F370343

General Info

Members Datasets Scaffolds Average Seq Length
261 188 522 117

Family's Representative Sequence

Representative Sequence 3300013297|Ga0157378_11690069|Ga0157378_116900691
Length 127
Sequence MDYLLLLYSNEEGWTSMTPEQQQXGYEALKKAGAYKTSRLLHPVAAATTVRVTDGKTQVLDGPYIESKEQLGGFFLIQAPDLDSALAWAARCPGASHGTIEVRPIWPVDAKQTGSAPNGVRVAVKAS

Samples

Sample ID Description Type Environment
1 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
71 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
108 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
109 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
110 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
111 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
112 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
113 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
114 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
115 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
116 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
117 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
118 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
119 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
120 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
121 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
122 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
123 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
124 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
125 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
126 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
127 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
128 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
129 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
130 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
131 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
132 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
133 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
134 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
135 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
136 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
137 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
138 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
139 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
140 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
141 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
142 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
143 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
144 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
145 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
146 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
147 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
155 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
156 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
157 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
158 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
159 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
160 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
161 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
162 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
163 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
165 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
166 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
167 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
168 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
169 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
170 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
171 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
172 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
173 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
174 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
175 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
176 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
177 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
178 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
179 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
180 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
181 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
182 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
183 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
184 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
185 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
186 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
187 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
188 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.81
Nodule 0
Rhizoplane 3.07
Rhizosphere 83.52
Stem 0
Stem Tuber 0
Unclassified 9.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157378_11690069 3300013297 Bacteria 680
2 Ga0070658_10082784 3300005327 Bacteria 2637
3 Ga0070683_100125802 3300005329 Bacteria 2423
4 Ga0070690_100044822 3300005330 Bacteria 2808
5 Ga0070670_100323133 3300005331 Bacteria 1352
6 Ga0070682_100059332 3300005337 Bacteria 2416
7 Ga0070691_10976609 3300005341 Bacteria 527
8 Ga0070661_100002684 3300005344 Bacteria 12177
9 Ga0070661_101378024 3300005344 Bacteria 593
10 Ga0070692_10045975 3300005345 Bacteria 2254
11 Ga0070692_10233279 3300005345 Bacteria 1093
12 Ga0070674_100150857 3300005356 Bacteria 1754
13 Ga0070673_100403825 3300005364 Bacteria 1222
14 Ga0070673_101501508 3300005364 Bacteria 635
15 Ga0070667_100001811 3300005367 Bacteria 19035
16 Ga0070667_100508171 3300005367 Unclassified 1105
17 Ga0070667_101767523 3300005367 Bacteria 582
18 Ga0070709_10058915 3300005434 Bacteria 2437
19 Ga0070714_100805009 3300005435 Bacteria 910
20 Ga0070713_100062384 3300005436 Bacteria 3122
21 Ga0070713_101213087 3300005436 Bacteria 730
22 Ga0070710_10050669 3300005437 Bacteria 2328
23 Ga0070701_10241980 3300005438 Bacteria 1086
24 Ga0070711_100038670 3300005439 Bacteria 3209
25 Ga0070711_100422934 3300005439 Bacteria 1086
26 Ga0070663_100026202 3300005455 Bacteria 3946
27 Ga0070678_101067861 3300005456 Bacteria 744
28 Ga0070681_10620255 3300005458 Bacteria 996
29 Ga0068867_100014388 3300005459 Bacteria 5606
30 Ga0070685_10251957 3300005466 Bacteria 1170
31 Ga0070706_100017652 3300005467 Bacteria 6585
32 Ga0070706_100036286 3300005467 Bacteria 4552
33 Ga0070707_101104117 3300005468 Bacteria 759
34 Ga0070707_101164411 3300005468 Unclassified 737
35 Ga0070698_100007867 3300005471 Bacteria 11541
36 Ga0070698_100036276 3300005471 Bacteria 5094
37 Ga0070699_100320312 3300005518 Bacteria 1393
38 Ga0070679_100288706 3300005530 Bacteria 1592
39 Ga0070697_100541173 3300005536 Bacteria 1021
40 Ga0070672_100421752 3300005543 Bacteria 1146
41 Ga0070672_101370568 3300005543 Bacteria 632
42 Ga0070696_100589774 3300005546 Unclassified 895
43 Ga0070665_100000214 3300005548 Bacteria 99943
44 Ga0070665_100007465 3300005548 Bacteria 11117
45 Ga0070665_100144239 3300005548 Bacteria 2385
46 Ga0070665_100457747 3300005548 Bacteria 1286
47 Ga0070665_100818202 3300005548 Bacteria 944
48 Ga0070665_101423473 3300005548 Bacteria 702
49 Ga0068855_100160591 3300005563 Bacteria 2551
50 Ga0070664_101809903 3300005564 Bacteria 579
51 Ga0068857_100355770 3300005577 Bacteria 1357
52 Ga0068857_100898236 3300005577 Bacteria 849
53 Ga0068856_100014584 3300005614 Bacteria 7593
54 Ga0070702_100081684 3300005615 Bacteria 1937
55 Ga0068852_101821066 3300005616 Bacteria 631
56 Ga0068859_100865004 3300005617 Bacteria 990
57 Ga0068860_100072632 3300005843 Bacteria 3270
58 Ga0068862_100112183 3300005844 Bacteria 2394
59 Ga0068862_101675159 3300005844 Bacteria 644
60 Ga0081455_10180171 3300005937 Bacteria 1601
61 Ga0081455_10314122 3300005937 Bacteria 1119
62 Ga0070717_10212745 3300006028 Unclassified 1697
63 Ga0070717_10396680 3300006028 Bacteria 1239
64 Ga0070716_100042539 3300006173 Bacteria 2536
65 Ga0070712_100010667 3300006175 Bacteria 5802
66 Ga0070712_101193477 3300006175 Bacteria 662
67 Ga0075369_10463853 3300006186 Bacteria 600
68 Ga0075428_100054238 3300006844 Bacteria 4393
69 Ga0075428_100113345 3300006844 Bacteria 2954
70 Ga0075428_102072355 3300006844 Unclassified 589
71 Ga0075430_101024207 3300006846 Unclassified 680
72 Ga0075431_100232034 3300006847 Bacteria 1880
73 Ga0075433_10677363 3300006852 Unclassified 904
74 Ga0075434_100071786 3300006871 Bacteria 3454
75 Ga0075429_100010405 3300006880 Bacteria 8049
76 Ga0068865_100534660 3300006881 Bacteria 982
77 Ga0075436_101563021 3300006914 Unclassified 501
78 Ga0097620_100864989 3300006931 Bacteria 990
79 Ga0099795_10150185 3300007788 Bacteria 954
80 Ga0105240_10594091 3300009093 Bacteria 1220
81 Ga0111539_10030893 3300009094 Bacteria 6510
82 Ga0111539_10440283 3300009094 Unclassified 1517
83 Ga0111539_10813342 3300009094 Bacteria 1087
84 Ga0105247_11067056 3300009101 Bacteria 635
85 Ga0114129_10156614 3300009147 Bacteria 3114
86 Ga0105237_12242371 3300009545 Bacteria 556
87 Ga0105238_12313148 3300009551 Unclassified 573
88 Ga0099796_10089859 3300010159 Bacteria 1140
89 Ga0105239_12872021 3300010375 Unclassified 562
90 Ga0157370_10465452 3300013104 Bacteria 1162
91 Ga0157369_10032290 3300013105 Bacteria 5760
92 Ga0157378_11017877 3300013297 Bacteria 863
93 Ga0157375_12132104 3300013308 Unclassified 667
94 Ga0157375_12470003 3300013308 Bacteria 620
95 Ga0163163_10020287 3300014325 Bacteria 6256
96 Ga0157379_11751235 3300014968 Bacteria 610
97 Ga0207426_1012508 3300025302 Bacteria 3183
98 Ga0207656_10623795 3300025321 Bacteria 551
99 Ga0207692_10060733 3300025898 Bacteria 1956
100 Ga0207647_10013627 3300025904 Bacteria 5629
101 Ga0207685_10129362 3300025905 Bacteria 1119
102 Ga0207699_10156140 3300025906 Bacteria 1514
103 Ga0207705_10000977 3300025909 Bacteria 23344
104 Ga0207684_10044690 3300025910 Bacteria 3757
105 Ga0207684_10199194 3300025910 Bacteria 1727
106 Ga0207684_11536187 3300025910 Bacteria 541
107 Ga0207671_10363284 3300025914 Bacteria 1149
108 Ga0207663_10583015 3300025916 Bacteria 877
109 Ga0207663_11254740 3300025916 Bacteria 597
110 Ga0207657_10024157 3300025919 Bacteria 5641
111 Ga0207649_10018008 3300025920 Bacteria 4009
112 Ga0207646_11258413 3300025922 Bacteria 647
113 Ga0207681_10060595 3300025923 Bacteria 2598
114 Ga0207694_10139513 3300025924 Bacteria 1949
115 Ga0207650_10258837 3300025925 Bacteria 1411
116 Ga0207690_10011565 3300025932 Bacteria 5272
117 Ga0207690_10012670 3300025932 Bacteria 5051
118 Ga0207706_10699661 3300025933 Bacteria 866
119 Ga0207665_10037116 3300025939 Bacteria 3242
120 Ga0207679_10434883 3300025945 Bacteria 1161
121 Ga0207667_10006167 3300025949 Bacteria 14558
122 Ga0207667_10481241 3300025949 Bacteria 1260
123 Ga0207651_10509874 3300025960 Bacteria 1041
124 Ga0207658_10092755 3300025986 Bacteria 2346
125 Ga0207658_11307808 3300025986 Bacteria 663
126 Ga0207703_12379075 3300026035 Bacteria 505
127 Ga0207639_11446442 3300026041 Bacteria 645
128 Ga0207678_10017295 3300026067 Bacteria 6330
129 Ga0207708_10108569 3300026075 Bacteria 2152
130 Ga0207708_10739213 3300026075 Bacteria 844
131 Ga0207702_10002175 3300026078 Bacteria 18801
132 Ga0207648_10032989 3300026089 Bacteria 4568
133 Ga0207648_10363727 3300026089 Bacteria 1306
134 Ga0207674_10744319 3300026116 Bacteria 946
135 Ga0207675_100075674 3300026118 Bacteria 3152
136 Ga0207683_10454584 3300026121 Bacteria 1181
137 Ga0207683_10882600 3300026121 Bacteria 830
138 Ga0207698_11049057 3300026142 Bacteria 827
139 Ga0207428_10581844 3300027907 Unclassified 808
140 Ga0268266_10000001 3300028379 Bacteria 4040580
141 Ga0268266_10057450 3300028379 Bacteria 3348
142 Ga0268266_10427609 3300028379 Bacteria 1256
143 Ga0268266_10619244 3300028379 Bacteria 1040
144 Ga0268265_10045071 3300028380 Bacteria 3288
145 Ga0268265_11661096 3300028380 Bacteria 644
146 Ga0268264_10072263 3300028381 Bacteria 2925
147 Ga0268264_10091363 3300028381 Bacteria 2626
148 Ga0268264_11034996 3300028381 Bacteria 828
149 Ga0268264_11835062 3300028381 Bacteria 616
150 Ga0265337_1001388 3300028556 Bacteria 11886
151 Ga0265334_10000880 3300028573 Bacteria 15036
152 Ga0307517_10316581 3300028786 Unclassified 866
153 Ga0307515_10205089 3300028794 Unclassified 1835
154 Ga0307511_10000543 3300030521 Bacteria 40443
155 Ga0265328_10186629 3300031239 Bacteria 785
156 Ga0265331_10006577 3300031250 Bacteria 6850
157 Ga0265331_10338909 3300031250 Bacteria 673
158 Ga0307513_10112683 3300031456 Bacteria 2710
159 Ga0307513_10184145 3300031456 Bacteria 1948
160 Ga0307513_10451824 3300031456 Bacteria 1009
161 Ga0265313_10018524 3300031595 Bacteria 3905
162 Ga0265313_10192740 3300031595 Bacteria 851
163 Ga0307508_10078051 3300031616 Bacteria 2891
164 Ga0307508_10367384 3300031616 Bacteria 1030
165 Ga0265314_10001480 3300031711 Bacteria 26127
166 Ga0265314_10074212 3300031711 Bacteria 2266
167 Ga0265314_10194436 3300031711 Bacteria 1204
168 Ga0307507_10526519 3300033179 Bacteria 630
169 Ga0373932_0277935 3300035112 Bacteria 619
170 Ga0373936_0583241 3300035113 Unclassified 524
171 Ga0373955_0055927 3300035172 Bacteria 2163
172 Ga0436364_1291243 3300037853 Bacteria 719
173 Ga0436360_0771600 3300039438 Bacteria 1136
174 Ga0451798_0025460 3300041458 Bacteria 1025
175 Ga0451804_1178081 3300041463 Bacteria 696
176 Ga0451835_0664945 3300041492 Bacteria 839
177 Ga0439455_0018312 3300042012 Bacteria 1641
178 Ga0450890_030786 3300042127 Unclassified 763
179 Ga0439464_0163244 3300042439 Unclassified 700
180 Ga0466961_0787565 3300044693 Unclassified 568
181 Ga0466957_0210850 3300044842 Bacteria 1279
182 Ga0466958_0901605 3300045836 Unclassified 577
183 Ga0495590_0198402 3300046457 Bacteria 737
184 Ga0495651_0122657 3300046462 Bacteria 1907
185 Ga0495642_0572590 3300046528 Bacteria 501
186 Ga0495587_0454269 3300046536 Bacteria 710
187 Ga0495625_0028815 3300046660 Bacteria 4159
188 Ga0495600_0178373 3300046809 Bacteria 1369
189 Ga0495686_0055364 3300047472 Bacteria 2481
190 Ga0495686_0086002 3300047472 Bacteria 1914
191 Ga0495686_0354191 3300047472 Unclassified 797
192 Ga0496100_0440042 3300048903 Bacteria 998
193 Ga0496102_0073117 3300048905 Bacteria 3151
194 Ga0496104_0079881 3300048907 Bacteria 3118
195 Ga0496110_0549766 3300048913 Bacteria 1049
196 Ga0496112_0348288 3300048915 Bacteria 1424
197 Ga0496115_0809868 3300048918 Bacteria 728
198 Ga0496126_0155420 3300048929 Bacteria 1958
199 Ga0501032_0212486 3300049569 Bacteria 1261
200 Ga0501033_0036197 3300049570 Bacteria 3700
201 Ga0501034_0195656 3300049571 Bacteria 1982
202 Ga0501034_0534352 3300049571 Bacteria 1083
203 Ga0501038_0280571 3300049574 Bacteria 1311
204 Ga0501038_0369308 3300049574 Bacteria 1115
205 Ga0501038_0877001 3300049574 Bacteria 663
206 Ga0501043_0087713 3300049579 Bacteria 2445
207 Ga0501043_0355294 3300049579 Bacteria 1113
208 Ga0501046_0072979 3300049580 Bacteria 2664
209 Ga0501046_0171806 3300049580 Bacteria 1626
210 Ga0501047_0085781 3300049581 Bacteria 3025
211 Ga0501047_0768427 3300049581 Bacteria 779
212 Ga0501067_0626194 3300049583 Bacteria 604
213 Ga0501067_0692111 3300049583 Bacteria 573
214 Ga0501068_0168460 3300049584 Bacteria 1382
215 Ga0501070_0026954 3300049586 Bacteria 4819
216 Ga0501073_0091897 3300049589 Bacteria 2109
217 Ga0501074_0591223 3300049590 Bacteria 785
218 Ga0501076_0562898 3300049592 Bacteria 940
219 Ga0501261_042496 3300049690 Unclassified 721
220 Ga0501080_0137458 3300049742 Bacteria 2260
221 Ga0501080_0237995 3300049742 Bacteria 1662
222 Ga0501083_0242194 3300049744 Bacteria 1174
223 Ga0501083_0351066 3300049744 Bacteria 959
224 Ga0501035_0407542 3300049822 Bacteria 1130
225 Ga0501044_0020081 3300049823 Bacteria 7133
226 Ga0501044_0217201 3300049823 Bacteria 1864
227 Ga0501044_0717241 3300049823 Bacteria 884
228 nmdc:mga05p37_28302_c1 3300050507 Bacteria 6834
229 nmdc:mga09592_599772_c1 3300050508 Bacteria 943
230 nmdc:mga09592_6162_c1 3300050508 Bacteria 9762
231 nmdc:mga0qj67_1209141_c1 3300050509 Bacteria 588
232 nmdc:mga06r32_384979_c1 3300050510 Bacteria 1385
233 nmdc:mga08y16_1194834_c1 3300050511 Bacteria 731
234 nmdc:mga08y16_132171_c1 3300050511 Bacteria 2595
235 nmdc:mga08y16_171255_c1 3300050511 Bacteria 2255
236 nmdc:mga0n895_140857_c1 3300050512 Bacteria 2440
237 nmdc:mga0a205_929542_c1 3300050515 Bacteria 716
238 Ga0495601_0723917 3300053077 Unclassified 634
239 Ga0500578_0209751 3300053086 Bacteria 1189
240 Ga0500646_0024270 3300053090 Bacteria 1632
241 Ga0500651_0004119 3300053093 Bacteria 8098
242 Ga0500651_0244899 3300053093 Bacteria 1044
243 Ga0500651_0276531 3300053093 Bacteria 970
244 Ga0500566_0031632 3300053094 Bacteria 3085
245 Ga0500641_0004213 3300053096 Bacteria 5074
246 Ga0500555_010365 3300053103 Bacteria 2671
247 Ga0500569_181120 3300053109 Bacteria 716
248 Ga0500595_000160 3300053119 Bacteria 44296
249 Ga0500614_149163 3300053123 Bacteria 703
250 Ga0500658_0041940 3300053134 Bacteria 1837
251 Ga0500658_0473907 3300053134 Bacteria 568
252 Ga0500559_0220324 3300053136 Bacteria 895
253 Ga0500568_0001482 3300053139 Bacteria 15042
254 Ga0500588_0003854 3300053146 Bacteria 3205
255 Ga0500588_0352617 3300053146 Bacteria 559
256 Ga0500588_0405176 3300053146 Unclassified 519
257 Ga0500604_0053464 3300053151 Bacteria 1252
258 Ga0500637_0036810 3300053178 Bacteria 2748
259 Ga0500637_0094326 3300053178 Bacteria 1734
260 Ga0501082_0129590 3300060353 Bacteria 2188
261 Ga0501082_0914076 3300060353 Bacteria 768
262 Ga0157378_11690069
263 Ga0070658_10082784
264 Ga0070683_100125802
265 Ga0070690_100044822
266 Ga0070670_100323133
267 Ga0070682_100059332
268 Ga0070691_10976609
269 Ga0070661_100002684
270 Ga0070661_101378024
271 Ga0070692_10045975
272 Ga0070692_10233279
273 Ga0070674_100150857
274 Ga0070673_100403825
275 Ga0070673_101501508
276 Ga0070667_100001811
277 Ga0070667_100508171
278 Ga0070667_101767523
279 Ga0070709_10058915
280 Ga0070714_100805009
281 Ga0070713_100062384
282 Ga0070713_101213087
283 Ga0070710_10050669
284 Ga0070701_10241980
285 Ga0070711_100038670
286 Ga0070711_100422934
287 Ga0070663_100026202
288 Ga0070678_101067861
289 Ga0070681_10620255
290 Ga0068867_100014388
291 Ga0070685_10251957
292 Ga0070706_100017652
293 Ga0070706_100036286
294 Ga0070707_101104117
295 Ga0070707_101164411
296 Ga0070698_100007867
297 Ga0070698_100036276
298 Ga0070699_100320312
299 Ga0070679_100288706
300 Ga0070697_100541173
301 Ga0070672_100421752
302 Ga0070672_101370568
303 Ga0070696_100589774
304 Ga0070665_100000214
305 Ga0070665_100007465
306 Ga0070665_100144239
307 Ga0070665_100457747
308 Ga0070665_100818202
309 Ga0070665_101423473
310 Ga0068855_100160591
311 Ga0070664_101809903
312 Ga0068857_100355770
313 Ga0068857_100898236
314 Ga0068856_100014584
315 Ga0070702_100081684
316 Ga0068852_101821066
317 Ga0068859_100865004
318 Ga0068860_100072632
319 Ga0068862_100112183
320 Ga0068862_101675159
321 Ga0081455_10180171
322 Ga0081455_10314122
323 Ga0070717_10212745
324 Ga0070717_10396680
325 Ga0070716_100042539
326 Ga0070712_100010667
327 Ga0070712_101193477
328 Ga0075369_10463853
329 Ga0075428_100054238
330 Ga0075428_100113345
331 Ga0075428_102072355
332 Ga0075430_101024207
333 Ga0075431_100232034
334 Ga0075433_10677363
335 Ga0075434_100071786
336 Ga0075429_100010405
337 Ga0068865_100534660
338 Ga0075436_101563021
339 Ga0097620_100864989
340 Ga0099795_10150185
341 Ga0105240_10594091
342 Ga0111539_10030893
343 Ga0111539_10440283
344 Ga0111539_10813342
345 Ga0105247_11067056
346 Ga0114129_10156614
347 Ga0105237_12242371
348 Ga0105238_12313148
349 Ga0099796_10089859
350 Ga0105239_12872021
351 Ga0157370_10465452
352 Ga0157369_10032290
353 Ga0157378_11017877
354 Ga0157375_12132104
355 Ga0157375_12470003
356 Ga0163163_10020287
357 Ga0157379_11751235
358 Ga0207426_1012508
359 Ga0207656_10623795
360 Ga0207692_10060733
361 Ga0207647_10013627
362 Ga0207685_10129362
363 Ga0207699_10156140
364 Ga0207705_10000977
365 Ga0207684_10044690
366 Ga0207684_10199194
367 Ga0207684_11536187
368 Ga0207671_10363284
369 Ga0207663_10583015
370 Ga0207663_11254740
371 Ga0207657_10024157
372 Ga0207649_10018008
373 Ga0207646_11258413
374 Ga0207681_10060595
375 Ga0207694_10139513
376 Ga0207650_10258837
377 Ga0207690_10011565
378 Ga0207690_10012670
379 Ga0207706_10699661
380 Ga0207665_10037116
381 Ga0207679_10434883
382 Ga0207667_10006167
383 Ga0207667_10481241
384 Ga0207651_10509874
385 Ga0207658_10092755
386 Ga0207658_11307808
387 Ga0207703_12379075
388 Ga0207639_11446442
389 Ga0207678_10017295
390 Ga0207708_10108569
391 Ga0207708_10739213
392 Ga0207702_10002175
393 Ga0207648_10032989
394 Ga0207648_10363727
395 Ga0207674_10744319
396 Ga0207675_100075674
397 Ga0207683_10454584
398 Ga0207683_10882600
399 Ga0207698_11049057
400 Ga0207428_10581844
401 Ga0268266_10000001
402 Ga0268266_10057450
403 Ga0268266_10427609
404 Ga0268266_10619244
405 Ga0268265_10045071
406 Ga0268265_11661096
407 Ga0268264_10072263
408 Ga0268264_10091363
409 Ga0268264_11034996
410 Ga0268264_11835062
411 Ga0265337_1001388
412 Ga0265334_10000880
413 Ga0307517_10316581
414 Ga0307515_10205089
415 Ga0307511_10000543
416 Ga0265328_10186629
417 Ga0265331_10006577
418 Ga0265331_10338909
419 Ga0307513_10112683
420 Ga0307513_10184145
421 Ga0307513_10451824
422 Ga0265313_10018524
423 Ga0265313_10192740
424 Ga0307508_10078051
425 Ga0307508_10367384
426 Ga0265314_10001480
427 Ga0265314_10074212
428 Ga0265314_10194436
429 Ga0307507_10526519
430 Ga0373932_0277935
431 Ga0373936_0583241
432 Ga0373955_0055927
433 Ga0436364_1291243
434 Ga0436360_0771600
435 Ga0451798_0025460
436 Ga0451804_1178081
437 Ga0451835_0664945
438 Ga0439455_0018312
439 Ga0450890_030786
440 Ga0439464_0163244
441 Ga0466961_0787565
442 Ga0466957_0210850
443 Ga0466958_0901605
444 Ga0495590_0198402
445 Ga0495651_0122657
446 Ga0495642_0572590
447 Ga0495587_0454269
448 Ga0495625_0028815
449 Ga0495600_0178373
450 Ga0495686_0055364
451 Ga0495686_0086002
452 Ga0495686_0354191
453 Ga0496100_0440042
454 Ga0496102_0073117
455 Ga0496104_0079881
456 Ga0496110_0549766
457 Ga0496112_0348288
458 Ga0496115_0809868
459 Ga0496126_0155420
460 Ga0501032_0212486
461 Ga0501033_0036197
462 Ga0501034_0195656
463 Ga0501034_0534352
464 Ga0501038_0280571
465 Ga0501038_0369308
466 Ga0501038_0877001
467 Ga0501043_0087713
468 Ga0501043_0355294
469 Ga0501046_0072979
470 Ga0501046_0171806
471 Ga0501047_0085781
472 Ga0501047_0768427
473 Ga0501067_0626194
474 Ga0501067_0692111
475 Ga0501068_0168460
476 Ga0501070_0026954
477 Ga0501073_0091897
478 Ga0501074_0591223
479 Ga0501076_0562898
480 Ga0501261_042496
481 Ga0501080_0137458
482 Ga0501080_0237995
483 Ga0501083_0242194
484 Ga0501083_0351066
485 Ga0501035_0407542
486 Ga0501044_0020081
487 Ga0501044_0217201
488 Ga0501044_0717241
489 nmdc:mga05p37_28302_c1
490 nmdc:mga09592_599772_c1
491 nmdc:mga09592_6162_c1
492 nmdc:mga0qj67_1209141_c1
493 nmdc:mga06r32_384979_c1
494 nmdc:mga08y16_1194834_c1
495 nmdc:mga08y16_132171_c1
496 nmdc:mga08y16_171255_c1
497 nmdc:mga0n895_140857_c1
498 nmdc:mga0a205_929542_c1
499 Ga0495601_0723917
500 Ga0500578_0209751
501 Ga0500646_0024270
502 Ga0500651_0004119
503 Ga0500651_0244899
504 Ga0500651_0276531
505 Ga0500566_0031632
506 Ga0500641_0004213
507 Ga0500555_010365
508 Ga0500569_181120
509 Ga0500595_000160
510 Ga0500614_149163
511 Ga0500658_0041940
512 Ga0500658_0473907
513 Ga0500559_0220324
514 Ga0500568_0001482
515 Ga0500588_0003854
516 Ga0500588_0352617
517 Ga0500588_0405176
518 Ga0500604_0053464
519 Ga0500637_0036810
520 Ga0500637_0094326
521 Ga0501082_0129590
522 Ga0501082_0914076

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03795

YCII

YCII-related domain

1

109

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.8407 1 114
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.8276 1 114
3zo7-assembly1.cif.gz_F crystal structure of clcfe27a with substrate 0.7488 1 115
3znj-assembly3.cif.gz_9 crystal structure of unliganded clcf from r.opacus 1cp in crystal form 1. 0.7399 1 115
3znu-assembly1.cif.gz_I crystal structure of clcf in crystal form 2 0.7311 1 115
ID Description Score Start End Superfamily
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.8407 1 114 3.30.70.1060
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.8276 1 114 3.30.70.1060
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7987 1 115 3.30.70.1060
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7469 1 115 3.30.70.1060
af_O07243_108_202_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7376 1 115 3.30.70.1060
ID Description Score Start End GO Terms
AF-A0A4P2Q9Z6-F1-model_v4 YCII-related domain-containing protein 0.9063 1 114
AF-A0A849Z1X5-F1-model_v4 YciI family protein 0.9001 1 115
AF-A0A849Z1X5-F1-model_v4 YciI family protein 0.8929 1 115
AF-A0A4P8IWP2-F1-model_v4 YciI family protein 0.8894 1 114
AF-B1Y0D2-F1-model_v4 DGPFAETKE family protein 0.8884 1 114 GO:0005829
GO:0006541

Map