F370254
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 261 | 149 | 258 | 190 |
Family's Representative Sequence
| Representative Sequence | 3300006237|Ga0097621_100670017|Ga0097621_1006700172 |
| Length | 214 |
| Sequence | MRARPPYRYEVMHMRYSKARWAVVLLCLTSLASAVASDAAISNSPPALKAGTFDPPRQAPDFDLLGSNSSALRISNFRGKVVLLAFGFTSCTAVCPTTLNTFAVARRKLAATAADVQVVYITVDPQRDNSARLKKYLDAFDPTFIGGTGTEQQLAAVRKSYGVSAQKQVAGDSYTYDHSSFTYLIDRSGRIRALMPYGHSPDDYVHDLTVLLKE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 2 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 3 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 4 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 5 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 29 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 31 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 32 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 33 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 34 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 35 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 36 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 37 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 38 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 39 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 40 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 42 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 43 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 44 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 45 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 46 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 47 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 48 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 49 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 97 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 101 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 102 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 103 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 104 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 105 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 106 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 107 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 108 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 109 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 110 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 111 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 112 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 113 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 114 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 115 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 116 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 117 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 118 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 119 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 127 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 128 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 129 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 130 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 131 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 132 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 133 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 134 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 135 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 136 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 137 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 138 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 139 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 140 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 141 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 142 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 143 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 144 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 145 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 146 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 147 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 148 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 149 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.85 |
| Metatranscriptomes | 0 |
| Isolates | 1.15 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.3 |
| Nodule | 0.38 |
| Rhizoplane | 2.68 |
| Rhizosphere | 81.61 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.03 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootL2_10202661 | 3300003322 | Bacteria | 1173 |
| 2 | rootL2_10293380 | 3300003322 | Bacteria | 1455 |
| 3 | rootH1_10240058 | 3300003323 | Bacteria | 1521 |
| 4 | Ga0070658_10022096 | 3300005327 | Bacteria | 5104 |
| 5 | Ga0070676_10142772 | 3300005328 | Bacteria | 1526 |
| 6 | Ga0070683_100019692 | 3300005329 | Bacteria | 5996 |
| 7 | Ga0070683_100351804 | 3300005329 | Bacteria | 1403 |
| 8 | Ga0070670_100252176 | 3300005331 | Bacteria | 1537 |
| 9 | Ga0068869_100137952 | 3300005334 | Bacteria | 1881 |
| 10 | Ga0070666_10322276 | 3300005335 | Bacteria | 1102 |
| 11 | Ga0070666_10326439 | 3300005335 | Unclassified | 1095 |
| 12 | Ga0070680_100015253 | 3300005336 | Bacteria | 6020 |
| 13 | Ga0070680_100024591 | 3300005336 | Bacteria | 4813 |
| 14 | Ga0070680_100252506 | 3300005336 | Bacteria | 1491 |
| 15 | Ga0070680_100569327 | 3300005336 | Bacteria | 971 |
| 16 | Ga0070682_100020897 | 3300005337 | Bacteria | 3857 |
| 17 | Ga0070661_100310231 | 3300005344 | Bacteria | 1230 |
| 18 | Ga0070661_100329447 | 3300005344 | Unclassified | 1194 |
| 19 | Ga0070692_10182579 | 3300005345 | Bacteria | 1217 |
| 20 | Ga0070668_100044616 | 3300005347 | Bacteria | 3400 |
| 21 | Ga0070669_100151983 | 3300005353 | Bacteria | 1793 |
| 22 | Ga0070671_100283034 | 3300005355 | Unclassified | 1410 |
| 23 | Ga0070673_100779759 | 3300005364 | Bacteria | 882 |
| 24 | Ga0070659_100075820 | 3300005366 | Bacteria | 2681 |
| 25 | Ga0070667_100108794 | 3300005367 | Bacteria | 2402 |
| 26 | Ga0070667_100225450 | 3300005367 | Bacteria | 1669 |
| 27 | Ga0070713_100093803 | 3300005436 | Unclassified | 2587 |
| 28 | Ga0070700_100063706 | 3300005441 | Bacteria | 2333 |
| 29 | Ga0070662_100021418 | 3300005457 | Bacteria | 4413 |
| 30 | Ga0070681_10000176 | 3300005458 | Bacteria | 48725 |
| 31 | Ga0070681_10009203 | 3300005458 | Bacteria | 9708 |
| 32 | Ga0070681_10051030 | 3300005458 | Bacteria | 4126 |
| 33 | Ga0070681_10094733 | 3300005458 | Bacteria | 2934 |
| 34 | Ga0070681_10142250 | 3300005458 | Bacteria | 2328 |
| 35 | Ga0070681_10346639 | 3300005458 | Bacteria | 1395 |
| 36 | Ga0070679_100044253 | 3300005530 | Bacteria | 4435 |
| 37 | Ga0070679_100058580 | 3300005530 | Bacteria | 3838 |
| 38 | Ga0070679_100291890 | 3300005530 | Bacteria | 1582 |
| 39 | Ga0070684_100015656 | 3300005535 | Bacteria | 6185 |
| 40 | Ga0070684_100183450 | 3300005535 | Bacteria | 1903 |
| 41 | Ga0070684_100190895 | 3300005535 | Bacteria | 1864 |
| 42 | Ga0068853_100167540 | 3300005539 | Bacteria | 1986 |
| 43 | Ga0068853_100760021 | 3300005539 | Unclassified | 926 |
| 44 | Ga0070665_100013207 | 3300005548 | Bacteria | 8319 |
| 45 | Ga0070665_100027519 | 3300005548 | Bacteria | 5727 |
| 46 | Ga0070665_100029524 | 3300005548 | Bacteria | 5519 |
| 47 | Ga0070665_100037593 | 3300005548 | Bacteria | 4867 |
| 48 | Ga0070665_100054900 | 3300005548 | Bacteria | 3995 |
| 49 | Ga0070665_100061829 | 3300005548 | Bacteria | 3754 |
| 50 | Ga0070665_100332273 | 3300005548 | Bacteria | 1524 |
| 51 | Ga0068855_100000482 | 3300005563 | Bacteria | 49178 |
| 52 | Ga0068855_100066365 | 3300005563 | Bacteria | 4207 |
| 53 | Ga0068857_100280315 | 3300005577 | Bacteria | 1533 |
| 54 | Ga0068857_100313417 | 3300005577 | Bacteria | 1448 |
| 55 | Ga0068856_100042650 | 3300005614 | Bacteria | 4463 |
| 56 | Ga0068856_101424637 | 3300005614 | Bacteria | 707 |
| 57 | Ga0068852_100267340 | 3300005616 | Unclassified | 1644 |
| 58 | Ga0068861_100064512 | 3300005719 | Bacteria | 2818 |
| 59 | Ga0068861_101176056 | 3300005719 | Unclassified | 740 |
| 60 | Ga0068863_100156186 | 3300005841 | Bacteria | 2184 |
| 61 | Ga0068863_100834043 | 3300005841 | Bacteria | 920 |
| 62 | Ga0068858_100002222 | 3300005842 | Bacteria | 19632 |
| 63 | Ga0068858_100273773 | 3300005842 | Bacteria | 1607 |
| 64 | Ga0068860_100000296 | 3300005843 | Bacteria | 69084 |
| 65 | Ga0068862_100009624 | 3300005844 | Bacteria | 7987 |
| 66 | Ga0068862_100040751 | 3300005844 | Bacteria | 3948 |
| 67 | Ga0068862_100234745 | 3300005844 | Unclassified | 1665 |
| 68 | Ga0081455_10000140 | 3300005937 | Bacteria | 84977 |
| 69 | Ga0097621_100670017 | 3300006237 | Unclassified | 953 |
| 70 | Ga0068871_100072206 | 3300006358 | Bacteria | 2842 |
| 71 | Ga0075428_100048159 | 3300006844 | Bacteria | 4679 |
| 72 | Ga0075430_100002507 | 3300006846 | Bacteria | 15307 |
| 73 | Ga0075430_100206137 | 3300006846 | Bacteria | 1632 |
| 74 | Ga0075431_100020432 | 3300006847 | Bacteria | 6766 |
| 75 | Ga0075429_100103890 | 3300006880 | Bacteria | 2481 |
| 76 | Ga0099826_10062883 | 3300006948 | Bacteria | 2402 |
| 77 | Ga0099794_10053512 | 3300007265 | Bacteria | 1946 |
| 78 | Ga0099795_10190324 | 3300007788 | Bacteria | 861 |
| 79 | Ga0105240_10002942 | 3300009093 | Bacteria | 26855 |
| 80 | Ga0105240_10007565 | 3300009093 | Bacteria | 15741 |
| 81 | Ga0105240_10014732 | 3300009093 | Bacteria | 10667 |
| 82 | Ga0105240_10034295 | 3300009093 | Bacteria | 6547 |
| 83 | Ga0105240_10382419 | 3300009093 | Bacteria | 1589 |
| 84 | Ga0105240_10670684 | 3300009093 | Unclassified | 1134 |
| 85 | Ga0111539_10060969 | 3300009094 | Bacteria | 4470 |
| 86 | Ga0111539_10201575 | 3300009094 | Bacteria | 2320 |
| 87 | Ga0105247_10000867 | 3300009101 | Bacteria | 22861 |
| 88 | Ga0114129_10012970 | 3300009147 | Bacteria | 11863 |
| 89 | Ga0114129_10416636 | 3300009147 | Bacteria | 1768 |
| 90 | Ga0105243_10757694 | 3300009148 | Bacteria | 952 |
| 91 | Ga0105243_11165067 | 3300009148 | Unclassified | 782 |
| 92 | Ga0105248_10775753 | 3300009177 | Bacteria | 1082 |
| 93 | Ga0105237_10090329 | 3300009545 | Bacteria | 3052 |
| 94 | Ga0105237_10091608 | 3300009545 | Bacteria | 3030 |
| 95 | Ga0105237_10129019 | 3300009545 | Bacteria | 2523 |
| 96 | Ga0105237_10211798 | 3300009545 | Unclassified | 1938 |
| 97 | Ga0105237_10460225 | 3300009545 | Bacteria | 1278 |
| 98 | Ga0105237_10518063 | 3300009545 | Bacteria | 1199 |
| 99 | Ga0105237_10627945 | 3300009545 | Bacteria | 1081 |
| 100 | Ga0105238_10000745 | 3300009551 | Bacteria | 33998 |
| 101 | Ga0105238_10072943 | 3300009551 | Bacteria | 3427 |
| 102 | Ga0105238_10538051 | 3300009551 | Bacteria | 1172 |
| 103 | Ga0105249_10025778 | 3300009553 | Bacteria | 5295 |
| 104 | Ga0105249_10123845 | 3300009553 | Bacteria | 2460 |
| 105 | Ga0105239_10930521 | 3300010375 | Bacteria | 998 |
| 106 | Ga0105246_10770853 | 3300011119 | Unclassified | 850 |
| 107 | Ga0157370_10002748 | 3300013104 | Bacteria | 21027 |
| 108 | Ga0157370_10178071 | 3300013104 | Bacteria | 1976 |
| 109 | Ga0157370_10428384 | 3300013104 | Unclassified | 1217 |
| 110 | Ga0157369_10002834 | 3300013105 | Bacteria | 20690 |
| 111 | Ga0157369_10042638 | 3300013105 | Bacteria | 4949 |
| 112 | Ga0157369_10105697 | 3300013105 | Bacteria | 2997 |
| 113 | Ga0157369_10132689 | 3300013105 | Bacteria | 2638 |
| 114 | Ga0157369_10334419 | 3300013105 | Bacteria | 1573 |
| 115 | Ga0157374_10174004 | 3300013296 | Bacteria | 2101 |
| 116 | Ga0157374_10464432 | 3300013296 | Bacteria | 1268 |
| 117 | Ga0163162_10223611 | 3300013306 | Bacteria | 2012 |
| 118 | Ga0157372_10295036 | 3300013307 | Bacteria | 1885 |
| 119 | Ga0157372_10687900 | 3300013307 | Unclassified | 1190 |
| 120 | Ga0163163_10023119 | 3300014325 | Bacteria | 5896 |
| 121 | Ga0157379_10049684 | 3300014968 | Bacteria | 3745 |
| 122 | Ga0157379_10137832 | 3300014968 | Bacteria | 2199 |
| 123 | Ga0157379_10146708 | 3300014968 | Bacteria | 2128 |
| 124 | Ga0157379_10219184 | 3300014968 | Bacteria | 1724 |
| 125 | Ga0157376_10149637 | 3300014969 | Bacteria | 2104 |
| 126 | Ga0157376_10231145 | 3300014969 | Bacteria | 1718 |
| 127 | Ga0207680_10142284 | 3300025903 | Bacteria | 1591 |
| 128 | Ga0207680_10206499 | 3300025903 | Bacteria | 1341 |
| 129 | Ga0207645_10141076 | 3300025907 | Bacteria | 1570 |
| 130 | Ga0207707_10019089 | 3300025912 | Bacteria | 5982 |
| 131 | Ga0207707_10052889 | 3300025912 | Bacteria | 3534 |
| 132 | Ga0207707_10121724 | 3300025912 | Bacteria | 2281 |
| 133 | Ga0207707_10195107 | 3300025912 | Bacteria | 1766 |
| 134 | Ga0207671_10025761 | 3300025914 | Bacteria | 4414 |
| 135 | Ga0207671_10090701 | 3300025914 | Bacteria | 2302 |
| 136 | Ga0207671_10133837 | 3300025914 | Bacteria | 1905 |
| 137 | Ga0207660_10033416 | 3300025917 | Bacteria | 3559 |
| 138 | Ga0207660_10101857 | 3300025917 | Bacteria | 2146 |
| 139 | Ga0207660_10195232 | 3300025917 | Unclassified | 1578 |
| 140 | Ga0207660_10397712 | 3300025917 | Bacteria | 1109 |
| 141 | Ga0207649_10335518 | 3300025920 | Bacteria | 1115 |
| 142 | Ga0207652_10026989 | 3300025921 | Bacteria | 4785 |
| 143 | Ga0207652_10073118 | 3300025921 | Bacteria | 2982 |
| 144 | Ga0207652_10184588 | 3300025921 | Unclassified | 1875 |
| 145 | Ga0207652_10359520 | 3300025921 | Bacteria | 1314 |
| 146 | Ga0207681_10237911 | 3300025923 | Bacteria | 1416 |
| 147 | Ga0207694_10031588 | 3300025924 | Bacteria | 4046 |
| 148 | Ga0207694_10286767 | 3300025924 | Unclassified | 1353 |
| 149 | Ga0207694_10731034 | 3300025924 | Unclassified | 835 |
| 150 | Ga0207700_10429237 | 3300025928 | Bacteria | 1162 |
| 151 | Ga0207706_10017412 | 3300025933 | Bacteria | 6473 |
| 152 | Ga0207709_10531820 | 3300025935 | Bacteria | 922 |
| 153 | Ga0207704_10644939 | 3300025938 | Bacteria | 872 |
| 154 | Ga0207689_10394714 | 3300025942 | Bacteria | 1153 |
| 155 | Ga0207661_10027813 | 3300025944 | Unclassified | 4324 |
| 156 | Ga0207661_10035931 | 3300025944 | Bacteria | 3865 |
| 157 | Ga0207667_10037806 | 3300025949 | Bacteria | 5159 |
| 158 | Ga0207667_10093240 | 3300025949 | Bacteria | 3110 |
| 159 | Ga0207667_10360842 | 3300025949 | Bacteria | 1481 |
| 160 | Ga0207712_10055191 | 3300025961 | Bacteria | 2793 |
| 161 | Ga0207712_10083361 | 3300025961 | Bacteria | 2333 |
| 162 | Ga0207668_10032978 | 3300025972 | Bacteria | 3428 |
| 163 | Ga0207703_10000415 | 3300026035 | Bacteria | 45514 |
| 164 | Ga0207639_10070084 | 3300026041 | Bacteria | 2738 |
| 165 | Ga0207678_10413799 | 3300026067 | Unclassified | 1169 |
| 166 | Ga0207708_10049759 | 3300026075 | Bacteria | 3191 |
| 167 | Ga0207702_10244908 | 3300026078 | Bacteria | 1681 |
| 168 | Ga0207702_11031327 | 3300026078 | Bacteria | 816 |
| 169 | Ga0207641_10002406 | 3300026088 | Bacteria | 17287 |
| 170 | Ga0207674_10073430 | 3300026116 | Bacteria | 3434 |
| 171 | Ga0207675_100003205 | 3300026118 | Bacteria | 16049 |
| 172 | Ga0207675_100008556 | 3300026118 | Bacteria | 9626 |
| 173 | Ga0207675_100456357 | 3300026118 | Bacteria | 1267 |
| 174 | Ga0207698_10342562 | 3300026142 | Unclassified | 1409 |
| 175 | Ga0209179_1046642 | 3300027512 | Unclassified | 922 |
| 176 | Ga0207428_10118804 | 3300027907 | Bacteria | 2029 |
| 177 | Ga0268266_10001570 | 3300028379 | Bacteria | 26707 |
| 178 | Ga0268266_10010721 | 3300028379 | Bacteria | 7985 |
| 179 | Ga0268266_10084602 | 3300028379 | Bacteria | 2770 |
| 180 | Ga0268266_10115454 | 3300028379 | Bacteria | 2383 |
| 181 | Ga0268266_10378382 | 3300028379 | Unclassified | 1335 |
| 182 | Ga0268265_10001552 | 3300028380 | Bacteria | 19040 |
| 183 | Ga0268265_10033532 | 3300028380 | Bacteria | 3734 |
| 184 | Ga0268265_10267837 | 3300028380 | Unclassified | 1522 |
| 185 | Ga0268264_10000088 | 3300028381 | Bacteria | 235344 |
| 186 | Ga0268264_10755965 | 3300028381 | Unclassified | 969 |
| 187 | Ga0265334_10006156 | 3300028573 | Bacteria | 5196 |
| 188 | Ga0307511_10000260 | 3300030521 | Bacteria | 54540 |
| 189 | Ga0265331_10007424 | 3300031250 | Bacteria | 6343 |
| 190 | Ga0265331_10115075 | 3300031250 | Unclassified | 1232 |
| 191 | Ga0307408_100060854 | 3300031548 | Bacteria | 2754 |
| 192 | Ga0307408_100337100 | 3300031548 | Bacteria | 1275 |
| 193 | Ga0307508_10346145 | 3300031616 | Bacteria | 1078 |
| 194 | Ga0307516_10001288 | 3300031730 | Bacteria | 34892 |
| 195 | Ga0307406_10456520 | 3300031901 | Unclassified | 1026 |
| 196 | Ga0307510_10000008 | 3300033180 | Bacteria | 433990 |
| 197 | Ga0307510_10024198 | 3300033180 | Bacteria | 7021 |
| 198 | Ga0373936_0013458 | 3300035113 | Bacteria | 3122 |
| 199 | Ga0373936_0072696 | 3300035113 | Unclassified | 1420 |
| 200 | Ga0395905_0159671 | 3300037471 | Bacteria | 2119 |
| 201 | Ga0395901_1065049 | 3300038443 | Unclassified | 781 |
| 202 | Ga0436363_1191838 | 3300039450 | Unclassified | 1106 |
| 203 | Ga0450896_032236 | 3300042133 | Bacteria | 797 |
| 204 | Ga0450898_000813 | 3300042134 | Bacteria | 3864 |
| 205 | Ga0466969_0030463 | 3300044656 | Bacteria | 2749 |
| 206 | Ga0466966_0084668 | 3300044684 | Bacteria | 1972 |
| 207 | Ga0466970_0382618 | 3300044765 | Unclassified | 801 |
| 208 | Ga0466959_0004915 | 3300045049 | Bacteria | 9053 |
| 209 | Ga0451576_1768775 | 3300045051 | Unclassified | 639 |
| 210 | Ga0495638_0108016 | 3300046460 | Bacteria | 1656 |
| 211 | Ga0495606_0231291 | 3300046507 | Bacteria | 1036 |
| 212 | Ga0495610_0204742 | 3300046512 | Unclassified | 806 |
| 213 | Ga0495632_0104683 | 3300046519 | Bacteria | 1332 |
| 214 | Ga0495598_0233931 | 3300046537 | Bacteria | 675 |
| 215 | Ga0495668_0165359 | 3300046616 | Bacteria | 1212 |
| 216 | Ga0495625_0271708 | 3300046660 | Bacteria | 1093 |
| 217 | Ga0496102_0002316 | 3300048905 | Bacteria | 16258 |
| 218 | Ga0496102_0042364 | 3300048905 | Bacteria | 4125 |
| 219 | Ga0496103_0022008 | 3300048906 | Bacteria | 3837 |
| 220 | Ga0496108_0617970 | 3300048911 | Unclassified | 944 |
| 221 | Ga0496112_0045626 | 3300048915 | Bacteria | 4297 |
| 222 | Ga0496113_0397840 | 3300048916 | Bacteria | 1106 |
| 223 | Ga0496114_0184293 | 3300048917 | Bacteria | 1824 |
| 224 | Ga0496116_0004130 | 3300048919 | Bacteria | 13990 |
| 225 | Ga0496117_0000117 | 3300048920 | Bacteria | 177596 |
| 226 | Ga0496118_0000025 | 3300048921 | Bacteria | 379363 |
| 227 | Ga0496118_0051110 | 3300048921 | Bacteria | 3165 |
| 228 | Ga0496119_0004103 | 3300048922 | Bacteria | 14685 |
| 229 | Ga0496119_0004474 | 3300048922 | Bacteria | 13898 |
| 230 | Ga0496119_0147693 | 3300048922 | Unclassified | 1263 |
| 231 | Ga0496119_0237114 | 3300048922 | Bacteria | 925 |
| 232 | Ga0496120_0000098 | 3300048923 | Bacteria | 145165 |
| 233 | Ga0496120_0023255 | 3300048923 | Bacteria | 3881 |
| 234 | Ga0496120_0032813 | 3300048923 | Bacteria | 3126 |
| 235 | Ga0496121_0006502 | 3300048924 | Bacteria | 14456 |
| 236 | Ga0496121_0015152 | 3300048924 | Bacteria | 8107 |
| 237 | Ga0496121_0103346 | 3300048924 | Bacteria | 2192 |
| 238 | Ga0496121_0142807 | 3300048924 | Bacteria | 1773 |
| 239 | Ga0496124_0071181 | 3300048927 | Bacteria | 2883 |
| 240 | Ga0496125_0000416 | 3300048928 | Bacteria | 79287 |
| 241 | Ga0496125_0023876 | 3300048928 | Bacteria | 5634 |
| 242 | Ga0496125_0039847 | 3300048928 | Bacteria | 4038 |
| 243 | Ga0496126_0013978 | 3300048929 | Bacteria | 8139 |
| 244 | Ga0496126_0086767 | 3300048929 | Bacteria | 2758 |
| 245 | Ga0496126_0309613 | 3300048929 | Unclassified | 1301 |
| 246 | nmdc:mga05p37_1497_c1 | 3300050507 | Bacteria | 27123 |
| 247 | nmdc:mga05p37_386035_c1 | 3300050507 | Bacteria | 1639 |
| 248 | nmdc:mga09592_537_c1 | 3300050508 | Bacteria | 28691 |
| 249 | nmdc:mga0qj67_10621_c1 | 3300050509 | Bacteria | 6880 |
| 250 | nmdc:mga06r32_5829_c1 | 3300050510 | Bacteria | 11095 |
| 251 | nmdc:mga08y16_128254_c1 | 3300050511 | Bacteria | 2639 |
| 252 | nmdc:mga08y16_65306_c1 | 3300050511 | Bacteria | 3799 |
| 253 | Ga0500641_0176687 | 3300053096 | Unclassified | 918 |
| 254 | Ga0500568_0131809 | 3300053139 | Unclassified | 929 |
| 255 | Ga0500616_0000016 | 3300053153 | Bacteria | 627087 |
| 256 | Ga0500637_0002700 | 3300053178 | Bacteria | 7959 |
| 257 | Ga0500637_0010462 | 3300053178 | Bacteria | 4759 |
| 258 | Ga0500637_0365381 | 3300053178 | Unclassified | 762 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005335 | Ga0070666_10326439 | Ga0070666_103264392 | 168 |
| 2 | 3300005367 | Ga0070667_100108794 | Ga0070667_1001087943 | 168 |
| 3 | 3300005548 | Ga0070665_100029524 | Ga0070665_1000295243 | 168 |
| 4 | 3300005563 | Ga0068855_100066365 | Ga0068855_1000663652 | 168 |
| 5 | 3300009093 | Ga0105240_10007565 | Ga0105240_100075658 | 168 |
| 6 | 3300009545 | Ga0105237_10090329 | Ga0105237_100903294 | 168 |
| 7 | 3300013296 | Ga0157374_10174004 | Ga0157374_101740042 | 168 |
| 8 | 3300037471 | Ga0395905_0159671 | Ga0395905_0159671_1451_2032 | 169 |
| 9 | 3300042134 | Ga0450898_000813 | Ga0450898_000813_636_1217 | 169 |
| 10 | 3300009551 | Ga0105238_10072943 | Ga0105238_100729433 | 170 |
| 11 | 3300031250 | Ga0265331_10115075 | Ga0265331_101150752 | 170 |
| 12 | 3300048921 | Ga0496118_0051110 | Ga0496118_0051110_268_903 | 170 |
| 13 | 3300053153 | Ga0500616_0000016 | Ga0500616_0000016_395813_396334 | 170 |
| 14 | 3300009545 | Ga0105237_10627945 | Ga0105237_106279452 | 171 |
| 15 | 3300046460 | Ga0495638_0108016 | Ga0495638_0108016_829_1365 | 171 |
| 16 | 3300046512 | Ga0495610_0204742 | Ga0495610_0204742_152_688 | 171 |
| 17 | 3300048923 | Ga0496120_0023255 | Ga0496120_0023255_36_572 | 171 |
| 18 | 3300005335 | Ga0070666_10322276 | Ga0070666_103222762 | 172 |
| 19 | 3300005355 | Ga0070671_100283034 | Ga0070671_1002830341 | 172 |
| 20 | 3300005367 | Ga0070667_100225450 | Ga0070667_1002254503 | 172 |
| 21 | 3300005539 | Ga0068853_100760021 | Ga0068853_1007600212 | 172 |
| 22 | 3300005548 | Ga0070665_100054900 | Ga0070665_1000549005 | 172 |
| 23 | 3300005719 | Ga0068861_100064512 | Ga0068861_1000645124 | 172 |
| 24 | 3300005841 | Ga0068863_100156186 | Ga0068863_1001561862 | 172 |
| 25 | 3300005842 | Ga0068858_100002222 | Ga0068858_1000022226 | 172 |
| 26 | 3300005843 | Ga0068860_100000296 | Ga0068860_10000029655 | 172 |
| 27 | 3300009093 | Ga0105240_10014732 | Ga0105240_100147325 | 172 |
| 28 | 3300009093 | Ga0105240_10670684 | Ga0105240_106706842 | 172 |
| 29 | 3300009551 | Ga0105238_10538051 | Ga0105238_105380512 | 172 |
| 30 | 3300011119 | Ga0105246_10770853 | Ga0105246_107708531 | 172 |
| 31 | 3300013105 | Ga0157369_10105697 | Ga0157369_101056972 | 172 |
| 32 | 3300013306 | Ga0163162_10223611 | Ga0163162_102236112 | 172 |
| 33 | 3300014969 | Ga0157376_10149637 | Ga0157376_101496372 | 172 |
| 34 | 3300025903 | Ga0207680_10142284 | Ga0207680_101422842 | 172 |
| 35 | 3300025949 | Ga0207667_10360842 | Ga0207667_103608422 | 172 |
| 36 | 3300026035 | Ga0207703_10000415 | Ga0207703_1000041523 | 172 |
| 37 | 3300026041 | Ga0207639_10070084 | Ga0207639_100700844 | 172 |
| 38 | 3300026067 | Ga0207678_10413799 | Ga0207678_104137992 | 172 |
| 39 | 3300026088 | Ga0207641_10002406 | Ga0207641_1000240613 | 172 |
| 40 | 3300026118 | Ga0207675_100008556 | Ga0207675_1000085569 | 172 |
| 41 | 3300028379 | Ga0268266_10378382 | Ga0268266_103783822 | 172 |
| 42 | 3300028381 | Ga0268264_10000088 | Ga0268264_1000008859 | 172 |
| 43 | 3300048922 | Ga0496119_0147693 | Ga0496119_0147693_478_1050 | 172 |
| 44 | 3300048928 | Ga0496125_0000416 | Ga0496125_0000416_73070_73642 | 172 |
| 45 | 3300048929 | Ga0496126_0309613 | Ga0496126_0309613_384_956 | 172 |
| 46 | 3300009101 | Ga0105247_10000867 | Ga0105247_100008677 | 173 |
| 47 | 3300009177 | Ga0105248_10775753 | Ga0105248_107757532 | 173 |
| 48 | 3300014325 | Ga0163163_10023119 | Ga0163163_100231193 | 173 |
| 49 | 3300014968 | Ga0157379_10146708 | Ga0157379_101467082 | 173 |
| 50 | 3300035113 | Ga0373936_0013458 | Ga0373936_0013458_2471_3013 | 173 |
| 51 | 3300048911 | Ga0496108_0617970 | Ga0496108_0617970_88_681 | 173 |
| 52 | 3300048915 | Ga0496112_0045626 | Ga0496112_0045626_3216_3809 | 173 |
| 53 | 3300048916 | Ga0496113_0397840 | Ga0496113_0397840_34_627 | 173 |
| 54 | 3300048924 | Ga0496121_0006502 | Ga0496121_0006502_1995_2588 | 173 |
| 55 | 3300048928 | Ga0496125_0023876 | Ga0496125_0023876_2122_2715 | 173 |
| 56 | 3300006948 | Ga0099826_10062883 | Ga0099826_100628832 | 175 |
| 57 | 3300005336 | Ga0070680_100024591 | Ga0070680_1000245912 | 176 |
| 58 | 3300005337 | Ga0070682_100020897 | Ga0070682_1000208973 | 176 |
| 59 | 3300005458 | Ga0070681_10142250 | Ga0070681_101422503 | 176 |
| 60 | 3300005530 | Ga0070679_100044253 | Ga0070679_1000442535 | 176 |
| 61 | 3300005539 | Ga0068853_100167540 | Ga0068853_1001675403 | 176 |
| 62 | 3300005563 | Ga0068855_100000482 | Ga0068855_10000048215 | 176 |
| 63 | 3300005614 | Ga0068856_101424637 | Ga0068856_1014246371 | 176 |
| 64 | 3300007788 | Ga0099795_10190324 | Ga0099795_101903242 | 176 |
| 65 | 3300009093 | Ga0105240_10034295 | Ga0105240_100342955 | 176 |
| 66 | 3300009545 | Ga0105237_10129019 | Ga0105237_101290192 | 176 |
| 67 | 3300009551 | Ga0105238_10000745 | Ga0105238_1000074527 | 176 |
| 68 | 3300010375 | Ga0105239_10930521 | Ga0105239_109305211 | 176 |
| 69 | 3300013104 | Ga0157370_10002748 | Ga0157370_1000274816 | 176 |
| 70 | 3300013105 | Ga0157369_10002834 | Ga0157369_1000283416 | 176 |
| 71 | 3300025912 | Ga0207707_10019089 | Ga0207707_100190896 | 176 |
| 72 | 3300025914 | Ga0207671_10090701 | Ga0207671_100907012 | 176 |
| 73 | 3300025917 | Ga0207660_10033416 | Ga0207660_100334164 | 176 |
| 74 | 3300025921 | Ga0207652_10026989 | Ga0207652_100269894 | 176 |
| 75 | 3300026078 | Ga0207702_11031327 | Ga0207702_110313271 | 176 |
| 76 | 3300048922 | Ga0496119_0004103 | Ga0496119_0004103_573_1127 | 176 |
| 77 | 3300048923 | Ga0496120_0000098 | Ga0496120_0000098_37383_37937 | 176 |
| 78 | 3300053178 | Ga0500637_0010462 | Ga0500637_0010462_3332_3871 | 176 |
| 79 | 3300005353 | Ga0070669_100151983 | Ga0070669_1001519833 | 177 |
| 80 | 3300005614 | Ga0068856_100042650 | Ga0068856_1000426502 | 177 |
| 81 | 3300009093 | Ga0105240_10382419 | Ga0105240_103824192 | 177 |
| 82 | 3300009545 | Ga0105237_10518063 | Ga0105237_105180632 | 177 |
| 83 | 3300013105 | Ga0157369_10334419 | Ga0157369_103344192 | 177 |
| 84 | 3300025923 | Ga0207681_10237911 | Ga0207681_102379112 | 177 |
| 85 | 3300026078 | Ga0207702_10244908 | Ga0207702_102449082 | 177 |
| 86 | 3300046537 | Ga0495598_0233931 | Ga0495598_0233931_103_660 | 177 |
| 87 | iso_pu_bacteria | 2643221585 | 2643934599 | 177 |
| 88 | iso_pu_bacteria | 2643221656 | 2644316085 | 177 |
| 89 | 3300003323 | rootH1_10240058 | rootH1_102400583 | 178 |
| 90 | 3300005331 | Ga0070670_100252176 | Ga0070670_1002521762 | 178 |
| 91 | 3300005364 | Ga0070673_100779759 | Ga0070673_1007797592 | 178 |
| 92 | 3300009545 | Ga0105237_10091608 | Ga0105237_100916085 | 178 |
| 93 | 3300014968 | Ga0157379_10137832 | Ga0157379_101378322 | 178 |
| 94 | 3300039450 | Ga0436363_1191838 | Ga0436363_1191838_308_910 | 178 |
| 95 | 3300046616 | Ga0495668_0165359 | Ga0495668_0165359_504_1100 | 178 |
| 96 | 3300003322 | rootL2_10202661 | rootL2_102026611 | 179 |
| 97 | 3300003322 | rootL2_10293380 | rootL2_102933802 | 179 |
| 98 | 3300005327 | Ga0070658_10022096 | Ga0070658_100220962 | 179 |
| 99 | 3300005328 | Ga0070676_10142772 | Ga0070676_101427722 | 179 |
| 100 | 3300005329 | Ga0070683_100019692 | Ga0070683_1000196923 | 179 |
| 101 | 3300005329 | Ga0070683_100351804 | Ga0070683_1003518042 | 179 |
| 102 | 3300005334 | Ga0068869_100137952 | Ga0068869_1001379522 | 179 |
| 103 | 3300005336 | Ga0070680_100015253 | Ga0070680_1000152534 | 179 |
| 104 | 3300005336 | Ga0070680_100252506 | Ga0070680_1002525062 | 179 |
| 105 | 3300005336 | Ga0070680_100569327 | Ga0070680_1005693272 | 179 |
| 106 | 3300005344 | Ga0070661_100310231 | Ga0070661_1003102312 | 179 |
| 107 | 3300005344 | Ga0070661_100329447 | Ga0070661_1003294471 | 179 |
| 108 | 3300005345 | Ga0070692_10182579 | Ga0070692_101825792 | 179 |
| 109 | 3300005347 | Ga0070668_100044616 | Ga0070668_1000446164 | 179 |
| 110 | 3300005366 | Ga0070659_100075820 | Ga0070659_1000758203 | 179 |
| 111 | 3300005436 | Ga0070713_100093803 | Ga0070713_1000938034 | 179 |
| 112 | 3300005441 | Ga0070700_100063706 | Ga0070700_1000637063 | 179 |
| 113 | 3300005457 | Ga0070662_100021418 | Ga0070662_1000214185 | 179 |
| 114 | 3300005458 | Ga0070681_10000176 | Ga0070681_1000017613 | 179 |
| 115 | 3300005458 | Ga0070681_10009203 | Ga0070681_100092033 | 179 |
| 116 | 3300005458 | Ga0070681_10051030 | Ga0070681_100510303 | 179 |
| 117 | 3300005458 | Ga0070681_10094733 | Ga0070681_100947334 | 179 |
| 118 | 3300005458 | Ga0070681_10346639 | Ga0070681_103466392 | 179 |
| 119 | 3300005530 | Ga0070679_100058580 | Ga0070679_1000585803 | 179 |
| 120 | 3300005530 | Ga0070679_100291890 | Ga0070679_1002918902 | 179 |
| 121 | 3300005535 | Ga0070684_100015656 | Ga0070684_1000156566 | 179 |
| 122 | 3300005535 | Ga0070684_100183450 | Ga0070684_1001834502 | 179 |
| 123 | 3300005535 | Ga0070684_100190895 | Ga0070684_1001908952 | 179 |
| 124 | 3300005548 | Ga0070665_100013207 | Ga0070665_1000132076 | 179 |
| 125 | 3300005548 | Ga0070665_100027519 | Ga0070665_1000275192 | 179 |
| 126 | 3300005548 | Ga0070665_100037593 | Ga0070665_1000375934 | 179 |
| 127 | 3300005548 | Ga0070665_100061829 | Ga0070665_1000618292 | 179 |
| 128 | 3300005548 | Ga0070665_100332273 | Ga0070665_1003322732 | 179 |
| 129 | 3300005577 | Ga0068857_100280315 | Ga0068857_1002803152 | 179 |
| 130 | 3300005577 | Ga0068857_100313417 | Ga0068857_1003134173 | 179 |
| 131 | 3300005616 | Ga0068852_100267340 | Ga0068852_1002673402 | 179 |
| 132 | 3300005719 | Ga0068861_101176056 | Ga0068861_1011760561 | 179 |
| 133 | 3300005841 | Ga0068863_100834043 | Ga0068863_1008340432 | 179 |
| 134 | 3300005842 | Ga0068858_100273773 | Ga0068858_1002737732 | 179 |
| 135 | 3300005844 | Ga0068862_100009624 | Ga0068862_1000096243 | 179 |
| 136 | 3300005844 | Ga0068862_100040751 | Ga0068862_1000407514 | 179 |
| 137 | 3300005844 | Ga0068862_100234745 | Ga0068862_1002347452 | 179 |
| 138 | 3300005937 | Ga0081455_10000140 | Ga0081455_1000014014 | 179 |
| 139 | 3300006237 | Ga0097621_100670017 | Ga0097621_1006700172 | 179 |
| 140 | 3300006358 | Ga0068871_100072206 | Ga0068871_1000722065 | 179 |
| 141 | 3300006844 | Ga0075428_100048159 | Ga0075428_1000481592 | 179 |
| 142 | 3300006846 | Ga0075430_100002507 | Ga0075430_10000250711 | 179 |
| 143 | 3300006846 | Ga0075430_100206137 | Ga0075430_1002061372 | 179 |
| 144 | 3300006847 | Ga0075431_100020432 | Ga0075431_1000204326 | 179 |
| 145 | 3300006880 | Ga0075429_100103890 | Ga0075429_1001038904 | 179 |
| 146 | 3300007265 | Ga0099794_10053512 | Ga0099794_100535121 | 179 |
| 147 | 3300009093 | Ga0105240_10002942 | Ga0105240_1000294226 | 179 |
| 148 | 3300009094 | Ga0111539_10060969 | Ga0111539_100609692 | 179 |
| 149 | 3300009094 | Ga0111539_10201575 | Ga0111539_102015752 | 179 |
| 150 | 3300009147 | Ga0114129_10012970 | Ga0114129_100129708 | 179 |
| 151 | 3300009147 | Ga0114129_10416636 | Ga0114129_104166362 | 179 |
| 152 | 3300009148 | Ga0105243_10757694 | Ga0105243_107576941 | 179 |
| 153 | 3300009148 | Ga0105243_11165067 | Ga0105243_111650671 | 179 |
| 154 | 3300009545 | Ga0105237_10211798 | Ga0105237_102117983 | 179 |
| 155 | 3300009545 | Ga0105237_10460225 | Ga0105237_104602252 | 179 |
| 156 | 3300009553 | Ga0105249_10025778 | Ga0105249_100257784 | 179 |
| 157 | 3300009553 | Ga0105249_10123845 | Ga0105249_101238452 | 179 |
| 158 | 3300013104 | Ga0157370_10178071 | Ga0157370_101780712 | 179 |
| 159 | 3300013104 | Ga0157370_10428384 | Ga0157370_104283842 | 179 |
| 160 | 3300013105 | Ga0157369_10042638 | Ga0157369_100426382 | 179 |
| 161 | 3300013105 | Ga0157369_10132689 | Ga0157369_101326894 | 179 |
| 162 | 3300013296 | Ga0157374_10464432 | Ga0157374_104644322 | 179 |
| 163 | 3300013307 | Ga0157372_10295036 | Ga0157372_102950363 | 179 |
| 164 | 3300013307 | Ga0157372_10687900 | Ga0157372_106879002 | 179 |
| 165 | 3300014968 | Ga0157379_10049684 | Ga0157379_100496844 | 179 |
| 166 | 3300014968 | Ga0157379_10219184 | Ga0157379_102191842 | 179 |
| 167 | 3300014969 | Ga0157376_10231145 | Ga0157376_102311452 | 179 |
| 168 | 3300025903 | Ga0207680_10206499 | Ga0207680_102064992 | 179 |
| 169 | 3300025907 | Ga0207645_10141076 | Ga0207645_101410762 | 179 |
| 170 | 3300025912 | Ga0207707_10052889 | Ga0207707_100528893 | 179 |
| 171 | 3300025912 | Ga0207707_10121724 | Ga0207707_101217242 | 179 |
| 172 | 3300025912 | Ga0207707_10195107 | Ga0207707_101951071 | 179 |
| 173 | 3300025914 | Ga0207671_10025761 | Ga0207671_100257613 | 179 |
| 174 | 3300025914 | Ga0207671_10133837 | Ga0207671_101338373 | 179 |
| 175 | 3300025917 | Ga0207660_10101857 | Ga0207660_101018572 | 179 |
| 176 | 3300025917 | Ga0207660_10195232 | Ga0207660_101952322 | 179 |
| 177 | 3300025917 | Ga0207660_10397712 | Ga0207660_103977122 | 179 |
| 178 | 3300025920 | Ga0207649_10335518 | Ga0207649_103355182 | 179 |
| 179 | 3300025921 | Ga0207652_10073118 | Ga0207652_100731183 | 179 |
| 180 | 3300025921 | Ga0207652_10184588 | Ga0207652_101845883 | 179 |
| 181 | 3300025921 | Ga0207652_10359520 | Ga0207652_103595202 | 179 |
| 182 | 3300025924 | Ga0207694_10031588 | Ga0207694_100315884 | 179 |
| 183 | 3300025924 | Ga0207694_10286767 | Ga0207694_102867673 | 179 |
| 184 | 3300025924 | Ga0207694_10731034 | Ga0207694_107310342 | 179 |
| 185 | 3300025928 | Ga0207700_10429237 | Ga0207700_104292372 | 179 |
| 186 | 3300025933 | Ga0207706_10017412 | Ga0207706_100174127 | 179 |
| 187 | 3300025935 | Ga0207709_10531820 | Ga0207709_105318202 | 179 |
| 188 | 3300025938 | Ga0207704_10644939 | Ga0207704_106449392 | 179 |
| 189 | 3300025942 | Ga0207689_10394714 | Ga0207689_103947142 | 179 |
| 190 | 3300025944 | Ga0207661_10027813 | Ga0207661_100278133 | 179 |
| 191 | 3300025944 | Ga0207661_10035931 | Ga0207661_100359314 | 179 |
| 192 | 3300025949 | Ga0207667_10037806 | Ga0207667_100378065 | 179 |
| 193 | 3300025949 | Ga0207667_10093240 | Ga0207667_100932402 | 179 |
| 194 | 3300025961 | Ga0207712_10055191 | Ga0207712_100551914 | 179 |
| 195 | 3300025961 | Ga0207712_10083361 | Ga0207712_100833612 | 179 |
| 196 | 3300025972 | Ga0207668_10032978 | Ga0207668_100329784 | 179 |
| 197 | 3300026075 | Ga0207708_10049759 | Ga0207708_100497593 | 179 |
| 198 | 3300026116 | Ga0207674_10073430 | Ga0207674_100734304 | 179 |
| 199 | 3300026118 | Ga0207675_100003205 | Ga0207675_1000032055 | 179 |
| 200 | 3300026118 | Ga0207675_100456357 | Ga0207675_1004563572 | 179 |
| 201 | 3300026142 | Ga0207698_10342562 | Ga0207698_103425622 | 179 |
| 202 | 3300027512 | Ga0209179_1046642 | Ga0209179_10466422 | 179 |
| 203 | 3300027907 | Ga0207428_10118804 | Ga0207428_101188043 | 179 |
| 204 | 3300028379 | Ga0268266_10001570 | Ga0268266_100015701 | 179 |
| 205 | 3300028379 | Ga0268266_10010721 | Ga0268266_100107216 | 179 |
| 206 | 3300028379 | Ga0268266_10084602 | Ga0268266_100846021 | 179 |
| 207 | 3300028379 | Ga0268266_10115454 | Ga0268266_101154542 | 179 |
| 208 | 3300028380 | Ga0268265_10001552 | Ga0268265_100015528 | 179 |
| 209 | 3300028380 | Ga0268265_10033532 | Ga0268265_100335324 | 179 |
| 210 | 3300028380 | Ga0268265_10267837 | Ga0268265_102678372 | 179 |
| 211 | 3300028381 | Ga0268264_10755965 | Ga0268264_107559652 | 179 |
| 212 | 3300028573 | Ga0265334_10006156 | Ga0265334_100061564 | 179 |
| 213 | 3300030521 | Ga0307511_10000260 | Ga0307511_1000026045 | 179 |
| 214 | 3300031250 | Ga0265331_10007424 | Ga0265331_100074243 | 179 |
| 215 | 3300031548 | Ga0307408_100060854 | Ga0307408_1000608542 | 179 |
| 216 | 3300031548 | Ga0307408_100337100 | Ga0307408_1003371002 | 179 |
| 217 | 3300031616 | Ga0307508_10346145 | Ga0307508_103461452 | 179 |
| 218 | 3300031730 | Ga0307516_10001288 | Ga0307516_1000128829 | 179 |
| 219 | 3300031901 | Ga0307406_10456520 | Ga0307406_104565202 | 179 |
| 220 | 3300033180 | Ga0307510_10000008 | Ga0307510_10000008220 | 179 |
| 221 | 3300033180 | Ga0307510_10024198 | Ga0307510_100241985 | 179 |
| 222 | 3300035113 | Ga0373936_0072696 | Ga0373936_0072696_57_635 | 179 |
| 223 | 3300038443 | Ga0395901_1065049 | Ga0395901_1065049_119_721 | 179 |
| 224 | 3300042133 | Ga0450896_032236 | Ga0450896_032236_46_627 | 179 |
| 225 | 3300044656 | Ga0466969_0030463 | Ga0466969_0030463_1659_2246 | 179 |
| 226 | 3300044684 | Ga0466966_0084668 | Ga0466966_0084668_362_949 | 179 |
| 227 | 3300044765 | Ga0466970_0382618 | Ga0466970_0382618_116_703 | 179 |
| 228 | 3300045049 | Ga0466959_0004915 | Ga0466959_0004915_5251_5838 | 179 |
| 229 | 3300045051 | Ga0451576_1768775 | Ga0451576_1768775_22_603 | 179 |
| 230 | 3300046507 | Ga0495606_0231291 | Ga0495606_0231291_85_663 | 179 |
| 231 | 3300046519 | Ga0495632_0104683 | Ga0495632_0104683_610_1182 | 179 |
| 232 | 3300046660 | Ga0495625_0271708 | Ga0495625_0271708_224_796 | 179 |
| 233 | 3300048905 | Ga0496102_0002316 | Ga0496102_0002316_7906_8469 | 179 |
| 234 | 3300048905 | Ga0496102_0042364 | Ga0496102_0042364_374_946 | 179 |
| 235 | 3300048906 | Ga0496103_0022008 | Ga0496103_0022008_3070_3642 | 179 |
| 236 | 3300048917 | Ga0496114_0184293 | Ga0496114_0184293_358_930 | 179 |
| 237 | 3300048919 | Ga0496116_0004130 | Ga0496116_0004130_215_787 | 179 |
| 238 | 3300048920 | Ga0496117_0000117 | Ga0496117_0000117_58334_58906 | 179 |
| 239 | 3300048921 | Ga0496118_0000025 | Ga0496118_0000025_260339_260911 | 179 |
| 240 | 3300048922 | Ga0496119_0004474 | Ga0496119_0004474_9132_9704 | 179 |
| 241 | 3300048922 | Ga0496119_0237114 | Ga0496119_0237114_143_715 | 179 |
| 242 | 3300048923 | Ga0496120_0032813 | Ga0496120_0032813_184_756 | 179 |
| 243 | 3300048924 | Ga0496121_0015152 | Ga0496121_0015152_4202_4774 | 179 |
| 244 | 3300048924 | Ga0496121_0103346 | Ga0496121_0103346_434_1036 | 179 |
| 245 | 3300048924 | Ga0496121_0142807 | Ga0496121_0142807_172_744 | 179 |
| 246 | 3300048927 | Ga0496124_0071181 | Ga0496124_0071181_1328_1900 | 179 |
| 247 | 3300048928 | Ga0496125_0039847 | Ga0496125_0039847_556_1128 | 179 |
| 248 | 3300048929 | Ga0496126_0013978 | Ga0496126_0013978_6240_6812 | 179 |
| 249 | 3300048929 | Ga0496126_0086767 | Ga0496126_0086767_1777_2349 | 179 |
| 250 | 3300050507 | nmdc:mga05p37_1497_c1 | nmdc:mga05p37_1497_c1_8704_9285 | 179 |
| 251 | 3300050507 | nmdc:mga05p37_386035_c1 | nmdc:mga05p37_386035_c1_580_1161 | 179 |
| 252 | 3300050508 | nmdc:mga09592_537_c1 | nmdc:mga09592_537_c1_4084_4665 | 179 |
| 253 | 3300050509 | nmdc:mga0qj67_10621_c1 | nmdc:mga0qj67_10621_c1_6098_6679 | 179 |
| 254 | 3300050510 | nmdc:mga06r32_5829_c1 | nmdc:mga06r32_5829_c1_193_774 | 179 |
| 255 | 3300050511 | nmdc:mga08y16_128254_c1 | nmdc:mga08y16_128254_c1_835_1416 | 179 |
| 256 | 3300050511 | nmdc:mga08y16_65306_c1 | nmdc:mga08y16_65306_c1_172_735 | 179 |
| 257 | 3300053096 | Ga0500641_0176687 | Ga0500641_0176687_228_800 | 179 |
| 258 | 3300053139 | Ga0500568_0131809 | Ga0500568_0131809_214_810 | 179 |
| 259 | 3300053178 | Ga0500637_0002700 | Ga0500637_0002700_5976_6581 | 179 |
| 260 | 3300053178 | Ga0500637_0365381 | Ga0500637_0365381_41_649 | 179 |
| 261 | iso_pu_bacteria | 2738541337 | 2739054113 | 179 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4wbr-assembly1.cif.gz_D | structure of bradyrhizobium japonicum scoi with copper bound | 0.933 | 23 | 176 |
| 1wp0-assembly1.cif.gz_A | human sco1 | 0.9324 | 25 | 175 |
| 6n5u-assembly2.cif.gz_B | crystal structure of arabidopsis thaliana scoi with copper bound | 0.929 | 24 | 178 |
| 6n5u-assembly3.cif.gz_C | crystal structure of arabidopsis thaliana scoi with copper bound | 0.9258 | 24 | 178 |
| 2gt6-assembly1.cif.gz_A | solution structure of human cu(i) sco1 | 0.9216 | 21 | 175 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54TT7_154_312_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9543 | 25 | 178 | 3.40.30.10 |
| af_O42899_78_257_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9348 | 21 | 175 | 3.40.30.10 |
| af_K7MTL0_161_316_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9293 | 39 | 178 | 3.40.30.10 |
| af_Q4CYL4_166_345_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.923 | 21 | 178 | 3.40.30.10 |
| af_Q4DE34_85_262_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9224 | 23 | 178 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6L6PHQ9-F1-model_v4 | Redoxin domain-containing protein | 0.9948 | 24 | 179 |
GO:0046872
|
| AF-A0A4Q3Y2B9-F1-model_v4 | SCO family protein | 0.9857 | 16 | 179 |
GO:0046872
|
| AF-A0A432UXB7-F1-model_v4 | Photosynthetic protein synthase I | 0.9706 | 26 | 178 |
GO:0004130
GO:0009055 GO:0020037 GO:0046872 |
| AF-A0A6L6PHQ9-F1-model_v4 | Redoxin domain-containing protein | 0.97 | 24 | 179 |
GO:0046872
|
| AF-F3FW19-F1-model_v4 | Twin-arginine translocation pathway signal | 0.9695 | 64 | 165 |
GO:0046872
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar