F370351

General Info

Members Datasets Scaffolds Average Seq Length
261 141 522 141

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_10414144|Ga0163163_104141442
Length 169
Sequence MNQLINAPHPVAIAPGTDYINQWRFLMSEQNNLEANKALMRRWFEEVWNQGRADAIPELFSEDGIAHGLSEDVNAPMKGPAGFRPFHAQFREAFPNIEVVVEEMIAEGDLVASRCSVRGKHLGHSLGFAATNEPVEFTGMAITRIRDGKIVEAWNNFDFMKMYKQLGAI

Samples

Sample ID Description Type Environment
1 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
2 3300001432 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
111 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
114 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
115 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
116 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
117 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
118 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
119 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
120 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
121 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
122 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
123 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
124 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
125 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
126 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
127 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
128 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
129 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
130 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
132 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
133 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
134 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
135 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
136 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
137 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
138 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
139 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
140 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
141 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.53
Rhizosphere 98.08
Stem 0
Stem Tuber 0
Unclassified 46.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163163_10414144 3300014325 Unclassified 1406
2 JGI24034J14986_101185 3300001432 Bacteria 1518
3 JGI24748J21848_1000006 3300002074 Bacteria 212677
4 JGI24034J26672_10000002 3300002239 Bacteria 925353
5 JGI24742J22300_10106782 3300002244 Unclassified 545
6 Ga0070690_100029014 3300005330 Bacteria 3429
7 Ga0070690_100509125 3300005330 Unclassified 902
8 Ga0070690_100718893 3300005330 Bacteria 768
9 Ga0070690_100974833 3300005330 Bacteria 667
10 Ga0070670_100444686 3300005331 Bacteria 1148
11 Ga0068869_100233983 3300005334 Unclassified 1461
12 Ga0070666_10552498 3300005335 Unclassified 838
13 Ga0070680_100907881 3300005336 Unclassified 760
14 Ga0070689_100641632 3300005340 Unclassified 923
15 Ga0070689_101137250 3300005340 Bacteria 699
16 Ga0070687_100507307 3300005343 Unclassified 813
17 Ga0070692_10663793 3300005345 Unclassified 697
18 Ga0070668_100022696 3300005347 Unclassified 4745
19 Ga0070675_100108951 3300005354 Bacteria 2340
20 Ga0070673_100105372 3300005364 Unclassified 2329
21 Ga0070688_100457926 3300005365 Unclassified 955
22 Ga0070703_10004152 3300005406 Bacteria 4082
23 Ga0070709_11289115 3300005434 Bacteria 589
24 Ga0070701_10548578 3300005438 Unclassified 758
25 Ga0070705_100292122 3300005440 Bacteria 1164
26 Ga0070705_100532172 3300005440 Bacteria 898
27 Ga0070705_100834095 3300005440 Unclassified 736
28 Ga0070705_100903921 3300005440 Unclassified 710
29 Ga0070700_100022772 3300005441 Bacteria 3659
30 Ga0070700_100130301 3300005441 Bacteria 1696
31 Ga0070700_101060187 3300005441 Unclassified 670
32 Ga0070694_100000316 3300005444 Bacteria 25983
33 Ga0070694_100211177 3300005444 Bacteria 1451
34 Ga0070694_100268997 3300005444 Bacteria 1295
35 Ga0070694_100994403 3300005444 Unclassified 696
36 Ga0070708_100201327 3300005445 Unclassified 1864
37 Ga0070708_100391312 3300005445 Bacteria 1311
38 Ga0070708_101421641 3300005445 Bacteria 647
39 Ga0070662_101165505 3300005457 Unclassified 662
40 Ga0068867_100208331 3300005459 Bacteria 1569
41 Ga0068867_100774784 3300005459 Unclassified 853
42 Ga0068867_101800760 3300005459 Unclassified 576
43 Ga0070706_100028906 3300005467 Bacteria 5106
44 Ga0070707_100035987 3300005468 Bacteria 4724
45 Ga0070707_100054669 3300005468 Unclassified 3828
46 Ga0070698_100000352 3300005471 Bacteria 47541
47 Ga0070698_100023999 3300005471 Bacteria 6368
48 Ga0070698_100025937 3300005471 Bacteria 6105
49 Ga0070698_100066342 3300005471 Unclassified 3633
50 Ga0070698_100372606 3300005471 Unclassified 1360
51 Ga0070698_100416160 3300005471 Bacteria 1278
52 Ga0070698_101435660 3300005471 Unclassified 641
53 Ga0070699_100090170 3300005518 Unclassified 2679
54 Ga0070699_100317002 3300005518 Bacteria 1401
55 Ga0070699_100556442 3300005518 Unclassified 1044
56 Ga0070699_101272539 3300005518 Unclassified 675
57 Ga0070697_100000074 3300005536 Bacteria 79648
58 Ga0070697_101138048 3300005536 Unclassified 695
59 Ga0070686_100001250 3300005544 Bacteria 14438
60 Ga0070686_100006819 3300005544 Bacteria 6359
61 Ga0070686_100837539 3300005544 Unclassified 744
62 Ga0070695_100046515 3300005545 Bacteria 2769
63 Ga0070695_100108463 3300005545 Unclassified 1880
64 Ga0070695_100393522 3300005545 Unclassified 1049
65 Ga0070695_100593302 3300005545 Unclassified 869
66 Ga0070696_100491221 3300005546 Unclassified 975
67 Ga0070696_100826104 3300005546 Bacteria 764
68 Ga0070696_101063697 3300005546 Unclassified 679
69 Ga0070693_100033705 3300005547 Bacteria 2829
70 Ga0070693_100549059 3300005547 Unclassified 827
71 Ga0070704_101243939 3300005549 Unclassified 680
72 Ga0068857_101426361 3300005577 Unclassified 674
73 Ga0068854_100755931 3300005578 Unclassified 844
74 Ga0068854_101443150 3300005578 Bacteria 623
75 Ga0070702_100181709 3300005615 Bacteria 1377
76 Ga0070702_100565117 3300005615 Unclassified 847
77 Ga0068852_100653132 3300005616 Bacteria 1059
78 Ga0068859_100082033 3300005617 Unclassified 3267
79 Ga0068859_100199206 3300005617 Bacteria 2087
80 Ga0068859_100367846 3300005617 Unclassified 1533
81 Ga0068859_101332816 3300005617 Unclassified 791
82 Ga0068864_100278739 3300005618 Unclassified 1560
83 Ga0068864_100540212 3300005618 Bacteria 1125
84 Ga0068861_100220274 3300005719 Unclassified 1603
85 Ga0068861_100221589 3300005719 Bacteria 1599
86 Ga0068858_100000566 3300005842 Bacteria 38612
87 Ga0068858_100153754 3300005842 Unclassified 2164
88 Ga0068858_100398317 3300005842 Bacteria 1322
89 Ga0068858_100518292 3300005842 Bacteria 1153
90 Ga0068860_100503622 3300005843 Bacteria 1209
91 Ga0068860_100695364 3300005843 Bacteria 1026
92 Ga0068860_100869188 3300005843 Bacteria 917
93 Ga0081455_10171799 3300005937 Bacteria 1650
94 Ga0070715_10000010 3300006163 Bacteria 184687
95 Ga0070715_10584019 3300006163 Bacteria 652
96 Ga0070716_100271837 3300006173 Unclassified 1165
97 Ga0068871_100961404 3300006358 Unclassified 794
98 Ga0075428_100577890 3300006844 Unclassified 1201
99 Ga0075428_100732573 3300006844 Bacteria 1052
100 Ga0075433_10248665 3300006852 Bacteria 1578
101 Ga0075433_10479028 3300006852 Unclassified 1096
102 Ga0075433_10694063 3300006852 Unclassified 892
103 Ga0075434_100028990 3300006871 Bacteria 5443
104 Ga0075434_100418488 3300006871 Unclassified 1361
105 Ga0075434_101245448 3300006871 Unclassified 755
106 Ga0075429_100224681 3300006880 Unclassified 1645
107 Ga0068865_100057256 3300006881 Unclassified 2719
108 Ga0068865_101256569 3300006881 Unclassified 657
109 Ga0075436_100000018 3300006914 Bacteria 139195
110 Ga0097620_100082027 3300006931 Unclassified 3267
111 Ga0097620_100199195 3300006931 Bacteria 2087
112 Ga0097620_100367899 3300006931 Unclassified 1533
113 Ga0097620_101332521 3300006931 Unclassified 791
114 Ga0075435_100016777 3300007076 Bacteria 5526
115 Ga0075435_100318940 3300007076 Unclassified 1330
116 Ga0075435_100934131 3300007076 Bacteria 757
117 Ga0099795_10307931 3300007788 Unclassified 698
118 Ga0111539_12918369 3300009094 Unclassified 553
119 Ga0105245_10140974 3300009098 Bacteria 2270
120 Ga0105245_11417307 3300009098 Bacteria 745
121 Ga0105245_11701049 3300009098 Bacteria 683
122 Ga0105247_10000001 3300009101 Bacteria 739726
123 Ga0114129_10059109 3300009147 Bacteria 5360
124 Ga0114129_10187682 3300009147 Bacteria 2809
125 Ga0105243_10000024 3300009148 Bacteria 197391
126 Ga0105243_10002873 3300009148 Bacteria 14277
127 Ga0105243_10178162 3300009148 Unclassified 1846
128 Ga0105243_10459216 3300009148 Bacteria 1197
129 Ga0105243_10482838 3300009148 Unclassified 1170
130 Ga0105243_10572117 3300009148 Bacteria 1083
131 Ga0105241_11141135 3300009174 Unclassified 736
132 Ga0105242_10000081 3300009176 Bacteria 65802
133 Ga0105242_10000502 3300009176 Bacteria 30880
134 Ga0105242_10001371 3300009176 Bacteria 19204
135 Ga0105242_10145079 3300009176 Bacteria 2064
136 Ga0105242_12477399 3300009176 Unclassified 567
137 Ga0105248_10453318 3300009177 Bacteria 1445
138 Ga0105248_12321348 3300009177 Unclassified 611
139 Ga0105249_10000139 3300009553 Bacteria 94384
140 Ga0105249_10246688 3300009553 Bacteria 1768
141 Ga0105249_10444903 3300009553 Unclassified 1334
142 Ga0105239_10257342 3300010375 Unclassified 1961
143 Ga0105246_11952382 3300011119 Unclassified 565
144 Ga0157378_10000001 3300013297 Bacteria 352632
145 Ga0157378_10022090 3300013297 Bacteria 5598
146 Ga0157378_10102183 3300013297 Bacteria 2618
147 Ga0157378_10169440 3300013297 Unclassified 2047
148 Ga0157378_10231382 3300013297 Bacteria 1761
149 Ga0157378_10360278 3300013297 Bacteria 1423
150 Ga0157378_10537012 3300013297 Bacteria 1173
151 Ga0163162_10000045 3300013306 Bacteria 127819
152 Ga0163162_10060826 3300013306 Bacteria 3813
153 Ga0163162_10088560 3300013306 Bacteria 3175
154 Ga0163162_10476325 3300013306 Unclassified 1380
155 Ga0163162_10789901 3300013306 Unclassified 1067
156 Ga0157372_11055696 3300013307 Bacteria 940
157 Ga0157375_10001076 3300013308 Bacteria 23672
158 Ga0157375_10440151 3300013308 Unclassified 1469
159 Ga0157380_10258147 3300014326 Bacteria 1581
160 Ga0157380_10327740 3300014326 Bacteria 1423
161 Ga0157380_11176872 3300014326 Unclassified 809
162 Ga0157376_10133061 3300014969 Unclassified 2222
163 Ga0163161_10310622 3300017792 Unclassified 1244
164 Ga0163161_10319594 3300017792 Bacteria 1227
165 Ga0163161_10594979 3300017792 Unclassified 911
166 Ga0207672_1000333 3300025223 Bacteria 6266
167 Ga0207653_10000303 3300025885 Bacteria 28140
168 Ga0207710_10000003 3300025900 Bacteria 1071597
169 Ga0207685_10000006 3300025905 Bacteria 284255
170 Ga0207699_10476993 3300025906 Bacteria 898
171 Ga0207684_10110134 3300025910 Unclassified 2357
172 Ga0207662_10580311 3300025918 Unclassified 779
173 Ga0207662_10747776 3300025918 Unclassified 687
174 Ga0207646_10047237 3300025922 Unclassified 3861
175 Ga0207646_10189043 3300025922 Bacteria 1860
176 Ga0207646_11129351 3300025922 Unclassified 689
177 Ga0207646_11733143 3300025922 Unclassified 536
178 Ga0207681_11158756 3300025923 Bacteria 649
179 Ga0207681_11185294 3300025923 Unclassified 642
180 Ga0207659_10181668 3300025926 Bacteria 1667
181 Ga0207687_10410089 3300025927 Unclassified 1116
182 Ga0207644_10003142 3300025931 Bacteria 10638
183 Ga0207706_10166333 3300025933 Bacteria 1938
184 Ga0207686_10000011 3300025934 Bacteria 216046
185 Ga0207686_10000012 3300025934 Bacteria 209763
186 Ga0207686_10016265 3300025934 Unclassified 4173
187 Ga0207686_10374455 3300025934 Unclassified 1078
188 Ga0207709_10000042 3300025935 Bacteria 254145
189 Ga0207709_10002713 3300025935 Bacteria 10939
190 Ga0207670_11423362 3300025936 Unclassified 589
191 Ga0207704_10083909 3300025938 Unclassified 2069
192 Ga0207665_10710164 3300025939 Unclassified 791
193 Ga0207711_10348165 3300025941 Bacteria 1372
194 Ga0207711_10351335 3300025941 Unclassified 1365
195 Ga0207711_11468396 3300025941 Unclassified 625
196 Ga0207689_10042388 3300025942 Bacteria 3765
197 Ga0207651_10465858 3300025960 Unclassified 1087
198 Ga0207651_10908133 3300025960 Unclassified 784
199 Ga0207651_11352580 3300025960 Unclassified 641
200 Ga0207712_10000139 3300025961 Bacteria 76388
201 Ga0207640_11409020 3300025981 Unclassified 624
202 Ga0207703_10000545 3300026035 Bacteria 38626
203 Ga0207703_10088364 3300026035 Unclassified 2601
204 Ga0207703_10313387 3300026035 Bacteria 1435
205 Ga0207703_10319030 3300026035 Bacteria 1422
206 Ga0207703_10787427 3300026035 Unclassified 907
207 Ga0207708_10005654 3300026075 Bacteria 9232
208 Ga0207708_10580914 3300026075 Unclassified 947
209 Ga0207708_11212355 3300026075 Unclassified 660
210 Ga0207648_10173567 3300026089 Unclassified 1906
211 Ga0207648_10278999 3300026089 Bacteria 1494
212 Ga0207648_10779690 3300026089 Bacteria 889
213 Ga0207676_11694374 3300026095 Unclassified 630
214 Ga0207674_11314444 3300026116 Unclassified 692
215 Ga0207675_100002100 3300026118 Bacteria 19774
216 Ga0207675_100323352 3300026118 Bacteria 1506
217 Ga0207698_10201387 3300026142 Bacteria 1783
218 Ga0210000_1017313 3300027462 Bacteria 1092
219 Ga0207428_10400584 3300027907 Unclassified 1005
220 Ga0268264_10224307 3300028381 Bacteria 1732
221 Ga0268264_10466452 3300028381 Bacteria 1226
222 Ga0268264_10914959 3300028381 Bacteria 881
223 Ga0395898_0127143 3300037466 Bacteria 2442
224 Ga0395905_0181336 3300037471 Bacteria 1977
225 Ga0395901_0619922 3300038443 Bacteria 1089
226 Ga0436365_0258095 3300039437 Bacteria 5125
227 Ga0439464_0085791 3300042439 Unclassified 944
228 Ga0451577_0580155 3300042876 Bacteria 1018
229 Ga0453683_0175888 3300044673 Bacteria 1356
230 Ga0453684_0842896 3300044712 Bacteria 986
231 Ga0451576_0293296 3300045051 Bacteria 1700
232 Ga0495618_0546613 3300046514 Unclassified 694
233 Ga0495635_0458105 3300046663 Unclassified 843
234 Ga0495669_0232433 3300046684 Bacteria 885
235 Ga0495674_0387473 3300047319 Bacteria 1130
236 Ga0495677_0367713 3300047445 Unclassified 568
237 Ga0496100_0193449 3300048903 Unclassified 1478
238 Ga0496104_0802524 3300048907 Bacteria 847
239 Ga0496106_0000719 3300048909 Bacteria 23847
240 Ga0496114_0348266 3300048917 Bacteria 1310
241 Ga0501067_0216616 3300049583 Bacteria 1066
242 Ga0501077_0719043 3300049593 Unclassified 642
243 Ga0501035_1337574 3300049822 Unclassified 551
244 Ga0501045_0875199 3300049824 Unclassified 660
245 nmdc:mga05p37_189903_c1 3300050507 Unclassified 2495
246 nmdc:mga09592_180842_c1 3300050508 Unclassified 1824
247 nmdc:mga09592_260585_c1 3300050508 Bacteria 1503
248 nmdc:mga08y16_178750_c1 3300050511 Unclassified 2204
249 nmdc:mga0n895_1602419_c1 3300050512 Unclassified 615
250 nmdc:mga0n895_1861_c1 3300050512 Bacteria 16112
251 nmdc:mga0n895_384007_c1 3300050512 Unclassified 1421
252 nmdc:mga0rr50_1020_c1 3300050513 Bacteria 15195
253 nmdc:mga0rr50_354723_c1 3300050513 Bacteria 1234
254 nmdc:mga08x19_12_c1 3300050514 Bacteria 395395
255 nmdc:mga0a205_1104368_c1 3300050515 Unclassified 640
256 nmdc:mga0a205_1302288_c1 3300050515 Unclassified 574
257 nmdc:mga0a205_854559_c1 3300050515 Unclassified 757
258 Ga0495655_0004776 3300053083 Bacteria 2346
259 Ga0501084_0429518 3300054114 Bacteria 1117
260 Ga0501082_0234236 3300060353 Bacteria 1598
261 Ga0501082_1698287 3300060353 Unclassified 551
262 Ga0163163_10414144
263 JGI24034J14986_101185
264 JGI24748J21848_1000006
265 JGI24034J26672_10000002
266 JGI24742J22300_10106782
267 Ga0070690_100029014
268 Ga0070690_100509125
269 Ga0070690_100718893
270 Ga0070690_100974833
271 Ga0070670_100444686
272 Ga0068869_100233983
273 Ga0070666_10552498
274 Ga0070680_100907881
275 Ga0070689_100641632
276 Ga0070689_101137250
277 Ga0070687_100507307
278 Ga0070692_10663793
279 Ga0070668_100022696
280 Ga0070675_100108951
281 Ga0070673_100105372
282 Ga0070688_100457926
283 Ga0070703_10004152
284 Ga0070709_11289115
285 Ga0070701_10548578
286 Ga0070705_100292122
287 Ga0070705_100532172
288 Ga0070705_100834095
289 Ga0070705_100903921
290 Ga0070700_100022772
291 Ga0070700_100130301
292 Ga0070700_101060187
293 Ga0070694_100000316
294 Ga0070694_100211177
295 Ga0070694_100268997
296 Ga0070694_100994403
297 Ga0070708_100201327
298 Ga0070708_100391312
299 Ga0070708_101421641
300 Ga0070662_101165505
301 Ga0068867_100208331
302 Ga0068867_100774784
303 Ga0068867_101800760
304 Ga0070706_100028906
305 Ga0070707_100035987
306 Ga0070707_100054669
307 Ga0070698_100000352
308 Ga0070698_100023999
309 Ga0070698_100025937
310 Ga0070698_100066342
311 Ga0070698_100372606
312 Ga0070698_100416160
313 Ga0070698_101435660
314 Ga0070699_100090170
315 Ga0070699_100317002
316 Ga0070699_100556442
317 Ga0070699_101272539
318 Ga0070697_100000074
319 Ga0070697_101138048
320 Ga0070686_100001250
321 Ga0070686_100006819
322 Ga0070686_100837539
323 Ga0070695_100046515
324 Ga0070695_100108463
325 Ga0070695_100393522
326 Ga0070695_100593302
327 Ga0070696_100491221
328 Ga0070696_100826104
329 Ga0070696_101063697
330 Ga0070693_100033705
331 Ga0070693_100549059
332 Ga0070704_101243939
333 Ga0068857_101426361
334 Ga0068854_100755931
335 Ga0068854_101443150
336 Ga0070702_100181709
337 Ga0070702_100565117
338 Ga0068852_100653132
339 Ga0068859_100082033
340 Ga0068859_100199206
341 Ga0068859_100367846
342 Ga0068859_101332816
343 Ga0068864_100278739
344 Ga0068864_100540212
345 Ga0068861_100220274
346 Ga0068861_100221589
347 Ga0068858_100000566
348 Ga0068858_100153754
349 Ga0068858_100398317
350 Ga0068858_100518292
351 Ga0068860_100503622
352 Ga0068860_100695364
353 Ga0068860_100869188
354 Ga0081455_10171799
355 Ga0070715_10000010
356 Ga0070715_10584019
357 Ga0070716_100271837
358 Ga0068871_100961404
359 Ga0075428_100577890
360 Ga0075428_100732573
361 Ga0075433_10248665
362 Ga0075433_10479028
363 Ga0075433_10694063
364 Ga0075434_100028990
365 Ga0075434_100418488
366 Ga0075434_101245448
367 Ga0075429_100224681
368 Ga0068865_100057256
369 Ga0068865_101256569
370 Ga0075436_100000018
371 Ga0097620_100082027
372 Ga0097620_100199195
373 Ga0097620_100367899
374 Ga0097620_101332521
375 Ga0075435_100016777
376 Ga0075435_100318940
377 Ga0075435_100934131
378 Ga0099795_10307931
379 Ga0111539_12918369
380 Ga0105245_10140974
381 Ga0105245_11417307
382 Ga0105245_11701049
383 Ga0105247_10000001
384 Ga0114129_10059109
385 Ga0114129_10187682
386 Ga0105243_10000024
387 Ga0105243_10002873
388 Ga0105243_10178162
389 Ga0105243_10459216
390 Ga0105243_10482838
391 Ga0105243_10572117
392 Ga0105241_11141135
393 Ga0105242_10000081
394 Ga0105242_10000502
395 Ga0105242_10001371
396 Ga0105242_10145079
397 Ga0105242_12477399
398 Ga0105248_10453318
399 Ga0105248_12321348
400 Ga0105249_10000139
401 Ga0105249_10246688
402 Ga0105249_10444903
403 Ga0105239_10257342
404 Ga0105246_11952382
405 Ga0157378_10000001
406 Ga0157378_10022090
407 Ga0157378_10102183
408 Ga0157378_10169440
409 Ga0157378_10231382
410 Ga0157378_10360278
411 Ga0157378_10537012
412 Ga0163162_10000045
413 Ga0163162_10060826
414 Ga0163162_10088560
415 Ga0163162_10476325
416 Ga0163162_10789901
417 Ga0157372_11055696
418 Ga0157375_10001076
419 Ga0157375_10440151
420 Ga0157380_10258147
421 Ga0157380_10327740
422 Ga0157380_11176872
423 Ga0157376_10133061
424 Ga0163161_10310622
425 Ga0163161_10319594
426 Ga0163161_10594979
427 Ga0207672_1000333
428 Ga0207653_10000303
429 Ga0207710_10000003
430 Ga0207685_10000006
431 Ga0207699_10476993
432 Ga0207684_10110134
433 Ga0207662_10580311
434 Ga0207662_10747776
435 Ga0207646_10047237
436 Ga0207646_10189043
437 Ga0207646_11129351
438 Ga0207646_11733143
439 Ga0207681_11158756
440 Ga0207681_11185294
441 Ga0207659_10181668
442 Ga0207687_10410089
443 Ga0207644_10003142
444 Ga0207706_10166333
445 Ga0207686_10000011
446 Ga0207686_10000012
447 Ga0207686_10016265
448 Ga0207686_10374455
449 Ga0207709_10000042
450 Ga0207709_10002713
451 Ga0207670_11423362
452 Ga0207704_10083909
453 Ga0207665_10710164
454 Ga0207711_10348165
455 Ga0207711_10351335
456 Ga0207711_11468396
457 Ga0207689_10042388
458 Ga0207651_10465858
459 Ga0207651_10908133
460 Ga0207651_11352580
461 Ga0207712_10000139
462 Ga0207640_11409020
463 Ga0207703_10000545
464 Ga0207703_10088364
465 Ga0207703_10313387
466 Ga0207703_10319030
467 Ga0207703_10787427
468 Ga0207708_10005654
469 Ga0207708_10580914
470 Ga0207708_11212355
471 Ga0207648_10173567
472 Ga0207648_10278999
473 Ga0207648_10779690
474 Ga0207676_11694374
475 Ga0207674_11314444
476 Ga0207675_100002100
477 Ga0207675_100323352
478 Ga0207698_10201387
479 Ga0210000_1017313
480 Ga0207428_10400584
481 Ga0268264_10224307
482 Ga0268264_10466452
483 Ga0268264_10914959
484 Ga0395898_0127143
485 Ga0395905_0181336
486 Ga0395901_0619922
487 Ga0436365_0258095
488 Ga0439464_0085791
489 Ga0451577_0580155
490 Ga0453683_0175888
491 Ga0453684_0842896
492 Ga0451576_0293296
493 Ga0495618_0546613
494 Ga0495635_0458105
495 Ga0495669_0232433
496 Ga0495674_0387473
497 Ga0495677_0367713
498 Ga0496100_0193449
499 Ga0496104_0802524
500 Ga0496106_0000719
501 Ga0496114_0348266
502 Ga0501067_0216616
503 Ga0501077_0719043
504 Ga0501035_1337574
505 Ga0501045_0875199
506 nmdc:mga05p37_189903_c1
507 nmdc:mga09592_180842_c1
508 nmdc:mga09592_260585_c1
509 nmdc:mga08y16_178750_c1
510 nmdc:mga0n895_1602419_c1
511 nmdc:mga0n895_1861_c1
512 nmdc:mga0n895_384007_c1
513 nmdc:mga0rr50_1020_c1
514 nmdc:mga0rr50_354723_c1
515 nmdc:mga08x19_12_c1
516 nmdc:mga0a205_1104368_c1
517 nmdc:mga0a205_1302288_c1
518 nmdc:mga0a205_854559_c1
519 Ga0495655_0004776
520 Ga0501084_0429518
521 Ga0501082_0234236
522 Ga0501082_1698287

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07366

SnoaL

SnoaL-like polyketide cyclase

38

166

0.98

PF12680

SnoaL_2

SnoaL-like domain

40

153

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3kkg-assembly1.cif.gz_A-2 crystal structure of putative snoal-like polyketide cyclase (yp_509242.1) from jannaschia sp. ccs1 at 1.40 a resolution 0.9035 7 143
3k0z-assembly1.cif.gz_B crystal structure of putative polyketide cyclase (np_977253.1) from bacillus cereus atcc 10987 at 1.91 a resolution 0.8965 18 141
4hvn-assembly1.cif.gz_B crystal structure of hypothetical protein with ketosteroid isomerase-like protein fold from catenulispora acidiphila dsm 44928 in complex with trimethylamine. 0.8826 13 141
4lgq-assembly2.cif.gz_D crystal structure of a putative polyketide cyclase (cv_0247) from chromobacterium violaceum atcc 12472 at 2.72 a resolution 0.8804 11 141
5x7l-assembly1.cif.gz_A structure of tsrd from streptomyces laurentii 0.8754 8 143
ID Description Score Start End Superfamily
af_P96818_5_130_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9005 9 139 3.10.450.50
3k0zB00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8962 16 141 3.10.450.50
2geyD00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8861 7 143 3.10.450.50
4lgqD00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8835 11 141 3.10.450.50
3ov4D00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8806 7 135 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A2V8LW03-F1-model_v4 Ester cyclase 0.9866 7 143 GO:0030638
AF-A0A2V8LFS8-F1-model_v4 Ester cyclase 0.9835 1 143 GO:0030638
AF-A0A3D1AW98-F1-model_v4 Ester cyclase 0.9784 13 140 GO:0030638
AF-A0A2V8LFS8-F1-model_v4 Ester cyclase 0.9767 1 143 GO:0030638
AF-A0A4Q5NJM4-F1-model_v4 Ester cyclase 0.9755 10 141 GO:0030638

Map