F370305

General Info

Members Datasets Scaffolds Average Seq Length
261 152 522 127

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10503320|Ga0114129_105033203
Length 118
Sequence MRAVDTNVLVRLITRDDPKQVAAAEAFVATGAWVPHLALAEATCVLSFVYERSAEAIAAAIEMLLNHQQLTMQDGQFRRRPAVGFSDCLMVEVTRKAGHGPLGTFDRDLARVDGAHRL

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
70 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
94 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
97 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
98 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
99 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
100 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
101 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
102 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
103 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
104 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
105 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
106 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
107 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
108 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
109 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
110 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
111 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
112 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
113 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
114 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
115 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
116 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
117 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
118 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
119 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
120 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
121 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
122 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
123 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
124 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
125 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
126 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
127 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
128 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
129 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
131 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
132 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
133 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
134 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
135 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
136 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
137 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
138 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
139 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
140 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
141 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
142 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
143 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
144 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
145 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
146 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
147 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
148 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
149 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
150 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
151 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
152 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.21
Nodule 0
Rhizoplane 1.15
Rhizosphere 93.49
Stem 0
Stem Tuber 0
Unclassified 31.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10503320 3300009147 Unclassified 1582
2 Ga0065712_10199331 3300005290 Unclassified 1115
3 Ga0065707_10438527 3300005295 Unclassified 812
4 Ga0070670_100280721 3300005331 Bacteria 1454
5 Ga0068869_100051124 3300005334 Bacteria 2997
6 Ga0070666_10012084 3300005335 Bacteria 5437
7 Ga0070680_100758805 3300005336 Unclassified 835
8 Ga0070682_101042290 3300005337 Unclassified 681
9 Ga0070660_100444058 3300005339 Bacteria 1076
10 Ga0070689_100151434 3300005340 Unclassified 1871
11 Ga0070671_101694619 3300005355 Bacteria 561
12 Ga0070674_100011817 3300005356 Bacteria 5331
13 Ga0070667_100154288 3300005367 Bacteria 2019
14 Ga0070705_100234531 3300005440 Bacteria 1279
15 Ga0070694_100011838 3300005444 Bacteria 5410
16 Ga0070694_100661486 3300005444 Unclassified 846
17 Ga0070708_100244835 3300005445 Unclassified 1684
18 Ga0070708_101294901 3300005445 Unclassified 681
19 Ga0068867_100288311 3300005459 Bacteria 1349
20 Ga0070706_100536866 3300005467 Unclassified 1088
21 Ga0070707_100393318 3300005468 Unclassified 1346
22 Ga0070698_100081957 3300005471 Unclassified 3219
23 Ga0070698_100094578 3300005471 Bacteria 2967
24 Ga0070698_100757727 3300005471 Unclassified 914
25 Ga0070698_101223894 3300005471 Unclassified 700
26 Ga0070699_100024976 3300005518 Bacteria 5151
27 Ga0070699_100032627 3300005518 Bacteria 4497
28 Ga0070699_100350974 3300005518 Bacteria 1329
29 Ga0070679_100913190 3300005530 Bacteria 822
30 Ga0070684_100418473 3300005535 Bacteria 1237
31 Ga0070697_100110781 3300005536 Bacteria 2287
32 Ga0070696_100752182 3300005546 Unclassified 799
33 Ga0070704_100250354 3300005549 Bacteria 1455
34 Ga0068855_100195292 3300005563 Bacteria 2280
35 Ga0070664_100052804 3300005564 Bacteria 3443
36 Ga0070664_100370406 3300005564 Bacteria 1306
37 Ga0070664_101166722 3300005564 Bacteria 726
38 Ga0068857_102457028 3300005577 Unclassified 512
39 Ga0068856_100051441 3300005614 Bacteria 4061
40 Ga0070702_100909764 3300005615 Bacteria 689
41 Ga0068859_100060329 3300005617 Bacteria 3822
42 Ga0068859_100267096 3300005617 Bacteria 1803
43 Ga0068859_100431749 3300005617 Unclassified 1414
44 Ga0068859_100812467 3300005617 Unclassified 1022
45 Ga0068864_100886840 3300005618 Bacteria 880
46 Ga0068864_101036976 3300005618 Bacteria 814
47 Ga0068861_100487282 3300005719 Bacteria 1112
48 Ga0068861_100502946 3300005719 Bacteria 1096
49 Ga0068858_100144790 3300005842 Bacteria 2231
50 Ga0068858_100850607 3300005842 Bacteria 891
51 Ga0068860_100323965 3300005843 Unclassified 1513
52 Ga0068860_100557649 3300005843 Unclassified 1148
53 Ga0068862_100136385 3300005844 Bacteria 2175
54 Ga0068862_100241623 3300005844 Bacteria 1642
55 Ga0081455_10001835 3300005937 Bacteria 25601
56 Ga0081455_10496746 3300005937 Bacteria 820
57 Ga0075432_10072059 3300006058 Bacteria 1243
58 Ga0068871_100078514 3300006358 Unclassified 2730
59 Ga0068871_100095822 3300006358 Bacteria 2478
60 Ga0075428_100102169 3300006844 Bacteria 3126
61 Ga0075428_100277215 3300006844 Unclassified 1804
62 Ga0075428_100463193 3300006844 Bacteria 1357
63 Ga0075428_100494343 3300006844 Unclassified 1309
64 Ga0075430_100063231 3300006846 Bacteria 3109
65 Ga0075431_100073726 3300006847 Bacteria 3522
66 Ga0075433_10002723 3300006852 Bacteria 13504
67 Ga0075433_10081154 3300006852 Unclassified 2859
68 Ga0075433_10082176 3300006852 Bacteria 2841
69 Ga0075434_100001254 3300006871 Bacteria 21144
70 Ga0075434_100115156 3300006871 Unclassified 2701
71 Ga0075434_101644797 3300006871 Bacteria 650
72 Ga0075429_100032821 3300006880 Bacteria 4512
73 Ga0068865_101060840 3300006881 Unclassified 712
74 Ga0097620_100060328 3300006931 Bacteria 3822
75 Ga0097620_100267103 3300006931 Bacteria 1803
76 Ga0097620_100431758 3300006931 Unclassified 1414
77 Ga0097620_100812571 3300006931 Unclassified 1022
78 Ga0099794_10052874 3300007265 Unclassified 1958
79 Ga0105240_11454578 3300009093 Bacteria 719
80 Ga0111539_10003311 3300009094 Bacteria 21271
81 Ga0111539_10009320 3300009094 Bacteria 12399
82 Ga0105245_10037222 3300009098 Bacteria 4326
83 Ga0105245_10048810 3300009098 Unclassified 3788
84 Ga0105247_10114064 3300009101 Unclassified 1743
85 Ga0105247_10461931 3300009101 Bacteria 917
86 Ga0114129_10006482 3300009147 Bacteria 16602
87 Ga0114129_10020017 3300009147 Bacteria 9524
88 Ga0114129_10229957 3300009147 Bacteria 2498
89 Ga0114129_10971581 3300009147 Bacteria 1071
90 Ga0114129_12666111 3300009147 Unclassified 596
91 Ga0105243_10232266 3300009148 Unclassified 1637
92 Ga0105241_10180132 3300009174 Bacteria 1752
93 Ga0105241_10350787 3300009174 Bacteria 1281
94 Ga0105242_10150608 3300009176 Bacteria 2028
95 Ga0105242_10519033 3300009176 Bacteria 1136
96 Ga0105242_10562881 3300009176 Bacteria 1095
97 Ga0105242_12320824 3300009176 Unclassified 583
98 Ga0105248_10025057 3300009177 Bacteria 6631
99 Ga0105237_10387702 3300009545 Bacteria 1402
100 Ga0105237_12582218 3300009545 Unclassified 519
101 Ga0105238_10027921 3300009551 Bacteria 5751
102 Ga0105238_10476695 3300009551 Unclassified 1247
103 Ga0105238_10963444 3300009551 Unclassified 873
104 Ga0105249_12847485 3300009553 Bacteria 555
105 Ga0105239_10015885 3300010375 Bacteria 8334
106 Ga0105239_11844604 3300010375 Bacteria 701
107 Ga0157369_10150698 3300013105 Bacteria 2457
108 Ga0157369_10351743 3300013105 Bacteria 1530
109 Ga0157374_10225359 3300013296 Bacteria 1841
110 Ga0157374_10428865 3300013296 Unclassified 1322
111 Ga0157372_10475585 3300013307 Bacteria 1457
112 Ga0157372_10707602 3300013307 Bacteria 1172
113 Ga0157375_12495202 3300013308 Bacteria 617
114 Ga0157375_12850121 3300013308 Unclassified 578
115 Ga0163163_10032211 3300014325 Bacteria 5063
116 Ga0163163_10038151 3300014325 Bacteria 4679
117 Ga0163163_12164644 3300014325 Unclassified 615
118 Ga0157379_10028387 3300014968 Bacteria 4977
119 Ga0157379_10029293 3300014968 Unclassified 4896
120 Ga0157379_10772849 3300014968 Bacteria 905
121 Ga0157376_10203957 3300014969 Unclassified 1821
122 Ga0213876_10662778 3300021384 Unclassified 555
123 Ga0207680_10023627 3300025903 Bacteria 3360
124 Ga0207654_10406377 3300025911 Bacteria 948
125 Ga0207695_10209424 3300025913 Unclassified 1861
126 Ga0207695_11144666 3300025913 Bacteria 658
127 Ga0207671_10176691 3300025914 Bacteria 1660
128 Ga0207671_10288906 3300025914 Bacteria 1294
129 Ga0207652_10669658 3300025921 Bacteria 927
130 Ga0207646_10420978 3300025922 Unclassified 1206
131 Ga0207646_10566107 3300025922 Bacteria 1021
132 Ga0207694_10020746 3300025924 Bacteria 4974
133 Ga0207694_10280079 3300025924 Bacteria 1369
134 Ga0207694_10614402 3300025924 Unclassified 915
135 Ga0207650_10214315 3300025925 Bacteria 1547
136 Ga0207687_10158575 3300025927 Bacteria 1734
137 Ga0207686_10387485 3300025934 Unclassified 1061
138 Ga0207670_10518973 3300025936 Unclassified 970
139 Ga0207704_10602549 3300025938 Bacteria 899
140 Ga0207711_10053860 3300025941 Bacteria 3451
141 Ga0207679_10148270 3300025945 Unclassified 1906
142 Ga0207667_10083190 3300025949 Bacteria 3314
143 Ga0207658_10292869 3300025986 Bacteria 1399
144 Ga0207677_10131198 3300026023 Unclassified 1903
145 Ga0207703_10019428 3300026035 Bacteria 5309
146 Ga0207703_10142366 3300026035 Bacteria 2082
147 Ga0207641_11384461 3300026088 Bacteria 704
148 Ga0207674_11002571 3300026116 Unclassified 804
149 Ga0207675_100801418 3300026118 Unclassified 955
150 Ga0207675_101753134 3300026118 Bacteria 640
151 Ga0207698_11548575 3300026142 Bacteria 678
152 Ga0209588_1004935 3300027671 Unclassified 3792
153 Ga0207428_10001505 3300027907 Bacteria 24372
154 Ga0207428_10036899 3300027907 Bacteria 3981
155 Ga0268265_10300542 3300028380 Bacteria 1445
156 Ga0268264_10284332 3300028381 Unclassified 1551
157 Ga0268264_10478677 3300028381 Unclassified 1211
158 Ga0265338_10260005 3300028800 Unclassified 1277
159 Ga0265338_10706326 3300028800 Unclassified 696
160 Ga0265330_10003572 3300031235 Bacteria 8102
161 Ga0265330_10451378 3300031235 Unclassified 546
162 Ga0265329_10000299 3300031242 Bacteria 26141
163 Ga0265340_10285632 3300031247 Unclassified 733
164 Ga0265339_10019216 3300031249 Bacteria 4014
165 Ga0265316_10000295 3300031344 Bacteria 56326
166 Ga0265313_10437812 3300031595 Unclassified 509
167 Ga0265314_10013250 3300031711 Bacteria 6673
168 Ga0265314_10658002 3300031711 Bacteria 534
169 Ga0265342_10000228 3300031712 Bacteria 63409
170 Ga0307405_10522552 3300031731 Bacteria 955
171 Ga0307412_10413807 3300031911 Bacteria 1101
172 Ga0307414_10362367 3300032004 Bacteria 1248
173 Ga0373954_0177373 3300035118 Unclassified 1044
174 Ga0373954_0681486 3300035118 Unclassified 510
175 Ga0373943_0797735 3300035170 Unclassified 562
176 Ga0373924_0503683 3300035410 Unclassified 544
177 Ga0316582_0118878 3300036647 Bacteria 1767
178 Ga0436365_1250548 3300039437 Bacteria 4775
179 Ga0451804_1010314 3300041463 Unclassified 535
180 Ga0451835_0154339 3300041492 Unclassified 612
181 Ga0451577_0000119 3300042876 Bacteria 172779
182 Ga0451577_0002137 3300042876 Bacteria 24231
183 Ga0451577_0003114 3300042876 Bacteria 18711
184 Ga0451577_0005416 3300042876 Bacteria 13089
185 Ga0451577_0009562 3300042876 Bacteria 9317
186 Ga0451577_0049670 3300042876 Bacteria 3745
187 Ga0451577_0076208 3300042876 Bacteria 2990
188 Ga0451577_1034799 3300042876 Bacteria 736
189 Ga0453683_0000453 3300044673 Bacteria 47152
190 Ga0453683_0000898 3300044673 Bacteria 28525
191 Ga0453683_0004675 3300044673 Bacteria 9661
192 Ga0453683_0011393 3300044673 Bacteria 5858
193 Ga0453683_0015897 3300044673 Bacteria 4863
194 Ga0453683_0029838 3300044673 Unclassified 3447
195 Ga0453683_0222959 3300044673 Bacteria 1199
196 Ga0453683_0302397 3300044673 Bacteria 1023
197 Ga0453683_0519334 3300044673 Unclassified 773
198 Ga0453683_0630620 3300044673 Bacteria 700
199 Ga0466963_0972886 3300044694 Bacteria 598
200 Ga0453684_0000258 3300044712 Bacteria 228312
201 Ga0453684_0003151 3300044712 Bacteria 37976
202 Ga0453684_0003741 3300044712 Bacteria 33655
203 Ga0453684_0016477 3300044712 Bacteria 11548
204 Ga0453684_0027459 3300044712 Bacteria 8163
205 Ga0453684_0042340 3300044712 Bacteria 6140
206 Ga0453684_0088466 3300044712 Bacteria 3835
207 Ga0453684_0543672 3300044712 Bacteria 1280
208 Ga0453684_0755710 3300044712 Bacteria 1052
209 Ga0453684_1520283 3300044712 Unclassified 690
210 Ga0451576_0002115 3300045051 Bacteria 30865
211 Ga0451576_0007752 3300045051 Bacteria 12749
212 Ga0451576_0030641 3300045051 Bacteria 5747
213 Ga0451576_0371889 3300045051 Bacteria 1497
214 Ga0451576_0404105 3300045051 Bacteria 1432
215 Ga0451576_0411415 3300045051 Unclassified 1418
216 Ga0451576_0420225 3300045051 Unclassified 1402
217 Ga0451576_1280525 3300045051 Unclassified 764
218 Ga0466967_2346762 3300045976 Bacteria 529
219 Ga0495628_0134823 3300046516 Unclassified 1888
220 Ga0495630_0401412 3300046517 Unclassified 1050
221 Ga0495640_0351453 3300046533 Bacteria 910
222 Ga0495621_0227952 3300046539 Unclassified 756
223 Ga0495658_0569717 3300046683 Bacteria 725
224 Ga0495636_0026854 3300047318 Bacteria 2344
225 Ga0495636_0219243 3300047318 Unclassified 873
226 Ga0496109_1179109 3300048912 Unclassified 703
227 Ga0496115_0398475 3300048918 Unclassified 1117
228 Ga0501042_1287361 3300049578 Unclassified 533
229 Ga0501080_1087240 3300049742 Bacteria 691
230 nmdc:mga05p37_174223_c1 3300050507 Bacteria 2622
231 nmdc:mga05p37_21228_c1 3300050507 Bacteria 7861
232 nmdc:mga05p37_9396_c1 3300050507 Bacteria 11574
233 nmdc:mga09592_4403_c1 3300050508 Bacteria 11396
234 nmdc:mga0qj67_351461_c1 3300050509 Bacteria 1192
235 nmdc:mga06r32_61530_c1 3300050510 Bacteria 3614
236 nmdc:mga06r32_788335_c1 3300050510 Unclassified 912
237 nmdc:mga08y16_155963_c1 3300050511 Bacteria 2373
238 nmdc:mga08y16_6028_c1 3300050511 Bacteria 12705
239 nmdc:mga08y16_952770_c1 3300050511 Bacteria 841
240 nmdc:mga0n895_136055_c1 3300050512 Unclassified 2484
241 nmdc:mga0n895_1446242_c1 3300050512 Bacteria 655
242 nmdc:mga0n895_17581_c1 3300050512 Bacteria 6595
243 nmdc:mga0rr50_1028_c1 3300050513 Bacteria 15140
244 nmdc:mga08x19_19941_c1 3300050514 Bacteria 4123
245 nmdc:mga08x19_518417_c1 3300050514 Bacteria 842
246 nmdc:mga0a205_410_c2 3300050515 Bacteria 27270
247 nmdc:mga0a205_93359_c1 3300050515 Bacteria 2908
248 Ga0495601_0995933 3300053077 Unclassified 527
249 Ga0495595_0237684 3300053084 Bacteria 911
250 Ga0500641_0254890 3300053096 Bacteria 734
251 Ga0500556_0033538 3300053104 Bacteria 1761
252 Ga0500597_229383 3300053120 Bacteria 768
253 Ga0500642_0059245 3300053130 Bacteria 1714
254 Ga0500658_0011730 3300053134 Bacteria 3230
255 Ga0500561_0171842 3300053137 Bacteria 680
256 Ga0500568_0186143 3300053139 Bacteria 763
257 Ga0500588_0001551 3300053146 Bacteria 4415
258 Ga0500622_0000811 3300053156 Bacteria 26775
259 Ga0500622_0387285 3300053156 Bacteria 571
260 Ga0500637_0003595 3300053178 Bacteria 7196
261 Ga0501082_1443609 3300060353 Bacteria 601
262 Ga0114129_10503320
263 Ga0065712_10199331
264 Ga0065707_10438527
265 Ga0070670_100280721
266 Ga0068869_100051124
267 Ga0070666_10012084
268 Ga0070680_100758805
269 Ga0070682_101042290
270 Ga0070660_100444058
271 Ga0070689_100151434
272 Ga0070671_101694619
273 Ga0070674_100011817
274 Ga0070667_100154288
275 Ga0070705_100234531
276 Ga0070694_100011838
277 Ga0070694_100661486
278 Ga0070708_100244835
279 Ga0070708_101294901
280 Ga0068867_100288311
281 Ga0070706_100536866
282 Ga0070707_100393318
283 Ga0070698_100081957
284 Ga0070698_100094578
285 Ga0070698_100757727
286 Ga0070698_101223894
287 Ga0070699_100024976
288 Ga0070699_100032627
289 Ga0070699_100350974
290 Ga0070679_100913190
291 Ga0070684_100418473
292 Ga0070697_100110781
293 Ga0070696_100752182
294 Ga0070704_100250354
295 Ga0068855_100195292
296 Ga0070664_100052804
297 Ga0070664_100370406
298 Ga0070664_101166722
299 Ga0068857_102457028
300 Ga0068856_100051441
301 Ga0070702_100909764
302 Ga0068859_100060329
303 Ga0068859_100267096
304 Ga0068859_100431749
305 Ga0068859_100812467
306 Ga0068864_100886840
307 Ga0068864_101036976
308 Ga0068861_100487282
309 Ga0068861_100502946
310 Ga0068858_100144790
311 Ga0068858_100850607
312 Ga0068860_100323965
313 Ga0068860_100557649
314 Ga0068862_100136385
315 Ga0068862_100241623
316 Ga0081455_10001835
317 Ga0081455_10496746
318 Ga0075432_10072059
319 Ga0068871_100078514
320 Ga0068871_100095822
321 Ga0075428_100102169
322 Ga0075428_100277215
323 Ga0075428_100463193
324 Ga0075428_100494343
325 Ga0075430_100063231
326 Ga0075431_100073726
327 Ga0075433_10002723
328 Ga0075433_10081154
329 Ga0075433_10082176
330 Ga0075434_100001254
331 Ga0075434_100115156
332 Ga0075434_101644797
333 Ga0075429_100032821
334 Ga0068865_101060840
335 Ga0097620_100060328
336 Ga0097620_100267103
337 Ga0097620_100431758
338 Ga0097620_100812571
339 Ga0099794_10052874
340 Ga0105240_11454578
341 Ga0111539_10003311
342 Ga0111539_10009320
343 Ga0105245_10037222
344 Ga0105245_10048810
345 Ga0105247_10114064
346 Ga0105247_10461931
347 Ga0114129_10006482
348 Ga0114129_10020017
349 Ga0114129_10229957
350 Ga0114129_10971581
351 Ga0114129_12666111
352 Ga0105243_10232266
353 Ga0105241_10180132
354 Ga0105241_10350787
355 Ga0105242_10150608
356 Ga0105242_10519033
357 Ga0105242_10562881
358 Ga0105242_12320824
359 Ga0105248_10025057
360 Ga0105237_10387702
361 Ga0105237_12582218
362 Ga0105238_10027921
363 Ga0105238_10476695
364 Ga0105238_10963444
365 Ga0105249_12847485
366 Ga0105239_10015885
367 Ga0105239_11844604
368 Ga0157369_10150698
369 Ga0157369_10351743
370 Ga0157374_10225359
371 Ga0157374_10428865
372 Ga0157372_10475585
373 Ga0157372_10707602
374 Ga0157375_12495202
375 Ga0157375_12850121
376 Ga0163163_10032211
377 Ga0163163_10038151
378 Ga0163163_12164644
379 Ga0157379_10028387
380 Ga0157379_10029293
381 Ga0157379_10772849
382 Ga0157376_10203957
383 Ga0213876_10662778
384 Ga0207680_10023627
385 Ga0207654_10406377
386 Ga0207695_10209424
387 Ga0207695_11144666
388 Ga0207671_10176691
389 Ga0207671_10288906
390 Ga0207652_10669658
391 Ga0207646_10420978
392 Ga0207646_10566107
393 Ga0207694_10020746
394 Ga0207694_10280079
395 Ga0207694_10614402
396 Ga0207650_10214315
397 Ga0207687_10158575
398 Ga0207686_10387485
399 Ga0207670_10518973
400 Ga0207704_10602549
401 Ga0207711_10053860
402 Ga0207679_10148270
403 Ga0207667_10083190
404 Ga0207658_10292869
405 Ga0207677_10131198
406 Ga0207703_10019428
407 Ga0207703_10142366
408 Ga0207641_11384461
409 Ga0207674_11002571
410 Ga0207675_100801418
411 Ga0207675_101753134
412 Ga0207698_11548575
413 Ga0209588_1004935
414 Ga0207428_10001505
415 Ga0207428_10036899
416 Ga0268265_10300542
417 Ga0268264_10284332
418 Ga0268264_10478677
419 Ga0265338_10260005
420 Ga0265338_10706326
421 Ga0265330_10003572
422 Ga0265330_10451378
423 Ga0265329_10000299
424 Ga0265340_10285632
425 Ga0265339_10019216
426 Ga0265316_10000295
427 Ga0265313_10437812
428 Ga0265314_10013250
429 Ga0265314_10658002
430 Ga0265342_10000228
431 Ga0307405_10522552
432 Ga0307412_10413807
433 Ga0307414_10362367
434 Ga0373954_0177373
435 Ga0373954_0681486
436 Ga0373943_0797735
437 Ga0373924_0503683
438 Ga0316582_0118878
439 Ga0436365_1250548
440 Ga0451804_1010314
441 Ga0451835_0154339
442 Ga0451577_0000119
443 Ga0451577_0002137
444 Ga0451577_0003114
445 Ga0451577_0005416
446 Ga0451577_0009562
447 Ga0451577_0049670
448 Ga0451577_0076208
449 Ga0451577_1034799
450 Ga0453683_0000453
451 Ga0453683_0000898
452 Ga0453683_0004675
453 Ga0453683_0011393
454 Ga0453683_0015897
455 Ga0453683_0029838
456 Ga0453683_0222959
457 Ga0453683_0302397
458 Ga0453683_0519334
459 Ga0453683_0630620
460 Ga0466963_0972886
461 Ga0453684_0000258
462 Ga0453684_0003151
463 Ga0453684_0003741
464 Ga0453684_0016477
465 Ga0453684_0027459
466 Ga0453684_0042340
467 Ga0453684_0088466
468 Ga0453684_0543672
469 Ga0453684_0755710
470 Ga0453684_1520283
471 Ga0451576_0002115
472 Ga0451576_0007752
473 Ga0451576_0030641
474 Ga0451576_0371889
475 Ga0451576_0404105
476 Ga0451576_0411415
477 Ga0451576_0420225
478 Ga0451576_1280525
479 Ga0466967_2346762
480 Ga0495628_0134823
481 Ga0495630_0401412
482 Ga0495640_0351453
483 Ga0495621_0227952
484 Ga0495658_0569717
485 Ga0495636_0026854
486 Ga0495636_0219243
487 Ga0496109_1179109
488 Ga0496115_0398475
489 Ga0501042_1287361
490 Ga0501080_1087240
491 nmdc:mga05p37_174223_c1
492 nmdc:mga05p37_21228_c1
493 nmdc:mga05p37_9396_c1
494 nmdc:mga09592_4403_c1
495 nmdc:mga0qj67_351461_c1
496 nmdc:mga06r32_61530_c1
497 nmdc:mga06r32_788335_c1
498 nmdc:mga08y16_155963_c1
499 nmdc:mga08y16_6028_c1
500 nmdc:mga08y16_952770_c1
501 nmdc:mga0n895_136055_c1
502 nmdc:mga0n895_1446242_c1
503 nmdc:mga0n895_17581_c1
504 nmdc:mga0rr50_1028_c1
505 nmdc:mga08x19_19941_c1
506 nmdc:mga08x19_518417_c1
507 nmdc:mga0a205_410_c2
508 nmdc:mga0a205_93359_c1
509 Ga0495601_0995933
510 Ga0495595_0237684
511 Ga0500641_0254890
512 Ga0500556_0033538
513 Ga0500597_229383
514 Ga0500642_0059245
515 Ga0500658_0011730
516 Ga0500561_0171842
517 Ga0500568_0186143
518 Ga0500588_0001551
519 Ga0500622_0000811
520 Ga0500622_0387285
521 Ga0500637_0003595
522 Ga0501082_1443609

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01850

PIN

PIN domain

2

115

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5x3t-assembly1.cif.gz_H vapbc from mycobacterium tuberculosis 0.4769 2 115
1j9z-assembly2.cif.gz_B cypor-w677g 0.466 10 73
5wz4-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis vapc20 (rv2549c), sarcin-ricin loop cleaving toxin 0.4635 1 118
2dok-assembly3.cif.gz_B-2 crystal structure of the pin domain of human est1a 0.4632 3 72
5wzf-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis vapc20 (rv2549c), sarcin-ricin loop cleaving toxin 0.4619 1 118
ID Description Score Start End Superfamily
af_P9WF99_2_82_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.554 1 67 3.40.50.1010
af_Q3E911_201_282_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.5293 35 104 1.25.40.10
af_O53219_2_128_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.5208 3 117 3.40.50.1010
af_O53779_1_126_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.4996 3 107 3.40.50.1010
af_O49436_56_163_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.4923 6 105 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A2V8M089-F1-model_v4 PIN domain-containing protein 0.9976 1 64
AF-A0A7V5WNQ2-F1-model_v4 PIN domain-containing protein 0.9762 1 97
AF-A0A2V8M089-F1-model_v4 PIN domain-containing protein 0.9675 1 64
AF-A0A1W9I9A5-F1-model_v4 deleted 0.9657 1 126
AF-A0A4Q3T8F3-F1-model_v4 Type II toxin-antitoxin system VapC family toxin 0.9637 2 83

Map