F370540

General Info

Members Datasets Scaffolds Average Seq Length
261 102 522 231

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0013560|Ga0453684_0013560_11946_12716
Length 256
Sequence MDNRDKHGFFSVKIREIRGIRDLNWFKSRSNLMEVAKIENVTRTFKVGKIETQALRGVNLSIESGEFTALVGPSGSGKTTLLQLIGCLDLPTSGNVIINGKNVSKLNRSQRADMRRGTLGFIFQFFALIPTLTAYENVEMPLLLTGVSGSERRKRVTELLEAVGLTDRANNRPDQMSGGQQQRVAIARALTTKPALILADEPTANLDTANGQQVMETMTRLNQETGVTFVFATHDPRVIHYARRVVTLEDGLIVKN

Samples

Sample ID Description Type Environment
1 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
9 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
21 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
22 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
23 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
25 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
26 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
27 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
28 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
29 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
37 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
38 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
39 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
51 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
52 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
53 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
54 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
55 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
56 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
57 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
58 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
59 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
60 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
61 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
62 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
63 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
64 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
65 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
66 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
67 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
68 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
69 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
70 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
71 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
72 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
73 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
74 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
75 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
76 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
77 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
78 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
79 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
80 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
81 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
82 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
83 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
84 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
85 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
86 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
87 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
89 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
90 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
91 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
92 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
93 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
94 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
95 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
96 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
97 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
98 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
99 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
100 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
101 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
102 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.47
Metatranscriptomes 1.53
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.38
Rhizosphere 97.7
Stem 0
Stem Tuber 0
Unclassified 4.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0453684_0013560 3300044712 Bacteria 13217
2 SwRhRL2b_contig_3318367 2162886007 Bacteria 1062
3 JGI25406J46586_10047333 3300003203 Bacteria 1466
4 Ga0065704_10070229 3300005289 Bacteria 56373
5 Ga0065704_10097034 3300005289 Bacteria 2412
6 Ga0065707_10012170 3300005295 Bacteria 2430
7 Ga0065707_10081970 3300005295 Bacteria 26755
8 Ga0065707_10096333 3300005295 Bacteria 3275
9 Ga0065707_10125666 3300005295 Bacteria 2019
10 Ga0065707_10310619 3300005295 Bacteria 985
11 Ga0070690_100173868 3300005330 Bacteria 1484
12 Ga0070680_100495137 3300005336 Bacteria 1045
13 Ga0070700_100023351 3300005441 Bacteria 3616
14 Ga0070694_100086071 3300005444 Bacteria 2196
15 Ga0070694_100538234 3300005444 Unclassified 934
16 Ga0070708_100354124 3300005445 Bacteria 1383
17 Ga0070662_100916412 3300005457 Unclassified 748
18 Ga0070706_100786346 3300005467 Bacteria 881
19 Ga0070707_100031010 3300005468 Bacteria 5091
20 Ga0070707_100300181 3300005468 Bacteria 1561
21 Ga0070707_100687668 3300005468 Bacteria 986
22 Ga0070698_100057414 3300005471 Bacteria 3939
23 Ga0070698_100464681 3300005471 Bacteria 1201
24 Ga0070699_100012971 3300005518 Bacteria 7180
25 Ga0070699_100041439 3300005518 Unclassified 3986
26 Ga0070699_100300115 3300005518 Bacteria 1441
27 Ga0070684_100035259 3300005535 Bacteria 4282
28 Ga0070686_100164922 3300005544 Bacteria 1563
29 Ga0070696_100138270 3300005546 Bacteria 1777
30 Ga0068859_100063310 3300005617 Bacteria 3730
31 Ga0068859_100187380 3300005617 Bacteria 2153
32 Ga0068861_100084185 3300005719 Bacteria 2497
33 Ga0068870_10047403 3300005840 Bacteria 2259
34 Ga0068862_100012311 3300005844 Bacteria 7074
35 Ga0068862_100022202 3300005844 Bacteria 5309
36 Ga0068862_100323723 3300005844 Bacteria 1424
37 Ga0081539_10001449 3300005985 Bacteria 40567
38 Ga0081539_10006560 3300005985 Bacteria 11084
39 Ga0075428_100016377 3300006844 Bacteria 8192
40 Ga0075428_100234101 3300006844 Bacteria 1982
41 Ga0075428_100644236 3300006844 Bacteria 1130
42 Ga0075430_100086448 3300006846 Bacteria 2624
43 Ga0075430_100458322 3300006846 Bacteria 1052
44 Ga0075430_100645607 3300006846 Bacteria 873
45 Ga0075431_100102714 3300006847 Bacteria 2950
46 Ga0075431_100263960 3300006847 Bacteria 1747
47 Ga0075431_100282199 3300006847 Bacteria 1681
48 Ga0075431_100478117 3300006847 Bacteria 1239
49 Ga0075433_10147804 3300006852 Bacteria 2089
50 Ga0075429_100016033 3300006880 Bacteria 6490
51 Ga0075429_100034646 3300006880 Bacteria 4387
52 Ga0075429_100350789 3300006880 Bacteria 1292
53 Ga0097620_100063312 3300006931 Bacteria 3730
54 Ga0097620_100187382 3300006931 Bacteria 2153
55 Ga0111539_10919576 3300009094 Bacteria 1017
56 Ga0105245_10660281 3300009098 Bacteria 1076
57 Ga0114129_10003312 3300009147 Bacteria 22622
58 Ga0114129_10013397 3300009147 Bacteria 11686
59 Ga0114129_10142409 3300009147 Unclassified 3285
60 Ga0114129_10402794 3300009147 Bacteria 1803
61 Ga0114129_10570940 3300009147 Bacteria 1469
62 Ga0114129_11388972 3300009147 Bacteria 867
63 Ga0105243_10015325 3300009148 Bacteria 5798
64 Ga0105243_10291790 3300009148 Bacteria 1474
65 Ga0105237_10383309 3300009545 Bacteria 1411
66 Ga0105249_10274752 3300009553 Bacteria 1680
67 Ga0105249_10493615 3300009553 Bacteria 1268
68 Ga0157375_10766285 3300013308 Bacteria 1115
69 Ga0157377_10385312 3300014745 Bacteria 950
70 Ga0157376_10421937 3300014969 Bacteria 1295
71 Ga0207653_10019436 3300025885 Bacteria 2141
72 Ga0207643_10131498 3300025908 Bacteria 1489
73 Ga0207662_10478955 3300025918 Bacteria 854
74 Ga0207646_10397427 3300025922 Unclassified 1245
75 Ga0207646_10797187 3300025922 Bacteria 841
76 Ga0207709_10097544 3300025935 Bacteria 1936
77 Ga0207709_10258793 3300025935 Bacteria 1275
78 Ga0207703_10260694 3300026035 Bacteria 1567
79 Ga0207708_10032533 3300026075 Bacteria 3960
80 Ga0207641_10801675 3300026088 Bacteria 932
81 Ga0207674_10468283 3300026116 Bacteria 1218
82 Ga0207675_100168119 3300026118 Bacteria 2095
83 Ga0268265_10043528 3300028380 Bacteria 3339
84 Ga0265334_10001518 3300028573 Bacteria 11207
85 Ga0265318_10018408 3300028577 Unclassified 2850
86 Ga0265323_10017744 3300028653 Bacteria 2761
87 Ga0265320_10088914 3300031240 Unclassified 1432
88 Ga0265340_10004331 3300031247 Bacteria 7947
89 Ga0265331_10047177 3300031250 Unclassified 2073
90 Ga0265327_10020208 3300031251 Bacteria 4065
91 Ga0265316_10069261 3300031344 Bacteria 2723
92 Ga0316575_10003412 3300031665 Bacteria 5473
93 Ga0316579_10028978 3300031691 Bacteria 2524
94 Ga0316579_10037826 3300031691 Bacteria 2230
95 Ga0316579_10043734 3300031691 Bacteria 2084
96 Ga0316579_10062212 3300031691 Bacteria 1758
97 Ga0316579_10066381 3300031691 Bacteria 1703
98 Ga0316579_10107276 3300031691 Bacteria 1339
99 Ga0316576_10021979 3300031727 Bacteria 4422
100 Ga0316576_10040256 3300031727 Bacteria 3358
101 Ga0316576_10050249 3300031727 Bacteria 3032
102 Ga0316576_10553583 3300031727 Bacteria 843
103 Ga0316578_10005808 3300031728 Bacteria 6031
104 Ga0316578_10034587 3300031728 Bacteria 2902
105 Ga0316578_10045520 3300031728 Bacteria 2554
106 Ga0316578_10095496 3300031728 Bacteria 1779
107 Ga0316578_10149978 3300031728 Bacteria 1404
108 Ga0316578_10189279 3300031728 Bacteria 1240
109 Ga0316578_10317253 3300031728 Unclassified 931
110 Ga0307516_10062284 3300031730 Bacteria 3616
111 Ga0307405_10127429 3300031731 Bacteria 1753
112 Ga0316577_10005159 3300031733 Bacteria 6824
113 Ga0316577_10013216 3300031733 Bacteria 4509
114 Ga0316577_10027330 3300031733 Bacteria 3181
115 Ga0316577_10033275 3300031733 Bacteria 2879
116 Ga0316577_10056020 3300031733 Bacteria 2200
117 Ga0316577_10272562 3300031733 Bacteria 958
118 Ga0316577_10350175 3300031733 Bacteria 838
119 Ga0307410_10037126 3300031852 Bacteria 3180
120 Ga0307412_10222296 3300031911 Bacteria 1448
121 Ga0307416_100184260 3300032002 Bacteria 1960
122 Ga0307415_100146401 3300032126 Bacteria 1812
123 Ga0307415_100725480 3300032126 Bacteria 900
124 Ga0316583_10001773 3300032133 Bacteria 7337
125 Ga0316583_10018611 3300032133 Bacteria 2495
126 Ga0316585_10002919 3300032137 Bacteria 4670
127 Ga0316585_10012462 3300032137 Bacteria 2520
128 Ga0316585_10031580 3300032137 Bacteria 1666
129 Ga0316580_10033249 3300032139 Bacteria 1596
130 Ga0316593_10004240 3300032168 Bacteria 3661
131 Ga0316592_1038003 3300033524 Bacteria 1060
132 Ga0316596_1001915 3300033541 Bacteria 4359
133 Ga0316596_1001972 3300033541 Bacteria 4301
134 Ga0373939_0126931 3300035114 Bacteria 906
135 Ga0316574_0006065 3300035398 Bacteria 6497
136 Ga0316574_0009352 3300035398 Bacteria 5487
137 Ga0316582_0009952 3300036647 Bacteria 5185
138 Ga0316582_0031360 3300036647 Bacteria 3248
139 Ga0316582_0044950 3300036647 Bacteria 2779
140 Ga0316582_0085435 3300036647 Bacteria 2068
141 Ga0316582_0116883 3300036647 Bacteria 1781
142 Ga0316582_0118635 3300036647 Bacteria 1769
143 Ga0316582_0268910 3300036647 Bacteria 1169
144 Ga0316584_0008282 3300036712 Bacteria 7161
145 Ga0316584_0021750 3300036712 Bacteria 4666
146 Ga0316584_0030069 3300036712 Bacteria 4011
147 Ga0316584_0030397 3300036712 Bacteria 3989
148 Ga0316584_0053251 3300036712 Bacteria 3028
149 Ga0316584_0074680 3300036712 Bacteria 2541
150 Ga0316584_0090446 3300036712 Bacteria 2291
151 Ga0316584_0172463 3300036712 Bacteria 1603
152 Ga0316584_0193422 3300036712 Bacteria 1503
153 Ga0316584_0225889 3300036712 Bacteria 1374
154 Ga0316584_0229820 3300036712 Unclassified 1360
155 Ga0316584_0291269 3300036712 Bacteria 1184
156 Ga0316584_0294483 3300036712 Bacteria 1176
157 Ga0316581_0009518 3300037588 Bacteria 2673
158 Ga0316581_0037497 3300037588 Unclassified 1473
159 Ga0400484_11279 3300038725 Bacteria 1708
160 Ga0400484_19134 3300038725 Bacteria 3078
161 Ga0400490_43339 3300038726 Bacteria 4049
162 Ga0400489_83225 3300039093 Bacteria 4405
163 Ga0451577_0031564 3300042876 Bacteria 4779
164 Ga0451577_0032567 3300042876 Bacteria 4696
165 Ga0451577_0098759 3300042876 Bacteria 2608
166 Ga0451577_0252007 3300042876 Bacteria 1598
167 Ga0451577_0273970 3300042876 Bacteria 1528
168 Ga0451577_0384152 3300042876 Bacteria 1274
169 Ga0451577_0610928 3300042876 Bacteria 989
170 Ga0451577_0718710 3300042876 Bacteria 904
171 Ga0451577_0805152 3300042876 Viruses 849
172 Ga0451577_0993963 3300042876 Bacteria 753
173 Ga0453683_0002222 3300044673 Bacteria 15362
174 Ga0453683_0010387 3300044673 Bacteria 6171
175 Ga0453683_0019895 3300044673 Bacteria 4295
176 Ga0453683_0031846 3300044673 Bacteria 3330
177 Ga0453683_0093766 3300044673 Bacteria 1883
178 Ga0453683_0102057 3300044673 Bacteria 1801
179 Ga0453683_0273831 3300044673 Bacteria 1077
180 Ga0453684_0000023 3300044712 Bacteria 857153
181 Ga0453684_0000055 3300044712 Bacteria 532014
182 Ga0453684_0000157 3300044712 Bacteria 304259
183 Ga0453684_0000271 3300044712 Bacteria 223654
184 Ga0453684_0001019 3300044712 Bacteria 90275
185 Ga0453684_0003105 3300044712 Bacteria 38268
186 Ga0453684_0003908 3300044712 Bacteria 32740
187 Ga0453684_0006468 3300044712 Bacteria 22236
188 Ga0453684_0007761 3300044712 Bacteria 19573
189 Ga0453684_0008215 3300044712 Bacteria 18820
190 Ga0453684_0008685 3300044712 Bacteria 18072
191 Ga0453684_0016147 3300044712 Bacteria 11710
192 Ga0453684_0016361 3300044712 Bacteria 11607
193 Ga0453684_0030409 3300044712 Bacteria 7631
194 Ga0453684_0037473 3300044712 Bacteria 6654
195 Ga0453684_0058113 3300044712 Bacteria 4998
196 Ga0453684_0069604 3300044712 Bacteria 4462
197 Ga0453684_0078821 3300044712 Bacteria 4120
198 Ga0453684_0108651 3300044712 Bacteria 3375
199 Ga0453684_0118182 3300044712 Bacteria 3207
200 Ga0453684_0137398 3300044712 Bacteria 2924
201 Ga0453684_0198431 3300044712 Bacteria 2341
202 Ga0453684_0222809 3300044712 Bacteria 2183
203 Ga0453684_0254402 3300044712 Bacteria 2015
204 Ga0453684_0267277 3300044712 Bacteria 1956
205 Ga0453684_0310436 3300044712 Bacteria 1790
206 Ga0453684_0382999 3300044712 Bacteria 1579
207 Ga0453684_0396048 3300044712 Bacteria 1547
208 Ga0453684_0399342 3300044712 Bacteria 1540
209 Ga0453684_0429358 3300044712 Bacteria 1474
210 Ga0453684_0670587 3300044712 Bacteria 1129
211 Ga0453684_0701973 3300044712 Bacteria 1099
212 Ga0453684_0847999 3300044712 Bacteria 982
213 Ga0453684_0882051 3300044712 Bacteria 959
214 Ga0451576_0000454 3300045051 Bacteria 93047
215 Ga0451576_0003296 3300045051 Bacteria 22421
216 Ga0451576_0003672 3300045051 Bacteria 20828
217 Ga0451576_0038962 3300045051 Bacteria 5030
218 Ga0451576_0046581 3300045051 Bacteria 4565
219 Ga0451576_0075976 3300045051 Bacteria 3496
220 Ga0451576_0179225 3300045051 Bacteria 2212
221 Ga0451576_0181830 3300045051 Bacteria 2195
222 Ga0451576_0226172 3300045051 Bacteria 1954
223 Ga0451576_0259478 3300045051 Bacteria 1816
224 Ga0451576_0542954 3300045051 Bacteria 1221
225 Ga0451576_0569953 3300045051 Bacteria 1189
226 Ga0451576_0574271 3300045051 Bacteria 1185
227 Ga0496110_0051390 3300048913 Bacteria 3622
228 Ga0501041_0347441 3300049577 Bacteria 937
229 Ga0501071_0474578 3300049587 Bacteria 958
230 Ga0501074_0031444 3300049590 Bacteria 3845
231 Ga0501075_0004607 3300049591 Bacteria 9353
232 Ga0501075_0212179 3300049591 Bacteria 1477
233 Ga0501076_0008546 3300049592 Bacteria 7508
234 Ga0501076_0041048 3300049592 Bacteria 3639
235 Ga0501076_0137895 3300049592 Bacteria 1981
236 Ga0501076_0454305 3300049592 Bacteria 1055
237 Ga0501079_0015265 3300049741 Bacteria 5858
238 Ga0501079_0409540 3300049741 Bacteria 1064
239 Ga0501080_0355941 3300049742 Bacteria 1321
240 Ga0501283_012154 3300049779 Bacteria 1291
241 Ga0501045_0242712 3300049824 Bacteria 1341
242 nmdc:mga05p37_177946_c1 3300050507 Bacteria 2590
243 nmdc:mga05p37_195802_c1 3300050507 Unclassified 2451
244 nmdc:mga05p37_263563_c1 3300050507 Bacteria 2061
245 nmdc:mga05p37_43902_c1 3300050507 Bacteria 5500
246 nmdc:mga05p37_630_c1 3300050507 Bacteria 38995
247 nmdc:mga09592_22188_c1 3300050508 Bacteria 5239
248 nmdc:mga09592_24706_c1 3300050508 Bacteria 4969
249 nmdc:mga09592_2712_c1 3300050508 Bacteria 14307
250 nmdc:mga09592_304798_c1 3300050508 Bacteria 1381
251 nmdc:mga09592_61967_c1 3300050508 Unclassified 3164
252 nmdc:mga0qj67_278323_c1 3300050509 Bacteria 1356
253 nmdc:mga0qj67_75105_c1 3300050509 Bacteria 2701
254 nmdc:mga06r32_13060_c1 3300050510 Bacteria 7514
255 nmdc:mga06r32_390335_c1 3300050510 Bacteria 1374
256 nmdc:mga06r32_421821_c1 3300050510 Bacteria 1315
257 nmdc:mga08y16_935580_c1 3300050511 Bacteria 851
258 nmdc:mga0a205_205488_c1 3300050515 Bacteria 1859
259 nmdc:mga0a205_410412_c1 3300050515 Bacteria 1217
260 Ga0501084_0015432 3300054114 Bacteria 6335
261 Ga0501084_0428173 3300054114 Bacteria 1119
262 Ga0453684_0013560
263 SwRhRL2b_contig_3318367
264 JGI25406J46586_10047333
265 Ga0065704_10070229
266 Ga0065704_10097034
267 Ga0065707_10012170
268 Ga0065707_10081970
269 Ga0065707_10096333
270 Ga0065707_10125666
271 Ga0065707_10310619
272 Ga0070690_100173868
273 Ga0070680_100495137
274 Ga0070700_100023351
275 Ga0070694_100086071
276 Ga0070694_100538234
277 Ga0070708_100354124
278 Ga0070662_100916412
279 Ga0070706_100786346
280 Ga0070707_100031010
281 Ga0070707_100300181
282 Ga0070707_100687668
283 Ga0070698_100057414
284 Ga0070698_100464681
285 Ga0070699_100012971
286 Ga0070699_100041439
287 Ga0070699_100300115
288 Ga0070684_100035259
289 Ga0070686_100164922
290 Ga0070696_100138270
291 Ga0068859_100063310
292 Ga0068859_100187380
293 Ga0068861_100084185
294 Ga0068870_10047403
295 Ga0068862_100012311
296 Ga0068862_100022202
297 Ga0068862_100323723
298 Ga0081539_10001449
299 Ga0081539_10006560
300 Ga0075428_100016377
301 Ga0075428_100234101
302 Ga0075428_100644236
303 Ga0075430_100086448
304 Ga0075430_100458322
305 Ga0075430_100645607
306 Ga0075431_100102714
307 Ga0075431_100263960
308 Ga0075431_100282199
309 Ga0075431_100478117
310 Ga0075433_10147804
311 Ga0075429_100016033
312 Ga0075429_100034646
313 Ga0075429_100350789
314 Ga0097620_100063312
315 Ga0097620_100187382
316 Ga0111539_10919576
317 Ga0105245_10660281
318 Ga0114129_10003312
319 Ga0114129_10013397
320 Ga0114129_10142409
321 Ga0114129_10402794
322 Ga0114129_10570940
323 Ga0114129_11388972
324 Ga0105243_10015325
325 Ga0105243_10291790
326 Ga0105237_10383309
327 Ga0105249_10274752
328 Ga0105249_10493615
329 Ga0157375_10766285
330 Ga0157377_10385312
331 Ga0157376_10421937
332 Ga0207653_10019436
333 Ga0207643_10131498
334 Ga0207662_10478955
335 Ga0207646_10397427
336 Ga0207646_10797187
337 Ga0207709_10097544
338 Ga0207709_10258793
339 Ga0207703_10260694
340 Ga0207708_10032533
341 Ga0207641_10801675
342 Ga0207674_10468283
343 Ga0207675_100168119
344 Ga0268265_10043528
345 Ga0265334_10001518
346 Ga0265318_10018408
347 Ga0265323_10017744
348 Ga0265320_10088914
349 Ga0265340_10004331
350 Ga0265331_10047177
351 Ga0265327_10020208
352 Ga0265316_10069261
353 Ga0316575_10003412
354 Ga0316579_10028978
355 Ga0316579_10037826
356 Ga0316579_10043734
357 Ga0316579_10062212
358 Ga0316579_10066381
359 Ga0316579_10107276
360 Ga0316576_10021979
361 Ga0316576_10040256
362 Ga0316576_10050249
363 Ga0316576_10553583
364 Ga0316578_10005808
365 Ga0316578_10034587
366 Ga0316578_10045520
367 Ga0316578_10095496
368 Ga0316578_10149978
369 Ga0316578_10189279
370 Ga0316578_10317253
371 Ga0307516_10062284
372 Ga0307405_10127429
373 Ga0316577_10005159
374 Ga0316577_10013216
375 Ga0316577_10027330
376 Ga0316577_10033275
377 Ga0316577_10056020
378 Ga0316577_10272562
379 Ga0316577_10350175
380 Ga0307410_10037126
381 Ga0307412_10222296
382 Ga0307416_100184260
383 Ga0307415_100146401
384 Ga0307415_100725480
385 Ga0316583_10001773
386 Ga0316583_10018611
387 Ga0316585_10002919
388 Ga0316585_10012462
389 Ga0316585_10031580
390 Ga0316580_10033249
391 Ga0316593_10004240
392 Ga0316592_1038003
393 Ga0316596_1001915
394 Ga0316596_1001972
395 Ga0373939_0126931
396 Ga0316574_0006065
397 Ga0316574_0009352
398 Ga0316582_0009952
399 Ga0316582_0031360
400 Ga0316582_0044950
401 Ga0316582_0085435
402 Ga0316582_0116883
403 Ga0316582_0118635
404 Ga0316582_0268910
405 Ga0316584_0008282
406 Ga0316584_0021750
407 Ga0316584_0030069
408 Ga0316584_0030397
409 Ga0316584_0053251
410 Ga0316584_0074680
411 Ga0316584_0090446
412 Ga0316584_0172463
413 Ga0316584_0193422
414 Ga0316584_0225889
415 Ga0316584_0229820
416 Ga0316584_0291269
417 Ga0316584_0294483
418 Ga0316581_0009518
419 Ga0316581_0037497
420 Ga0400484_11279
421 Ga0400484_19134
422 Ga0400490_43339
423 Ga0400489_83225
424 Ga0451577_0031564
425 Ga0451577_0032567
426 Ga0451577_0098759
427 Ga0451577_0252007
428 Ga0451577_0273970
429 Ga0451577_0384152
430 Ga0451577_0610928
431 Ga0451577_0718710
432 Ga0451577_0805152
433 Ga0451577_0993963
434 Ga0453683_0002222
435 Ga0453683_0010387
436 Ga0453683_0019895
437 Ga0453683_0031846
438 Ga0453683_0093766
439 Ga0453683_0102057
440 Ga0453683_0273831
441 Ga0453684_0000023
442 Ga0453684_0000055
443 Ga0453684_0000157
444 Ga0453684_0000271
445 Ga0453684_0001019
446 Ga0453684_0003105
447 Ga0453684_0003908
448 Ga0453684_0006468
449 Ga0453684_0007761
450 Ga0453684_0008215
451 Ga0453684_0008685
452 Ga0453684_0016147
453 Ga0453684_0016361
454 Ga0453684_0030409
455 Ga0453684_0037473
456 Ga0453684_0058113
457 Ga0453684_0069604
458 Ga0453684_0078821
459 Ga0453684_0108651
460 Ga0453684_0118182
461 Ga0453684_0137398
462 Ga0453684_0198431
463 Ga0453684_0222809
464 Ga0453684_0254402
465 Ga0453684_0267277
466 Ga0453684_0310436
467 Ga0453684_0382999
468 Ga0453684_0396048
469 Ga0453684_0399342
470 Ga0453684_0429358
471 Ga0453684_0670587
472 Ga0453684_0701973
473 Ga0453684_0847999
474 Ga0453684_0882051
475 Ga0451576_0000454
476 Ga0451576_0003296
477 Ga0451576_0003672
478 Ga0451576_0038962
479 Ga0451576_0046581
480 Ga0451576_0075976
481 Ga0451576_0179225
482 Ga0451576_0181830
483 Ga0451576_0226172
484 Ga0451576_0259478
485 Ga0451576_0542954
486 Ga0451576_0569953
487 Ga0451576_0574271
488 Ga0496110_0051390
489 Ga0501041_0347441
490 Ga0501071_0474578
491 Ga0501074_0031444
492 Ga0501075_0004607
493 Ga0501075_0212179
494 Ga0501076_0008546
495 Ga0501076_0041048
496 Ga0501076_0137895
497 Ga0501076_0454305
498 Ga0501079_0015265
499 Ga0501079_0409540
500 Ga0501080_0355941
501 Ga0501283_012154
502 Ga0501045_0242712
503 nmdc:mga05p37_177946_c1
504 nmdc:mga05p37_195802_c1
505 nmdc:mga05p37_263563_c1
506 nmdc:mga05p37_43902_c1
507 nmdc:mga05p37_630_c1
508 nmdc:mga09592_22188_c1
509 nmdc:mga09592_24706_c1
510 nmdc:mga09592_2712_c1
511 nmdc:mga09592_304798_c1
512 nmdc:mga09592_61967_c1
513 nmdc:mga0qj67_278323_c1
514 nmdc:mga0qj67_75105_c1
515 nmdc:mga06r32_13060_c1
516 nmdc:mga06r32_390335_c1
517 nmdc:mga06r32_421821_c1
518 nmdc:mga08y16_935580_c1
519 nmdc:mga0a205_205488_c1
520 nmdc:mga0a205_410412_c1
521 Ga0501084_0015432
522 Ga0501084_0428173

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

55

204

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ws4-assembly1.cif.gz_B crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii 0.9706 1 226
5xu1-assembly1.cif.gz_B structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9696 1 225
5xu1-assembly1.cif.gz_A structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9684 1 225
3tuj-assembly1.cif.gz_C inward facing conformations of the metni methionine abc transporter: dm crystal form 0.9642 3 226
1f3o-assembly1.cif.gz_A-2 crystal structure of mj0796 atp-binding cassette 0.9638 4 230
ID Description Score Start End Superfamily
af_A4I4M8_123_401_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9771 30 226 3.40.50.300
af_Q4DP20_46_317_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9745 1 226 3.40.50.300
af_Q2G0D8_1_227_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9745 1 226 3.40.50.300
af_Q2FUZ1_1_243_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9689 3 231 3.40.50.300
af_Q8T664_36_360_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9687 1 226 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A4P5VZ20-F1-model_v4 ABC transporter ATP-binding protein 0.99 2 222 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A7V9TM51-F1-model_v4 ABC transporter ATP-binding protein 0.9862 22 226 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A7Y1ZUB8-F1-model_v4 ABC transporter ATP-binding protein 0.9792 4 224 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A1I1IEW9-F1-model_v4 deleted 0.978 2 224
AF-A0A1H9L1X7-F1-model_v4 Putative ABC transport system ATP-binding protein 0.9778 1 228 GO:0005524
GO:0005886
GO:0016887
GO:0022857

Map