10746629
344 Ga0157378_10351998
345 Ga0163162_10657783
346 Ga0157372_10287609
347 Ga0163163_10035659
348 Ga0206350_10077709
349 Ga0213874_10142824
350 Ga0213876_10021791
351 Ga0207697_10255004
352 Ga0207642_10025337
353 Ga0207680_10026147
354 Ga0207699_10330248
355 Ga0207645_10004025
356 Ga0207705_10056528
357 Ga0207705_10192017
358 Ga0207707_10248274
359 Ga0207660_10019136
360 Ga0207660_10355198
361 Ga0207662_10043084
362 Ga0207652_10150777
363 Ga0207681_10000891
364 Ga0207700_10001356
365 Ga0207700_10045929
366 Ga0207700_10562887
367 Ga0207664_10014369
368 Ga0207664_10066610
369 Ga0207706_10129859
370 Ga0207709_10088679
371 Ga0207670_10007079
372 Ga0207669_10019792
373 Ga0207704_10018263
374 Ga0207665_10107721
375 Ga0207691_10019127
376 Ga0207691_10065797
377 Ga0207689_10132557
378 Ga0207651_10083121
379 Ga0207651_10394622
380 Ga0207712_10206975
381 Ga0207668_10087337
382 Ga0207658_10032113
383 Ga0207703_10197633
384 Ga0207639_10710895
385 Ga0207708_10001920
386 Ga0207702_10141550
387 Ga0207648_10186944
388 Ga0207675_100044445
389 Ga0207683_10594043
390 Ga0207698_10257976
391 Ga0209588_1002174
392 Ga0209998_10095010
393 Ga0207428_10002461
394 Ga0207428_10942279
395 Ga0268266_10092677
396 Ga0268265_10363673
397 Ga0268264_10857817
398 Ga0265319_1021859
399 Ga0265320_10011385
400 Ga0265339_10259453
401 Ga0307508_10073164
402 Ga0265314_10004447
403 Ga0307416_101154975
404 Ga0373939_0302894
405 Ga0373937_0441854
406 Ga0395900_0198943
407 Ga0395900_0430197
408 Ga0436364_1312132
409 Ga0436365_1372899
410 Ga0436363_0306532
411 Ga0451797_1065295
412 Ga0451798_0231998
413 Ga0451802_0996681
414 Ga0451577_0800085
415 Ga0453684_0248082
416 Ga0466959_0388865
417 Ga0466958_0369889
418 Ga0466967_1155764
419 Ga0495592_0245342
420 Ga0495651_0019400
421 Ga0495580_0077287
422 Ga0495580_0111933
423 Ga0495664_0083617
424 Ga0495664_0108063
425 Ga0495594_0029276
426 Ga0495594_0043164
427 Ga0495608_0073707
428 Ga0495628_0031632
429 Ga0495630_0118473
430 Ga0495666_0072014
431 Ga0495652_0005289
432 Ga0495640_0058582
433 Ga0495640_0070706
434 Ga0495586_0085719
435 Ga0495587_0025713
436 Ga0495587_0486382
437 Ga0495645_0004376
438 Ga0495667_0182428
439 Ga0495634_0009960
440 Ga0495635_0125875
441 Ga0495657_0203754
442 Ga0495599_0012136
443 Ga0495623_0023472
444 Ga0495647_0082331
445 Ga0495624_0205645
446 Ga0495600_0024267
447 Ga0495604_0163604
448 Ga0495674_0199944
449 Ga0495674_0222537
450 Ga0495672_0212673
451 Ga0495680_0029148
452 Ga0495675_0092974
453 Ga0495684_0305452
454 Ga0495602_0060547
455 Ga0501031_0019622
456 Ga0501032_0037973
457 Ga0501032_0041683
458 Ga0501032_0140337
459 Ga0501033_0000734
460 Ga0501033_0002781
461 Ga0501034_0018795
462 Ga0501034_0231097
463 Ga0501036_0003617
464 Ga0501036_0028369
465 Ga0501036_0102086
466 Ga0501037_0009962
467 Ga0501037_0010500
468 Ga0501037_0021381
469 Ga0501038_0002303
470 Ga0501038_0010766
471 Ga0501038_0182035
472 Ga0501039_0028942
473 Ga0501039_0180242
474 Ga0501040_0064228
475 Ga0501043_0002504
476 Ga0501046_0300412
477 Ga0501047_0020162
478 Ga0501047_0289755
479 Ga0501047_0565432
480 Ga0501047_1164664
481 Ga0501048_0002543
482 Ga0501048_0243056
483 Ga0501067_0017662
484 Ga0501067_0274132
485 Ga0501068_0003983
486 Ga0501068_0008433
487 Ga0501068_0307379
488 Ga0501069_0053532
489 Ga0501069_0085650
490 Ga0501069_0168151
491 Ga0501070_0014152
492 Ga0501071_0005202
493 Ga0501072_0132083
494 Ga0501072_0315034
495 Ga0501073_0048033
496 Ga0501073_0148684
497 Ga0501074_0007817
498 Ga0501074_0042438
499 Ga0501076_0027571
500 Ga0501079_0227662
501 Ga0501079_0299309
502 Ga0501080_0008237
503 Ga0501083_0012290
504 Ga0501083_0118497
505 Ga0501035_0000789
506 Ga0501035_0018288
507 Ga0501044_0243936
508 Ga0501045_0003433
509 Ga0501045_0460209
510 nmdc:mga05p37_462345_c1
511 nmdc:mga09592_173986_c1
512 nmdc:mga09592_306460_c1
513 nmdc:mga06r32_102831_c1
514 nmdc:mga08y16_2187_c1
515 nmdc:mga0n895_141643_c1
516 nmdc:mga0rr50_15403_c1
517 Ga0495601_0051819
518 Ga0495619_0158260
519 Ga0501084_0067255
520 Ga0501084_0220510
521 Ga0501082_0030626
522 Ga0501082_0035548

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10604

Polyketide_cyc2

Polyketide cyclase / dehydrase and lipid transport

39

180

0.84

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

49

156

0.8

PF03364

Polyketide_cyc

Polyketide cyclase / dehydrase and lipid transport

48

156

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3q63-assembly2.cif.gz_D x-ray crystal structure of protein mll2253 from mesorhizobium loti, northeast structural genomics consortium target mlr404. 0.8397 25 150
3q6a-assembly1.cif.gz_D x-ray crystal structure of the protein ssp2350 from staphylococcus saprophyticus, northeast structural genomics consortium target syr116 0.8353 25 154
1xn5-assembly1.cif.gz_A solution structure of bacillus halodurans protein bh1534: the northeast structural genomics consortium target bhr29 0.8322 27 138
2n4b-assembly1.cif.gz_A ec-nmr structure of ralstonia metallidurans rmet_5065 determined by combining evolutionary couplings (ec) and sparse nmr data. northeast structural genomics consortium target crr115 0.8247 25 147
1xfs-assembly1.cif.gz_A x-ray crystal structure of protein ne0264 from nitrosomonas europaea. northeast structural genomics consortium target ner5. 0.8224 19 148
ID Description Score Start End Superfamily
1z94E00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8138 25 144 3.30.530.20
af_O53773_104_241_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.811 27 148 3.30.530.20
3q63F00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8083 22 150 3.30.530.20
2n4aA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8079 25 147 3.30.530.20
af_A0A1D6HQJ5_8_161_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8009 21 139 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A3N5H1A8-F1-model_v4 SRPBCC family protein 0.9805 4 176
AF-A0A2N7VIV1-F1-model_v4 Polyketide cyclase 0.9732 1 175
AF-A0A2V8FPE0-F1-model_v4 Polyketide cyclase 0.963 1 147
AF-A0A2N7VIV1-F1-model_v4 Polyketide cyclase 0.9623 1 175
AF-A0A3N5H1A8-F1-model_v4 SRPBCC family protein 0.9585 4 176

Map