F370410

General Info

Members Datasets Scaffolds Average Seq Length
261 164 261 234

Family's Representative Sequence

Representative Sequence 3300026121|Ga0207683_10346922|Ga0207683_103469222
Length 256
Sequence MRWPSWIGSADHYIRVVAASEEIPDRALAVYAHPDDPEISAGGTLARWAAAGTEVWVLITTQGDKGTQDPAADPAALAALRVEETAKAAALLGFVGTRHLDHPDGELVDDHELRGSIVQVIREVQPDVVLCPDPTAVFFGESYYNHRDHRVTGWATLDAVAPAAGNPHYFPEHVADGLPVHQVPIVYLSGTLEPNCWVDISDTLERKIDALFCHTSQLPDEAGEWFRDFLRERAEDAGAAASVKYAEPFRKLTFRR

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
3 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
4 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
7 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
8 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
17 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
18 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
20 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
21 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
22 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
23 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
24 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
25 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
26 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
27 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
28 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
29 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
30 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
37 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
38 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
39 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
41 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
42 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
54 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
56 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
57 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
58 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
59 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
60 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
61 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
62 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
63 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
64 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
65 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
66 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
67 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
68 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
69 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
70 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
71 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
72 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
73 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
74 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
75 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
76 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
77 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
78 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
79 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
80 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
81 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
82 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
83 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
84 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
85 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
86 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
87 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
88 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
89 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
90 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
91 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
92 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
93 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
94 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
95 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
96 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
97 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
98 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
99 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
100 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
101 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
102 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
103 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
104 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
105 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
106 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
107 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
108 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
109 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
110 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
111 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
112 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
113 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
114 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
115 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
116 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
117 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
118 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
119 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
120 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
121 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
122 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
123 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
124 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
125 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
126 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
127 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
139 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
140 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
141 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
142 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
143 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
144 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
145 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
146 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
148 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
149 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
150 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
151 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
152 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
153 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
154 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
155 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
156 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
157 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
158 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
159 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
160 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
161 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
162 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
163 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
164 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.62
Metatranscriptomes 0.38
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.38
Nodule 0
Rhizoplane 9.96
Rhizosphere 87.36
Stem 0
Stem Tuber 0
Unclassified 2.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10483478 3300005328 Bacteria 876
2 Ga0070682_100629717 3300005337 Bacteria 851
3 Ga0070675_100099382 3300005354 Bacteria 2449
4 Ga0070674_100703510 3300005356 Bacteria 864
5 Ga0070714_101071372 3300005435 Unclassified 785
6 Ga0070710_10082304 3300005437 Bacteria 1881
7 Ga0070708_100008064 3300005445 Bacteria 8442
8 Ga0070678_100061469 3300005456 Bacteria 2769
9 Ga0070678_100569043 3300005456 Bacteria 1008
10 Ga0070681_10100387 3300005458 Bacteria 2840
11 Ga0070706_100007750 3300005467 Bacteria 10040
12 Ga0070706_100088872 3300005467 Bacteria 2865
13 Ga0070707_100018203 3300005468 Bacteria 6610
14 Ga0070698_100013367 3300005471 Bacteria 8690
15 Ga0070698_100106839 3300005471 Bacteria 2767
16 Ga0070699_100179047 3300005518 Bacteria 1881
17 Ga0070697_100024522 3300005536 Bacteria 4802
18 Ga0068856_100056383 3300005614 Bacteria 3877
19 Ga0068856_100120175 3300005614 Bacteria 2629
20 Ga0068858_100035527 3300005842 Bacteria 4622
21 Ga0068860_100012044 3300005843 Bacteria 8518
22 Ga0081455_10007426 3300005937 Bacteria 11548
23 Ga0081455_10078802 3300005937 Bacteria 2707
24 Ga0081455_10081005 3300005937 Bacteria 2660
25 Ga0081455_10150519 3300005937 Bacteria 1795
26 Ga0081455_10219761 3300005937 Bacteria 1409
27 Ga0081539_10017544 3300005985 Bacteria 5018
28 Ga0070717_10391669 3300006028 Bacteria 1247
29 Ga0075432_10150716 3300006058 Bacteria 893
30 Ga0068871_100698347 3300006358 Bacteria 929
31 Ga0075428_100000031 3300006844 Bacteria 119070
32 Ga0075428_100110141 3300006844 Bacteria 3000
33 Ga0075428_101163936 3300006844 Bacteria 813
34 Ga0075430_100021673 3300006846 Bacteria 5461
35 Ga0075430_100166446 3300006846 Bacteria 1834
36 Ga0075430_100188860 3300006846 Unclassified 1713
37 Ga0075431_100105329 3300006847 Bacteria 2910
38 Ga0075431_100280073 3300006847 Unclassified 1688
39 Ga0075431_100539621 3300006847 Bacteria 1154
40 Ga0075433_10004998 3300006852 Bacteria 10388
41 Ga0075434_100001843 3300006871 Bacteria 18298
42 Ga0075434_100538054 3300006871 Bacteria 1188
43 Ga0075429_100006287 3300006880 Bacteria 10281
44 Ga0075429_100197229 3300006880 Bacteria 1763
45 Ga0075436_100006698 3300006914 Bacteria 7887
46 Ga0075435_100000704 3300007076 Bacteria 20666
47 Ga0111539_10004267 3300009094 Bacteria 18721
48 Ga0111539_10083896 3300009094 Bacteria 3746
49 Ga0105245_10002461 3300009098 Bacteria 16749
50 Ga0105245_10014833 3300009098 Bacteria 6786
51 Ga0105245_10212612 3300009098 Bacteria 1862
52 Ga0105245_10292826 3300009098 Bacteria 1595
53 Ga0105245_10370999 3300009098 Unclassified 1423
54 Ga0105245_10391314 3300009098 Unclassified 1387
55 Ga0105245_10705933 3300009098 Bacteria 1042
56 Ga0114129_10080024 3300009147 Bacteria 4543
57 Ga0114129_10125776 3300009147 Bacteria 3524
58 Ga0114129_10261825 3300009147 Bacteria 2317
59 Ga0114129_10284298 3300009147 Bacteria 2209
60 Ga0105241_10686018 3300009174 Bacteria 934
61 Ga0105248_10408263 3300009177 Bacteria 1529
62 Ga0157375_10470505 3300013308 Bacteria 1422
63 Ga0157380_10844204 3300014326 Unclassified 937
64 Ga0157379_10047022 3300014968 Bacteria 3850
65 Ga0206353_11896437 3300020082 Bacteria 2099
66 Ga0213876_10039784 3300021384 Bacteria 2484
67 Ga0213875_10174783 3300021388 Bacteria 1009
68 Ga0207692_10232080 3300025898 Bacteria 1098
69 Ga0207699_10124399 3300025906 Bacteria 1672
70 Ga0207684_10006998 3300025910 Bacteria 10201
71 Ga0207684_10033225 3300025910 Bacteria 4387
72 Ga0207684_10124592 3300025910 Bacteria 2210
73 Ga0207657_10332396 3300025919 Bacteria 1200
74 Ga0207646_10220083 3300025922 Bacteria 1715
75 Ga0207646_10321671 3300025922 Unclassified 1398
76 Ga0207659_10405503 3300025926 Bacteria 1141
77 Ga0207659_10824401 3300025926 Bacteria 797
78 Ga0207687_10004799 3300025927 Bacteria 8996
79 Ga0207687_10211180 3300025927 Bacteria 1523
80 Ga0207687_10249545 3300025927 Unclassified 1410
81 Ga0207668_10876589 3300025972 Unclassified 798
82 Ga0207703_10037436 3300026035 Bacteria 3865
83 Ga0207675_100263875 3300026118 Bacteria 1670
84 Ga0207683_10346922 3300026121 Bacteria 1362
85 Ga0207683_10828958 3300026121 Bacteria 859
86 Ga0207428_10460112 3300027907 Bacteria 927
87 Ga0207428_10462440 3300027907 Bacteria 924
88 Ga0268264_10009496 3300028381 Bacteria 8055
89 Ga0265327_10000231 3300031251 Bacteria 113114
90 Ga0265327_10003631 3300031251 Bacteria 14515
91 Ga0265327_10016867 3300031251 Bacteria 4613
92 Ga0265327_10033687 3300031251 Bacteria 2851
93 Ga0307408_100223993 3300031548 Bacteria 1536
94 Ga0316575_10041282 3300031665 Bacteria 1825
95 Ga0307410_10038364 3300031852 Bacteria 3137
96 Ga0307406_10750216 3300031901 Bacteria 819
97 Ga0307407_10083525 3300031903 Bacteria 1938
98 Ga0307409_100059613 3300031995 Bacteria 2971
99 Ga0307416_100005054 3300032002 Bacteria 8041
100 Ga0307414_10306307 3300032004 Bacteria 1346
101 Ga0307411_10057859 3300032005 Bacteria 2563
102 Ga0307415_100170346 3300032126 Bacteria 1697
103 Ga0373945_0031102 3300035116 Bacteria 1885
104 Ga0373945_0160876 3300035116 Bacteria 915
105 Ga0373943_0009397 3300035170 Bacteria 4382
106 Ga0373943_0081057 3300035170 Bacteria 1664
107 Ga0373942_0057716 3300035207 Bacteria 1105
108 Ga0316574_0134752 3300035398 Bacteria 1590
109 Ga0373924_0122068 3300035410 Bacteria 1131
110 Ga0373927_0002445 3300035695 Bacteria 13549
111 Ga0373933_0306898 3300035724 Unclassified 1028
112 Ga0373947_0039656 3300035725 Bacteria 2803
113 Ga0373937_0125126 3300036401 Bacteria 2398
114 Ga0373925_0020479 3300037068 Bacteria 4815
115 Ga0436364_1149844 3300037853 Bacteria 1207
116 Ga0395901_0387374 3300038443 Bacteria 1438
117 Ga0436365_0457037 3300039437 Bacteria 751
118 Ga0436365_1510845 3300039437 Bacteria 2550
119 Ga0436365_1764401 3300039437 Bacteria 1753
120 Ga0436360_1054821 3300039438 Bacteria 5339
121 Ga0436360_1257249 3300039438 Bacteria 1400
122 Ga0436361_0945315 3300039447 Bacteria 2683
123 Ga0436362_0143567 3300039453 Bacteria 9981
124 Ga0436362_0544710 3300039453 Unclassified 1475
125 Ga0451793_0882445 3300041452 Unclassified 1125
126 Ga0466969_0082431 3300044656 Bacteria 1533
127 Ga0466961_0220298 3300044693 Unclassified 1170
128 Ga0466968_0150957 3300044735 Bacteria 1068
129 Ga0495592_0335519 3300046454 Bacteria 973
130 Ga0495629_0081658 3300046459 Bacteria 2256
131 Ga0495629_0147771 3300046459 Unclassified 1634
132 Ga0495629_0391007 3300046459 Bacteria 946
133 Ga0495651_0095838 3300046462 Bacteria 2218
134 Ga0495651_0164402 3300046462 Bacteria 1587
135 Ga0495653_0053427 3300046463 Bacteria 3091
136 Ga0495653_0171159 3300046463 Bacteria 1499
137 Ga0495653_0254531 3300046463 Unclassified 1164
138 Ga0495639_0055821 3300046475 Bacteria 1802
139 Ga0495608_0089956 3300046511 Bacteria 1986
140 Ga0495608_0157145 3300046511 Bacteria 1447
141 Ga0495628_0009267 3300046516 Bacteria 8412
142 Ga0495628_0014314 3300046516 Bacteria 6653
143 Ga0495628_0054016 3300046516 Bacteria 3168
144 Ga0495628_0236772 3300046516 Bacteria 1367
145 Ga0495630_0073767 3300046517 Bacteria 2570
146 Ga0495630_0254497 3300046517 Bacteria 1341
147 Ga0495630_0323320 3300046517 Unclassified 1179
148 Ga0495640_0007581 3300046533 Bacteria 8524
149 Ga0495586_0108130 3300046535 Bacteria 1547
150 Ga0495645_0098282 3300046543 Bacteria 2084
151 Ga0495667_0027855 3300046559 Bacteria 3805
152 Ga0495667_0073606 3300046559 Bacteria 2225
153 Ga0495667_0207346 3300046559 Bacteria 1253
154 Ga0495634_0008258 3300046642 Bacteria 7764
155 Ga0495634_0373136 3300046642 Bacteria 851
156 Ga0495635_0330772 3300046663 Bacteria 1019
157 Ga0495635_0337902 3300046663 Bacteria 1006
158 Ga0495657_0031480 3300046675 Bacteria 3708
159 Ga0495657_0053380 3300046675 Bacteria 2705
160 Ga0495657_0280705 3300046675 Bacteria 997
161 Ga0495599_0243191 3300046678 Bacteria 1097
162 Ga0495599_0276715 3300046678 Bacteria 1017
163 Ga0495647_0105192 3300046681 Bacteria 1172
164 Ga0495647_0149197 3300046681 Unclassified 1001
165 Ga0495658_0146717 3300046683 Unclassified 1446
166 Ga0495658_0179563 3300046683 Unclassified 1313
167 Ga0495658_0292024 3300046683 Bacteria 1030
168 Ga0495613_0003106 3300046689 Bacteria 12426
169 Ga0495613_0150067 3300046689 Bacteria 1663
170 Ga0495613_0260886 3300046689 Bacteria 1207
171 Ga0495624_0188122 3300046690 Bacteria 1256
172 Ga0495589_0116707 3300046794 Bacteria 1286
173 Ga0495600_0282119 3300046809 Bacteria 1051
174 Ga0495581_0094063 3300047315 Bacteria 1740
175 Ga0495604_0074836 3300047317 Bacteria 2551
176 Ga0495604_0225696 3300047317 Bacteria 1287
177 Ga0495674_0225696 3300047319 Unclassified 1547
178 Ga0495674_0514901 3300047319 Bacteria 956
179 Ga0495680_0180091 3300047322 Bacteria 1526
180 Ga0495680_0194435 3300047322 Bacteria 1458
181 Ga0495680_0301871 3300047322 Unclassified 1124
182 Ga0495684_0006773 3300047471 Bacteria 8896
183 Ga0495684_0161507 3300047471 Bacteria 1671
184 Ga0495614_0021070 3300048089 Bacteria 2818
185 Ga0496100_0654672 3300048903 Bacteria 818
186 Ga0496102_0234152 3300048905 Bacteria 1731
187 Ga0496103_0323888 3300048906 Bacteria 991
188 Ga0496104_0101780 3300048907 Bacteria 2751
189 Ga0496104_0158131 3300048907 Bacteria 2174
190 Ga0496104_0478116 3300048907 Bacteria 1157
191 Ga0496105_0117088 3300048908 Bacteria 2197
192 Ga0496106_0341467 3300048909 Bacteria 1203
193 Ga0496108_0036173 3300048911 Bacteria 4107
194 Ga0496108_0517175 3300048911 Bacteria 1042
195 Ga0496108_0580043 3300048911 Bacteria 978
196 Ga0496108_0761653 3300048911 Bacteria 837
197 Ga0496108_1046668 3300048911 Bacteria 695
198 Ga0496109_0003555 3300048912 Bacteria 13010
199 Ga0496109_0016882 3300048912 Bacteria 6388
200 Ga0496110_0022771 3300048913 Bacteria 5323
201 Ga0496110_0362326 3300048913 Bacteria 1321
202 Ga0496110_0824260 3300048913 Bacteria 833
203 Ga0496111_0002778 3300048914 Bacteria 10659
204 Ga0496111_0111345 3300048914 Bacteria 2017
205 Ga0496111_0148297 3300048914 Unclassified 1739
206 Ga0496111_0565830 3300048914 Bacteria 834
207 Ga0496112_0002805 3300048915 Bacteria 14144
208 Ga0496114_0061052 3300048917 Bacteria 3152
209 Ga0496115_0162786 3300048918 Bacteria 1844
210 Ga0501031_0293460 3300049568 Unclassified 1054
211 Ga0501033_0166624 3300049570 Bacteria 1584
212 Ga0501036_0389572 3300049572 Unclassified 1163
213 Ga0501037_0202251 3300049573 Bacteria 1403
214 Ga0501038_0301539 3300049574 Bacteria 1257
215 Ga0501039_0262002 3300049575 Bacteria 1359
216 Ga0501040_0009297 3300049576 Bacteria 6403
217 Ga0501042_0135536 3300049578 Bacteria 1775
218 Ga0501043_0282525 3300049579 Bacteria 1272
219 Ga0501046_0131981 3300049580 Bacteria 1894
220 Ga0501046_0163070 3300049580 Bacteria 1676
221 Ga0501047_0012828 3300049581 Bacteria 7940
222 Ga0501070_0144661 3300049586 Bacteria 1962
223 Ga0501070_0175195 3300049586 Bacteria 1766
224 Ga0501070_0579498 3300049586 Bacteria 896
225 Ga0501071_0189540 3300049587 Bacteria 1542
226 Ga0501072_0246819 3300049588 Bacteria 1422
227 Ga0501074_0189918 3300049590 Bacteria 1465
228 Ga0501076_0104257 3300049592 Bacteria 2288
229 Ga0501076_0377687 3300049592 Unclassified 1165
230 Ga0501079_0089700 3300049741 Bacteria 2381
231 Ga0501080_0145363 3300049742 Bacteria 2192
232 Ga0501081_0056817 3300049743 Bacteria 2705
233 Ga0501081_0231856 3300049743 Bacteria 1345
234 Ga0501044_0016059 3300049823 Bacteria 8050
235 Ga0501045_0038894 3300049824 Bacteria 3461
236 Ga0501045_0084183 3300049824 Bacteria 2346
237 nmdc:mga05p37_167213_c1 3300050507 Bacteria 2683
238 nmdc:mga05p37_488279_c1 3300050507 Unclassified 1417
239 nmdc:mga09592_11139_c1 3300050508 Bacteria 7316
240 nmdc:mga0qj67_123159_c1 3300050509 Bacteria 2098
241 nmdc:mga06r32_1753_c1 3300050510 Bacteria 15330
242 nmdc:mga06r32_22189_c1 3300050510 Bacteria 5865
243 nmdc:mga06r32_791013_c1 3300050510 Unclassified 910
244 nmdc:mga08y16_92866_c1 3300050511 Bacteria 3145
245 nmdc:mga0n895_14427_c1 3300050512 Bacteria 7176
246 nmdc:mga0n895_199479_c1 3300050512 Bacteria 2032
247 nmdc:mga0rr50_1194_c1 3300050513 Bacteria 14102
248 nmdc:mga08x19_17458_c1 3300050514 Bacteria 4390
249 nmdc:mga0a205_2870_c1 3300050515 Bacteria 15241
250 Ga0495601_0036755 3300053077 Bacteria 3060
251 Ga0495601_0401417 3300053077 Unclassified 889
252 Ga0495612_0088639 3300053078 Bacteria 1307
253 Ga0495595_0020064 3300053084 Bacteria 2906
254 Ga0495595_0059594 3300053084 Bacteria 1785
255 Ga0495619_0019148 3300053085 Bacteria 4350
256 Ga0495619_0063832 3300053085 Bacteria 2454
257 Ga0495619_0211685 3300053085 Bacteria 1342
258 Ga0500568_0000015 3300053139 Bacteria 219403
259 Ga0501084_0000040 3300054114 Bacteria 104329
260 Ga0501082_0040339 3300060353 Bacteria 4028
261 Ga0530510_0325356 3300061734 Bacteria 1153

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049823 Ga0501044_0016059 Ga0501044_0016059_17_628 154
2 3300049573 Ga0501037_0202251 Ga0501037_0202251_609_1295 176
3 3300049574 Ga0501038_0301539 Ga0501038_0301539_103_789 176
4 3300049572 Ga0501036_0389572 Ga0501036_0389572_363_1049 177
5 3300049586 Ga0501070_0144661 Ga0501070_0144661_612_1298 177
6 3300049590 Ga0501074_0189918 Ga0501074_0189918_273_959 177
7 3300025927 Ga0207687_10211180 Ga0207687_102111803 181
8 3300035116 Ga0373945_0160876 Ga0373945_0160876_226_819 181
9 3300009098 Ga0105245_10292826 Ga0105245_102928262 187
10 3300049570 Ga0501033_0166624 Ga0501033_0166624_703_1524 189
11 3300049742 Ga0501080_0145363 Ga0501080_0145363_149_970 189
12 3300039437 Ga0436365_1764401 Ga0436365_1764401_40_666 191
13 3300048911 Ga0496108_1046668 Ga0496108_1046668_38_673 191
14 3300025926 Ga0207659_10405503 Ga0207659_104055032 196
15 3300025972 Ga0207668_10876589 Ga0207668_108765891 199
16 3300009098 Ga0105245_10705933 Ga0105245_107059331 202
17 3300009098 Ga0105245_10212612 Ga0105245_102126123 207
18 3300048907 Ga0496104_0478116 Ga0496104_0478116_14_697 207
19 3300035410 Ga0373924_0122068 Ga0373924_0122068_60_737 208
20 3300036401 Ga0373937_0125126 Ga0373937_0125126_1431_2108 208
21 3300046459 Ga0495629_0081658 Ga0495629_0081658_456_1133 208
22 3300046463 Ga0495653_0171159 Ga0495653_0171159_384_1061 208
23 3300046511 Ga0495608_0089956 Ga0495608_0089956_550_1227 208
24 3300046516 Ga0495628_0236772 Ga0495628_0236772_94_771 208
25 3300046559 Ga0495667_0073606 Ga0495667_0073606_1058_1735 208
26 3300046663 Ga0495635_0337902 Ga0495635_0337902_152_829 208
27 3300046675 Ga0495657_0280705 Ga0495657_0280705_271_948 208
28 3300046689 Ga0495613_0150067 Ga0495613_0150067_22_699 208
29 3300047317 Ga0495604_0225696 Ga0495604_0225696_76_753 208
30 3300053084 Ga0495595_0059594 Ga0495595_0059594_354_1031 208
31 3300053085 Ga0495619_0063832 Ga0495619_0063832_1391_2068 208
32 3300013308 Ga0157375_10470505 Ga0157375_104705052 209
33 3300046459 Ga0495629_0391007 Ga0495629_0391007_163_882 209
34 3300048912 Ga0496109_0016882 Ga0496109_0016882_4506_5198 210
35 3300006846 Ga0075430_100166446 Ga0075430_1001664461 212
36 3300049586 Ga0501070_0579498 Ga0501070_0579498_32_739 212
37 3300025927 Ga0207687_10249545 Ga0207687_102495453 213
38 3300025926 Ga0207659_10824401 Ga0207659_108244011 214
39 3300009098 Ga0105245_10391314 Ga0105245_103913142 215
40 3300006358 Ga0068871_100698347 Ga0068871_1006983471 216
41 3300009098 Ga0105245_10014833 Ga0105245_100148339 216
42 3300009174 Ga0105241_10686018 Ga0105241_106860182 216
43 3300014326 Ga0157380_10844204 Ga0157380_108442041 216
44 3300039437 Ga0436365_0457037 Ga0436365_0457037_10_711 216
45 3300046517 Ga0495630_0073767 Ga0495630_0073767_273_974 216
46 3300046642 Ga0495634_0008258 Ga0495634_0008258_1132_1833 216
47 3300046683 Ga0495658_0179563 Ga0495658_0179563_122_823 216
48 3300046689 Ga0495613_0003106 Ga0495613_0003106_8316_9017 216
49 3300005435 Ga0070714_101071372 Ga0070714_1010713721 217
50 3300005614 Ga0068856_100056383 Ga0068856_1000563833 217
51 3300005937 Ga0081455_10150519 Ga0081455_101505193 217
52 3300035724 Ga0373933_0306898 Ga0373933_0306898_213_926 217
53 3300039438 Ga0436360_1257249 Ga0436360_1257249_163_864 217
54 3300044656 Ga0466969_0082431 Ga0466969_0082431_36_740 217
55 3300044693 Ga0466961_0220298 Ga0466961_0220298_390_1094 217
56 3300044735 Ga0466968_0150957 Ga0466968_0150957_264_968 217
57 3300046459 Ga0495629_0147771 Ga0495629_0147771_893_1606 217
58 3300048907 Ga0496104_0158131 Ga0496104_0158131_1419_2132 217
59 3300048911 Ga0496108_0036173 Ga0496108_0036173_3172_3885 217
60 3300048912 Ga0496109_0003555 Ga0496109_0003555_2845_3558 217
61 3300048914 Ga0496111_0148297 Ga0496111_0148297_471_1184 217
62 3300048915 Ga0496112_0002805 Ga0496112_0002805_5015_5728 217
63 3300005337 Ga0070682_100629717 Ga0070682_1006297171 218
64 3300005445 Ga0070708_100008064 Ga0070708_1000080645 218
65 3300005843 Ga0068860_100012044 Ga0068860_1000120445 218
66 3300005937 Ga0081455_10007426 Ga0081455_1000742612 218
67 3300005937 Ga0081455_10081005 Ga0081455_100810052 218
68 3300005937 Ga0081455_10219761 Ga0081455_102197613 218
69 3300006844 Ga0075428_101163936 Ga0075428_1011639361 218
70 3300006846 Ga0075430_100021673 Ga0075430_1000216737 218
71 3300006880 Ga0075429_100197229 Ga0075429_1001972292 218
72 3300009094 Ga0111539_10004267 Ga0111539_100042676 218
73 3300009147 Ga0114129_10284298 Ga0114129_102842982 218
74 3300020082 Ga0206353_11896437 Ga0206353_118964373 218
75 3300021384 Ga0213876_10039784 Ga0213876_100397842 218
76 3300021388 Ga0213875_10174783 Ga0213875_101747831 218
77 3300027907 Ga0207428_10460112 Ga0207428_104601122 218
78 3300028381 Ga0268264_10009496 Ga0268264_100094963 218
79 3300031548 Ga0307408_100223993 Ga0307408_1002239932 218
80 3300031852 Ga0307410_10038364 Ga0307410_100383642 218
81 3300031901 Ga0307406_10750216 Ga0307406_107502161 218
82 3300031903 Ga0307407_10083525 Ga0307407_100835252 218
83 3300031995 Ga0307409_100059613 Ga0307409_1000596133 218
84 3300032002 Ga0307416_100005054 Ga0307416_1000050546 218
85 3300032004 Ga0307414_10306307 Ga0307414_103063072 218
86 3300032005 Ga0307411_10057859 Ga0307411_100578593 218
87 3300032126 Ga0307415_100170346 Ga0307415_1001703463 218
88 3300037853 Ga0436364_1149844 Ga0436364_1149844_195_899 218
89 3300039437 Ga0436365_1510845 Ga0436365_1510845_1128_1835 218
90 3300047319 Ga0495674_0514901 Ga0495674_0514901_103_807 218
91 3300048913 Ga0496110_0362326 Ga0496110_0362326_606_1310 218
92 3300049568 Ga0501031_0293460 Ga0501031_0293460_303_1007 218
93 3300049575 Ga0501039_0262002 Ga0501039_0262002_395_1099 218
94 3300049576 Ga0501040_0009297 Ga0501040_0009297_4964_5668 218
95 3300049578 Ga0501042_0135536 Ga0501042_0135536_146_850 218
96 3300049580 Ga0501046_0131981 Ga0501046_0131981_213_917 218
97 3300049580 Ga0501046_0163070 Ga0501046_0163070_92_796 218
98 3300049587 Ga0501071_0189540 Ga0501071_0189540_638_1342 218
99 3300049588 Ga0501072_0246819 Ga0501072_0246819_150_869 218
100 3300049592 Ga0501076_0104257 Ga0501076_0104257_305_1009 218
101 3300049592 Ga0501076_0377687 Ga0501076_0377687_19_723 218
102 3300049741 Ga0501079_0089700 Ga0501079_0089700_1261_1965 218
103 3300049743 Ga0501081_0056817 Ga0501081_0056817_1649_2353 218
104 3300049743 Ga0501081_0231856 Ga0501081_0231856_599_1321 218
105 3300049824 Ga0501045_0038894 Ga0501045_0038894_776_1480 218
106 3300049824 Ga0501045_0084183 Ga0501045_0084183_1323_2027 218
107 3300050509 nmdc:mga0qj67_123159_c1 nmdc:mga0qj67_123159_c1_357_1064 218
108 3300050510 nmdc:mga06r32_1753_c1 nmdc:mga06r32_1753_c1_4589_5296 218
109 3300050511 nmdc:mga08y16_92866_c1 nmdc:mga08y16_92866_c1_377_1084 218
110 3300053139 Ga0500568_0000015 Ga0500568_0000015_27827_28558 218
111 3300054114 Ga0501084_0000040 Ga0501084_0000040_60802_61521 218
112 3300060353 Ga0501082_0040339 Ga0501082_0040339_270_974 218
113 3300061734 Ga0530510_0325356 Ga0530510_0325356_183_905 218
114 3300005354 Ga0070675_100099382 Ga0070675_1000993823 219
115 3300005356 Ga0070674_100703510 Ga0070674_1007035101 219
116 3300005437 Ga0070710_10082304 Ga0070710_100823042 219
117 3300005456 Ga0070678_100061469 Ga0070678_1000614692 219
118 3300005458 Ga0070681_10100387 Ga0070681_101003874 219
119 3300005467 Ga0070706_100007750 Ga0070706_1000077507 219
120 3300005467 Ga0070706_100088872 Ga0070706_1000888723 219
121 3300005468 Ga0070707_100018203 Ga0070707_1000182036 219
122 3300005471 Ga0070698_100013367 Ga0070698_1000133674 219
123 3300005471 Ga0070698_100106839 Ga0070698_1001068391 219
124 3300005518 Ga0070699_100179047 Ga0070699_1001790473 219
125 3300005536 Ga0070697_100024522 Ga0070697_1000245223 219
126 3300005614 Ga0068856_100120175 Ga0068856_1001201753 219
127 3300005842 Ga0068858_100035527 Ga0068858_1000355273 219
128 3300005937 Ga0081455_10078802 Ga0081455_100788023 219
129 3300005985 Ga0081539_10017544 Ga0081539_100175446 219
130 3300006028 Ga0070717_10391669 Ga0070717_103916691 219
131 3300006058 Ga0075432_10150716 Ga0075432_101507161 219
132 3300006844 Ga0075428_100000031 Ga0075428_10000003186 219
133 3300006844 Ga0075428_100110141 Ga0075428_1001101414 219
134 3300006846 Ga0075430_100188860 Ga0075430_1001888603 219
135 3300006847 Ga0075431_100105329 Ga0075431_1001053294 219
136 3300006847 Ga0075431_100280073 Ga0075431_1002800733 219
137 3300006847 Ga0075431_100539621 Ga0075431_1005396212 219
138 3300006852 Ga0075433_10004998 Ga0075433_100049981 219
139 3300006871 Ga0075434_100001843 Ga0075434_10000184315 219
140 3300006871 Ga0075434_100538054 Ga0075434_1005380542 219
141 3300006880 Ga0075429_100006287 Ga0075429_1000062879 219
142 3300006914 Ga0075436_100006698 Ga0075436_1000066987 219
143 3300007076 Ga0075435_100000704 Ga0075435_1000007044 219
144 3300009094 Ga0111539_10083896 Ga0111539_100838964 219
145 3300009098 Ga0105245_10002461 Ga0105245_100024612 219
146 3300009147 Ga0114129_10080024 Ga0114129_100800245 219
147 3300009147 Ga0114129_10125776 Ga0114129_101257764 219
148 3300009147 Ga0114129_10261825 Ga0114129_102618253 219
149 3300014968 Ga0157379_10047022 Ga0157379_100470224 219
150 3300025898 Ga0207692_10232080 Ga0207692_102320802 219
151 3300025906 Ga0207699_10124399 Ga0207699_101243992 219
152 3300025910 Ga0207684_10006998 Ga0207684_100069987 219
153 3300025910 Ga0207684_10033225 Ga0207684_100332256 219
154 3300025910 Ga0207684_10124592 Ga0207684_101245924 219
155 3300025919 Ga0207657_10332396 Ga0207657_103323961 219
156 3300025922 Ga0207646_10220083 Ga0207646_102200833 219
157 3300025922 Ga0207646_10321671 Ga0207646_103216711 219
158 3300025927 Ga0207687_10004799 Ga0207687_1000479910 219
159 3300026035 Ga0207703_10037436 Ga0207703_100374362 219
160 3300026118 Ga0207675_100263875 Ga0207675_1002638752 219
161 3300026121 Ga0207683_10828958 Ga0207683_108289582 219
162 3300027907 Ga0207428_10462440 Ga0207428_104624401 219
163 3300031251 Ga0265327_10000231 Ga0265327_1000023112 219
164 3300031251 Ga0265327_10003631 Ga0265327_100036318 219
165 3300031665 Ga0316575_10041282 Ga0316575_100412822 219
166 3300035116 Ga0373945_0031102 Ga0373945_0031102_303_1022 219
167 3300035170 Ga0373943_0009397 Ga0373943_0009397_1538_2248 219
168 3300035170 Ga0373943_0081057 Ga0373943_0081057_791_1510 219
169 3300035207 Ga0373942_0057716 Ga0373942_0057716_285_992 219
170 3300035398 Ga0316574_0134752 Ga0316574_0134752_240_959 219
171 3300035695 Ga0373927_0002445 Ga0373927_0002445_10405_11115 219
172 3300035725 Ga0373947_0039656 Ga0373947_0039656_859_1569 219
173 3300037068 Ga0373925_0020479 Ga0373925_0020479_669_1379 219
174 3300038443 Ga0395901_0387374 Ga0395901_0387374_444_1163 219
175 3300039438 Ga0436360_1054821 Ga0436360_1054821_4389_5138 219
176 3300039447 Ga0436361_0945315 Ga0436361_0945315_440_1150 219
177 3300039453 Ga0436362_0143567 Ga0436362_0143567_9109_9819 219
178 3300039453 Ga0436362_0544710 Ga0436362_0544710_642_1355 219
179 3300046454 Ga0495592_0335519 Ga0495592_0335519_185_904 219
180 3300046462 Ga0495651_0095838 Ga0495651_0095838_14_733 219
181 3300046463 Ga0495653_0053427 Ga0495653_0053427_694_1413 219
182 3300046463 Ga0495653_0254531 Ga0495653_0254531_269_988 219
183 3300046475 Ga0495639_0055821 Ga0495639_0055821_87_800 219
184 3300046511 Ga0495608_0157145 Ga0495608_0157145_515_1234 219
185 3300046516 Ga0495628_0009267 Ga0495628_0009267_3901_4620 219
186 3300046516 Ga0495628_0014314 Ga0495628_0014314_2725_3444 219
187 3300046516 Ga0495628_0054016 Ga0495628_0054016_981_1691 219
188 3300046517 Ga0495630_0254497 Ga0495630_0254497_67_786 219
189 3300046517 Ga0495630_0323320 Ga0495630_0323320_412_1131 219
190 3300046533 Ga0495640_0007581 Ga0495640_0007581_3542_4261 219
191 3300046535 Ga0495586_0108130 Ga0495586_0108130_792_1511 219
192 3300046543 Ga0495645_0098282 Ga0495645_0098282_115_834 219
193 3300046559 Ga0495667_0027855 Ga0495667_0027855_198_917 219
194 3300046559 Ga0495667_0207346 Ga0495667_0207346_507_1226 219
195 3300046642 Ga0495634_0373136 Ga0495634_0373136_80_790 219
196 3300046663 Ga0495635_0330772 Ga0495635_0330772_186_905 219
197 3300046675 Ga0495657_0031480 Ga0495657_0031480_2509_3228 219
198 3300046675 Ga0495657_0053380 Ga0495657_0053380_52_771 219
199 3300046678 Ga0495599_0243191 Ga0495599_0243191_351_1070 219
200 3300046678 Ga0495599_0276715 Ga0495599_0276715_184_903 219
201 3300046681 Ga0495647_0105192 Ga0495647_0105192_17_736 219
202 3300046681 Ga0495647_0149197 Ga0495647_0149197_92_805 219
203 3300046683 Ga0495658_0146717 Ga0495658_0146717_484_1203 219
204 3300046683 Ga0495658_0292024 Ga0495658_0292024_69_788 219
205 3300046689 Ga0495613_0260886 Ga0495613_0260886_41_760 219
206 3300046690 Ga0495624_0188122 Ga0495624_0188122_343_1062 219
207 3300046809 Ga0495600_0282119 Ga0495600_0282119_170_889 219
208 3300047315 Ga0495581_0094063 Ga0495581_0094063_374_1093 219
209 3300047317 Ga0495604_0074836 Ga0495604_0074836_1577_2296 219
210 3300047322 Ga0495680_0180091 Ga0495680_0180091_101_820 219
211 3300047322 Ga0495680_0194435 Ga0495680_0194435_538_1257 219
212 3300047471 Ga0495684_0006773 Ga0495684_0006773_4676_5395 219
213 3300047471 Ga0495684_0161507 Ga0495684_0161507_395_1105 219
214 3300048089 Ga0495614_0021070 Ga0495614_0021070_1779_2492 219
215 3300048905 Ga0496102_0234152 Ga0496102_0234152_42_761 219
216 3300048906 Ga0496103_0323888 Ga0496103_0323888_201_920 219
217 3300048907 Ga0496104_0101780 Ga0496104_0101780_220_939 219
218 3300048908 Ga0496105_0117088 Ga0496105_0117088_324_1043 219
219 3300048909 Ga0496106_0341467 Ga0496106_0341467_30_749 219
220 3300048911 Ga0496108_0761653 Ga0496108_0761653_99_818 219
221 3300048913 Ga0496110_0022771 Ga0496110_0022771_1315_2034 219
222 3300048914 Ga0496111_0002778 Ga0496111_0002778_16_735 219
223 3300048914 Ga0496111_0111345 Ga0496111_0111345_1147_1866 219
224 3300048917 Ga0496114_0061052 Ga0496114_0061052_1895_2614 219
225 3300048918 Ga0496115_0162786 Ga0496115_0162786_834_1553 219
226 3300050507 nmdc:mga05p37_167213_c1 nmdc:mga05p37_167213_c1_1143_1862 219
227 3300050507 nmdc:mga05p37_488279_c1 nmdc:mga05p37_488279_c1_641_1360 219
228 3300050508 nmdc:mga09592_11139_c1 nmdc:mga09592_11139_c1_4389_5108 219
229 3300050510 nmdc:mga06r32_22189_c1 nmdc:mga06r32_22189_c1_4821_5540 219
230 3300050510 nmdc:mga06r32_791013_c1 nmdc:mga06r32_791013_c1_121_840 219
231 3300050512 nmdc:mga0n895_14427_c1 nmdc:mga0n895_14427_c1_2196_2915 219
232 3300050512 nmdc:mga0n895_199479_c1 nmdc:mga0n895_199479_c1_1281_2000 219
233 3300050513 nmdc:mga0rr50_1194_c1 nmdc:mga0rr50_1194_c1_4600_5319 219
234 3300050514 nmdc:mga08x19_17458_c1 nmdc:mga08x19_17458_c1_2105_2824 219
235 3300050515 nmdc:mga0a205_2870_c1 nmdc:mga0a205_2870_c1_4394_5113 219
236 3300053077 Ga0495601_0036755 Ga0495601_0036755_143_862 219
237 3300053077 Ga0495601_0401417 Ga0495601_0401417_95_805 219
238 3300053078 Ga0495612_0088639 Ga0495612_0088639_60_779 219
239 3300053084 Ga0495595_0020064 Ga0495595_0020064_334_1053 219
240 3300053085 Ga0495619_0019148 Ga0495619_0019148_3515_4234 219
241 3300053085 Ga0495619_0211685 Ga0495619_0211685_559_1278 219
242 3300005328 Ga0070676_10483478 Ga0070676_104834781 220
243 3300005456 Ga0070678_100569043 Ga0070678_1005690431 220
244 3300009098 Ga0105245_10370999 Ga0105245_103709992 220
245 3300009177 Ga0105248_10408263 Ga0105248_104082632 220
246 3300026121 Ga0207683_10346922 Ga0207683_103469222 220
247 3300031251 Ga0265327_10016867 Ga0265327_100168676 220
248 3300031251 Ga0265327_10033687 Ga0265327_100336873 220
249 3300041452 Ga0451793_0882445 Ga0451793_0882445_319_1050 220
250 3300046462 Ga0495651_0164402 Ga0495651_0164402_634_1365 220
251 3300046794 Ga0495589_0116707 Ga0495589_0116707_430_1158 220
252 3300047319 Ga0495674_0225696 Ga0495674_0225696_466_1191 220
253 3300047322 Ga0495680_0301871 Ga0495680_0301871_214_945 220
254 3300048903 Ga0496100_0654672 Ga0496100_0654672_33_755 220
255 3300048911 Ga0496108_0517175 Ga0496108_0517175_254_976 220
256 3300048911 Ga0496108_0580043 Ga0496108_0580043_176_946 220
257 3300048913 Ga0496110_0824260 Ga0496110_0824260_75_797 220
258 3300048914 Ga0496111_0565830 Ga0496111_0565830_57_779 220
259 3300049579 Ga0501043_0282525 Ga0501043_0282525_332_1054 220
260 3300049581 Ga0501047_0012828 Ga0501047_0012828_5568_6290 220
261 3300049586 Ga0501070_0175195 Ga0501070_0175195_331_1053 220

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02585

PIG-L

GlcNAc-PI de-N-acetylase

28

160

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5bmo-assembly1.cif.gz_A lnmx protein, a putative glcnac-pi de-n-acetylase from streptomyces atroolivaceus 0.8854 1 216
5bmo-assembly1.cif.gz_A lnmx protein, a putative glcnac-pi de-n-acetylase from streptomyces atroolivaceus 0.8663 1 216
8bgo-assembly1.cif.gz_C n,n-diacetylchitobiose deacetylase from pyrococcus chitonophagus with substrate n,n-diacetylchitobiose 0.8626 8 217
3we7-assembly1.cif.gz_A crystal structure of diacetylchitobiose deacetylase from pyrococcus horikoshii 0.8553 8 217
4xm0-assembly1.cif.gz_C n,n'-diacetylchitobiose deacetylase (semet derivative) from pyrococcus furiosus in the absence of cadmium 0.8503 6 216
ID Description Score Start End Superfamily
5bmoC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.878 1 216 3.40.50.10320
5bmoC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.8592 1 216 3.40.50.10320
3we7B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.8453 8 217 3.40.50.10320
2ixdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.8368 11 213 3.40.50.10320
1q74D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.8229 10 179 3.40.50.10320
ID Description Score Start End GO Terms
AF-A0A7C4XRG5-F1-model_v4 PIG-L family deacetylase 0.9637 83 220 GO:0016137
AF-A0A832AMB0-F1-model_v4 PIG-L family deacetylase 0.9428 2 220 GO:0016137
GO:0016811
AF-A0A832AMB0-F1-model_v4 PIG-L family deacetylase 0.9344 2 220 GO:0016137
GO:0016811
AF-A0A257STT5-F1-model_v4 deleted 0.9337 96 220
AF-A0A849J7I4-F1-model_v4 PIG-L family deacetylase 0.9316 1 217 GO:0016137
GO:0016811

Feature Viewer

pLDDT pTM Quality
92.18 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map