F370254

General Info

Members Datasets Scaffolds Average Seq Length
261 149 258 190

Family's Representative Sequence

Representative Sequence 3300006237|Ga0097621_100670017|Ga0097621_1006700172
Length 214
Sequence MRARPPYRYEVMHMRYSKARWAVVLLCLTSLASAVASDAAISNSPPALKAGTFDPPRQAPDFDLLGSNSSALRISNFRGKVVLLAFGFTSCTAVCPTTLNTFAVARRKLAATAADVQVVYITVDPQRDNSARLKKYLDAFDPTFIGGTGTEQQLAAVRKSYGVSAQKQVAGDSYTYDHSSFTYLIDRSGRIRALMPYGHSPDDYVHDLTVLLKE

Samples

Sample ID Description Type Environment
1 2643221585 Pelomonas sp. Root662 Isolate Unclassified
2 2643221656 Pelomonas sp. Root405 Isolate Unclassified
3 2738541337 Pelomonas sp. BT06 Isolate Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
47 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
48 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
101 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
102 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
103 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
104 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
105 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
106 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
107 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
108 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
109 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
110 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
111 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
112 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
113 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
114 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
115 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
116 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
117 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
118 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
119 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
120 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
121 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
122 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
123 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
124 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
125 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
126 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
127 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
128 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
129 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
130 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
131 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
132 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
133 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
134 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
135 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
136 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
137 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
138 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
139 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
140 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
141 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
142 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
143 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
144 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
145 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
146 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
147 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
148 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
149 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.85
Metatranscriptomes 0
Isolates 1.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.3
Nodule 0.38
Rhizoplane 2.68
Rhizosphere 81.61
Stem 0
Stem Tuber 0
Unclassified 13.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10202661 3300003322 Bacteria 1173
2 rootL2_10293380 3300003322 Bacteria 1455
3 rootH1_10240058 3300003323 Bacteria 1521
4 Ga0070658_10022096 3300005327 Bacteria 5104
5 Ga0070676_10142772 3300005328 Bacteria 1526
6 Ga0070683_100019692 3300005329 Bacteria 5996
7 Ga0070683_100351804 3300005329 Bacteria 1403
8 Ga0070670_100252176 3300005331 Bacteria 1537
9 Ga0068869_100137952 3300005334 Bacteria 1881
10 Ga0070666_10322276 3300005335 Bacteria 1102
11 Ga0070666_10326439 3300005335 Unclassified 1095
12 Ga0070680_100015253 3300005336 Bacteria 6020
13 Ga0070680_100024591 3300005336 Bacteria 4813
14 Ga0070680_100252506 3300005336 Bacteria 1491
15 Ga0070680_100569327 3300005336 Bacteria 971
16 Ga0070682_100020897 3300005337 Bacteria 3857
17 Ga0070661_100310231 3300005344 Bacteria 1230
18 Ga0070661_100329447 3300005344 Unclassified 1194
19 Ga0070692_10182579 3300005345 Bacteria 1217
20 Ga0070668_100044616 3300005347 Bacteria 3400
21 Ga0070669_100151983 3300005353 Bacteria 1793
22 Ga0070671_100283034 3300005355 Unclassified 1410
23 Ga0070673_100779759 3300005364 Bacteria 882
24 Ga0070659_100075820 3300005366 Bacteria 2681
25 Ga0070667_100108794 3300005367 Bacteria 2402
26 Ga0070667_100225450 3300005367 Bacteria 1669
27 Ga0070713_100093803 3300005436 Unclassified 2587
28 Ga0070700_100063706 3300005441 Bacteria 2333
29 Ga0070662_100021418 3300005457 Bacteria 4413
30 Ga0070681_10000176 3300005458 Bacteria 48725
31 Ga0070681_10009203 3300005458 Bacteria 9708
32 Ga0070681_10051030 3300005458 Bacteria 4126
33 Ga0070681_10094733 3300005458 Bacteria 2934
34 Ga0070681_10142250 3300005458 Bacteria 2328
35 Ga0070681_10346639 3300005458 Bacteria 1395
36 Ga0070679_100044253 3300005530 Bacteria 4435
37 Ga0070679_100058580 3300005530 Bacteria 3838
38 Ga0070679_100291890 3300005530 Bacteria 1582
39 Ga0070684_100015656 3300005535 Bacteria 6185
40 Ga0070684_100183450 3300005535 Bacteria 1903
41 Ga0070684_100190895 3300005535 Bacteria 1864
42 Ga0068853_100167540 3300005539 Bacteria 1986
43 Ga0068853_100760021 3300005539 Unclassified 926
44 Ga0070665_100013207 3300005548 Bacteria 8319
45 Ga0070665_100027519 3300005548 Bacteria 5727
46 Ga0070665_100029524 3300005548 Bacteria 5519
47 Ga0070665_100037593 3300005548 Bacteria 4867
48 Ga0070665_100054900 3300005548 Bacteria 3995
49 Ga0070665_100061829 3300005548 Bacteria 3754
50 Ga0070665_100332273 3300005548 Bacteria 1524
51 Ga0068855_100000482 3300005563 Bacteria 49178
52 Ga0068855_100066365 3300005563 Bacteria 4207
53 Ga0068857_100280315 3300005577 Bacteria 1533
54 Ga0068857_100313417 3300005577 Bacteria 1448
55 Ga0068856_100042650 3300005614 Bacteria 4463
56 Ga0068856_101424637 3300005614 Bacteria 707
57 Ga0068852_100267340 3300005616 Unclassified 1644
58 Ga0068861_100064512 3300005719 Bacteria 2818
59 Ga0068861_101176056 3300005719 Unclassified 740
60 Ga0068863_100156186 3300005841 Bacteria 2184
61 Ga0068863_100834043 3300005841 Bacteria 920
62 Ga0068858_100002222 3300005842 Bacteria 19632
63 Ga0068858_100273773 3300005842 Bacteria 1607
64 Ga0068860_100000296 3300005843 Bacteria 69084
65 Ga0068862_100009624 3300005844 Bacteria 7987
66 Ga0068862_100040751 3300005844 Bacteria 3948
67 Ga0068862_100234745 3300005844 Unclassified 1665
68 Ga0081455_10000140 3300005937 Bacteria 84977
69 Ga0097621_100670017 3300006237 Unclassified 953
70 Ga0068871_100072206 3300006358 Bacteria 2842
71 Ga0075428_100048159 3300006844 Bacteria 4679
72 Ga0075430_100002507 3300006846 Bacteria 15307
73 Ga0075430_100206137 3300006846 Bacteria 1632
74 Ga0075431_100020432 3300006847 Bacteria 6766
75 Ga0075429_100103890 3300006880 Bacteria 2481
76 Ga0099826_10062883 3300006948 Bacteria 2402
77 Ga0099794_10053512 3300007265 Bacteria 1946
78 Ga0099795_10190324 3300007788 Bacteria 861
79 Ga0105240_10002942 3300009093 Bacteria 26855
80 Ga0105240_10007565 3300009093 Bacteria 15741
81 Ga0105240_10014732 3300009093 Bacteria 10667
82 Ga0105240_10034295 3300009093 Bacteria 6547
83 Ga0105240_10382419 3300009093 Bacteria 1589
84 Ga0105240_10670684 3300009093 Unclassified 1134
85 Ga0111539_10060969 3300009094 Bacteria 4470
86 Ga0111539_10201575 3300009094 Bacteria 2320
87 Ga0105247_10000867 3300009101 Bacteria 22861
88 Ga0114129_10012970 3300009147 Bacteria 11863
89 Ga0114129_10416636 3300009147 Bacteria 1768
90 Ga0105243_10757694 3300009148 Bacteria 952
91 Ga0105243_11165067 3300009148 Unclassified 782
92 Ga0105248_10775753 3300009177 Bacteria 1082
93 Ga0105237_10090329 3300009545 Bacteria 3052
94 Ga0105237_10091608 3300009545 Bacteria 3030
95 Ga0105237_10129019 3300009545 Bacteria 2523
96 Ga0105237_10211798 3300009545 Unclassified 1938
97 Ga0105237_10460225 3300009545 Bacteria 1278
98 Ga0105237_10518063 3300009545 Bacteria 1199
99 Ga0105237_10627945 3300009545 Bacteria 1081
100 Ga0105238_10000745 3300009551 Bacteria 33998
101 Ga0105238_10072943 3300009551 Bacteria 3427
102 Ga0105238_10538051 3300009551 Bacteria 1172
103 Ga0105249_10025778 3300009553 Bacteria 5295
104 Ga0105249_10123845 3300009553 Bacteria 2460
105 Ga0105239_10930521 3300010375 Bacteria 998
106 Ga0105246_10770853 3300011119 Unclassified 850
107 Ga0157370_10002748 3300013104 Bacteria 21027
108 Ga0157370_10178071 3300013104 Bacteria 1976
109 Ga0157370_10428384 3300013104 Unclassified 1217
110 Ga0157369_10002834 3300013105 Bacteria 20690
111 Ga0157369_10042638 3300013105 Bacteria 4949
112 Ga0157369_10105697 3300013105 Bacteria 2997
113 Ga0157369_10132689 3300013105 Bacteria 2638
114 Ga0157369_10334419 3300013105 Bacteria 1573
115 Ga0157374_10174004 3300013296 Bacteria 2101
116 Ga0157374_10464432 3300013296 Bacteria 1268
117 Ga0163162_10223611 3300013306 Bacteria 2012
118 Ga0157372_10295036 3300013307 Bacteria 1885
119 Ga0157372_10687900 3300013307 Unclassified 1190
120 Ga0163163_10023119 3300014325 Bacteria 5896
121 Ga0157379_10049684 3300014968 Bacteria 3745
122 Ga0157379_10137832 3300014968 Bacteria 2199
123 Ga0157379_10146708 3300014968 Bacteria 2128
124 Ga0157379_10219184 3300014968 Bacteria 1724
125 Ga0157376_10149637 3300014969 Bacteria 2104
126 Ga0157376_10231145 3300014969 Bacteria 1718
127 Ga0207680_10142284 3300025903 Bacteria 1591
128 Ga0207680_10206499 3300025903 Bacteria 1341
129 Ga0207645_10141076 3300025907 Bacteria 1570
130 Ga0207707_10019089 3300025912 Bacteria 5982
131 Ga0207707_10052889 3300025912 Bacteria 3534
132 Ga0207707_10121724 3300025912 Bacteria 2281
133 Ga0207707_10195107 3300025912 Bacteria 1766
134 Ga0207671_10025761 3300025914 Bacteria 4414
135 Ga0207671_10090701 3300025914 Bacteria 2302
136 Ga0207671_10133837 3300025914 Bacteria 1905
137 Ga0207660_10033416 3300025917 Bacteria 3559
138 Ga0207660_10101857 3300025917 Bacteria 2146
139 Ga0207660_10195232 3300025917 Unclassified 1578
140 Ga0207660_10397712 3300025917 Bacteria 1109
141 Ga0207649_10335518 3300025920 Bacteria 1115
142 Ga0207652_10026989 3300025921 Bacteria 4785
143 Ga0207652_10073118 3300025921 Bacteria 2982
144 Ga0207652_10184588 3300025921 Unclassified 1875
145 Ga0207652_10359520 3300025921 Bacteria 1314
146 Ga0207681_10237911 3300025923 Bacteria 1416
147 Ga0207694_10031588 3300025924 Bacteria 4046
148 Ga0207694_10286767 3300025924 Unclassified 1353
149 Ga0207694_10731034 3300025924 Unclassified 835
150 Ga0207700_10429237 3300025928 Bacteria 1162
151 Ga0207706_10017412 3300025933 Bacteria 6473
152 Ga0207709_10531820 3300025935 Bacteria 922
153 Ga0207704_10644939 3300025938 Bacteria 872
154 Ga0207689_10394714 3300025942 Bacteria 1153
155 Ga0207661_10027813 3300025944 Unclassified 4324
156 Ga0207661_10035931 3300025944 Bacteria 3865
157 Ga0207667_10037806 3300025949 Bacteria 5159
158 Ga0207667_10093240 3300025949 Bacteria 3110
159 Ga0207667_10360842 3300025949 Bacteria 1481
160 Ga0207712_10055191 3300025961 Bacteria 2793
161 Ga0207712_10083361 3300025961 Bacteria 2333
162 Ga0207668_10032978 3300025972 Bacteria 3428
163 Ga0207703_10000415 3300026035 Bacteria 45514
164 Ga0207639_10070084 3300026041 Bacteria 2738
165 Ga0207678_10413799 3300026067 Unclassified 1169
166 Ga0207708_10049759 3300026075 Bacteria 3191
167 Ga0207702_10244908 3300026078 Bacteria 1681
168 Ga0207702_11031327 3300026078 Bacteria 816
169 Ga0207641_10002406 3300026088 Bacteria 17287
170 Ga0207674_10073430 3300026116 Bacteria 3434
171 Ga0207675_100003205 3300026118 Bacteria 16049
172 Ga0207675_100008556 3300026118 Bacteria 9626
173 Ga0207675_100456357 3300026118 Bacteria 1267
174 Ga0207698_10342562 3300026142 Unclassified 1409
175 Ga0209179_1046642 3300027512 Unclassified 922
176 Ga0207428_10118804 3300027907 Bacteria 2029
177 Ga0268266_10001570 3300028379 Bacteria 26707
178 Ga0268266_10010721 3300028379 Bacteria 7985
179 Ga0268266_10084602 3300028379 Bacteria 2770
180 Ga0268266_10115454 3300028379 Bacteria 2383
181 Ga0268266_10378382 3300028379 Unclassified 1335
182 Ga0268265_10001552 3300028380 Bacteria 19040
183 Ga0268265_10033532 3300028380 Bacteria 3734
184 Ga0268265_10267837 3300028380 Unclassified 1522
185 Ga0268264_10000088 3300028381 Bacteria 235344
186 Ga0268264_10755965 3300028381 Unclassified 969
187 Ga0265334_10006156 3300028573 Bacteria 5196
188 Ga0307511_10000260 3300030521 Bacteria 54540
189 Ga0265331_10007424 3300031250 Bacteria 6343
190 Ga0265331_10115075 3300031250 Unclassified 1232
191 Ga0307408_100060854 3300031548 Bacteria 2754
192 Ga0307408_100337100 3300031548 Bacteria 1275
193 Ga0307508_10346145 3300031616 Bacteria 1078
194 Ga0307516_10001288 3300031730 Bacteria 34892
195 Ga0307406_10456520 3300031901 Unclassified 1026
196 Ga0307510_10000008 3300033180 Bacteria 433990
197 Ga0307510_10024198 3300033180 Bacteria 7021
198 Ga0373936_0013458 3300035113 Bacteria 3122
199 Ga0373936_0072696 3300035113 Unclassified 1420
200 Ga0395905_0159671 3300037471 Bacteria 2119
201 Ga0395901_1065049 3300038443 Unclassified 781
202 Ga0436363_1191838 3300039450 Unclassified 1106
203 Ga0450896_032236 3300042133 Bacteria 797
204 Ga0450898_000813 3300042134 Bacteria 3864
205 Ga0466969_0030463 3300044656 Bacteria 2749
206 Ga0466966_0084668 3300044684 Bacteria 1972
207 Ga0466970_0382618 3300044765 Unclassified 801
208 Ga0466959_0004915 3300045049 Bacteria 9053
209 Ga0451576_1768775 3300045051 Unclassified 639
210 Ga0495638_0108016 3300046460 Bacteria 1656
211 Ga0495606_0231291 3300046507 Bacteria 1036
212 Ga0495610_0204742 3300046512 Unclassified 806
213 Ga0495632_0104683 3300046519 Bacteria 1332
214 Ga0495598_0233931 3300046537 Bacteria 675
215 Ga0495668_0165359 3300046616 Bacteria 1212
216 Ga0495625_0271708 3300046660 Bacteria 1093
217 Ga0496102_0002316 3300048905 Bacteria 16258
218 Ga0496102_0042364 3300048905 Bacteria 4125
219 Ga0496103_0022008 3300048906 Bacteria 3837
220 Ga0496108_0617970 3300048911 Unclassified 944
221 Ga0496112_0045626 3300048915 Bacteria 4297
222 Ga0496113_0397840 3300048916 Bacteria 1106
223 Ga0496114_0184293 3300048917 Bacteria 1824
224 Ga0496116_0004130 3300048919 Bacteria 13990
225 Ga0496117_0000117 3300048920 Bacteria 177596
226 Ga0496118_0000025 3300048921 Bacteria 379363
227 Ga0496118_0051110 3300048921 Bacteria 3165
228 Ga0496119_0004103 3300048922 Bacteria 14685
229 Ga0496119_0004474 3300048922 Bacteria 13898
230 Ga0496119_0147693 3300048922 Unclassified 1263
231 Ga0496119_0237114 3300048922 Bacteria 925
232 Ga0496120_0000098 3300048923 Bacteria 145165
233 Ga0496120_0023255 3300048923 Bacteria 3881
234 Ga0496120_0032813 3300048923 Bacteria 3126
235 Ga0496121_0006502 3300048924 Bacteria 14456
236 Ga0496121_0015152 3300048924 Bacteria 8107
237 Ga0496121_0103346 3300048924 Bacteria 2192
238 Ga0496121_0142807 3300048924 Bacteria 1773
239 Ga0496124_0071181 3300048927 Bacteria 2883
240 Ga0496125_0000416 3300048928 Bacteria 79287
241 Ga0496125_0023876 3300048928 Bacteria 5634
242 Ga0496125_0039847 3300048928 Bacteria 4038
243 Ga0496126_0013978 3300048929 Bacteria 8139
244 Ga0496126_0086767 3300048929 Bacteria 2758
245 Ga0496126_0309613 3300048929 Unclassified 1301
246 nmdc:mga05p37_1497_c1 3300050507 Bacteria 27123
247 nmdc:mga05p37_386035_c1 3300050507 Bacteria 1639
248 nmdc:mga09592_537_c1 3300050508 Bacteria 28691
249 nmdc:mga0qj67_10621_c1 3300050509 Bacteria 6880
250 nmdc:mga06r32_5829_c1 3300050510 Bacteria 11095
251 nmdc:mga08y16_128254_c1 3300050511 Bacteria 2639
252 nmdc:mga08y16_65306_c1 3300050511 Bacteria 3799
253 Ga0500641_0176687 3300053096 Unclassified 918
254 Ga0500568_0131809 3300053139 Unclassified 929
255 Ga0500616_0000016 3300053153 Bacteria 627087
256 Ga0500637_0002700 3300053178 Bacteria 7959
257 Ga0500637_0010462 3300053178 Bacteria 4759
258 Ga0500637_0365381 3300053178 Unclassified 762

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005335 Ga0070666_10326439 Ga0070666_103264392 168
2 3300005367 Ga0070667_100108794 Ga0070667_1001087943 168
3 3300005548 Ga0070665_100029524 Ga0070665_1000295243 168
4 3300005563 Ga0068855_100066365 Ga0068855_1000663652 168
5 3300009093 Ga0105240_10007565 Ga0105240_100075658 168
6 3300009545 Ga0105237_10090329 Ga0105237_100903294 168
7 3300013296 Ga0157374_10174004 Ga0157374_101740042 168
8 3300037471 Ga0395905_0159671 Ga0395905_0159671_1451_2032 169
9 3300042134 Ga0450898_000813 Ga0450898_000813_636_1217 169
10 3300009551 Ga0105238_10072943 Ga0105238_100729433 170
11 3300031250 Ga0265331_10115075 Ga0265331_101150752 170
12 3300048921 Ga0496118_0051110 Ga0496118_0051110_268_903 170
13 3300053153 Ga0500616_0000016 Ga0500616_0000016_395813_396334 170
14 3300009545 Ga0105237_10627945 Ga0105237_106279452 171
15 3300046460 Ga0495638_0108016 Ga0495638_0108016_829_1365 171
16 3300046512 Ga0495610_0204742 Ga0495610_0204742_152_688 171
17 3300048923 Ga0496120_0023255 Ga0496120_0023255_36_572 171
18 3300005335 Ga0070666_10322276 Ga0070666_103222762 172
19 3300005355 Ga0070671_100283034 Ga0070671_1002830341 172
20 3300005367 Ga0070667_100225450 Ga0070667_1002254503 172
21 3300005539 Ga0068853_100760021 Ga0068853_1007600212 172
22 3300005548 Ga0070665_100054900 Ga0070665_1000549005 172
23 3300005719 Ga0068861_100064512 Ga0068861_1000645124 172
24 3300005841 Ga0068863_100156186 Ga0068863_1001561862 172
25 3300005842 Ga0068858_100002222 Ga0068858_1000022226 172
26 3300005843 Ga0068860_100000296 Ga0068860_10000029655 172
27 3300009093 Ga0105240_10014732 Ga0105240_100147325 172
28 3300009093 Ga0105240_10670684 Ga0105240_106706842 172
29 3300009551 Ga0105238_10538051 Ga0105238_105380512 172
30 3300011119 Ga0105246_10770853 Ga0105246_107708531 172
31 3300013105 Ga0157369_10105697 Ga0157369_101056972 172
32 3300013306 Ga0163162_10223611 Ga0163162_102236112 172
33 3300014969 Ga0157376_10149637 Ga0157376_101496372 172
34 3300025903 Ga0207680_10142284 Ga0207680_101422842 172
35 3300025949 Ga0207667_10360842 Ga0207667_103608422 172
36 3300026035 Ga0207703_10000415 Ga0207703_1000041523 172
37 3300026041 Ga0207639_10070084 Ga0207639_100700844 172
38 3300026067 Ga0207678_10413799 Ga0207678_104137992 172
39 3300026088 Ga0207641_10002406 Ga0207641_1000240613 172
40 3300026118 Ga0207675_100008556 Ga0207675_1000085569 172
41 3300028379 Ga0268266_10378382 Ga0268266_103783822 172
42 3300028381 Ga0268264_10000088 Ga0268264_1000008859 172
43 3300048922 Ga0496119_0147693 Ga0496119_0147693_478_1050 172
44 3300048928 Ga0496125_0000416 Ga0496125_0000416_73070_73642 172
45 3300048929 Ga0496126_0309613 Ga0496126_0309613_384_956 172
46 3300009101 Ga0105247_10000867 Ga0105247_100008677 173
47 3300009177 Ga0105248_10775753 Ga0105248_107757532 173
48 3300014325 Ga0163163_10023119 Ga0163163_100231193 173
49 3300014968 Ga0157379_10146708 Ga0157379_101467082 173
50 3300035113 Ga0373936_0013458 Ga0373936_0013458_2471_3013 173
51 3300048911 Ga0496108_0617970 Ga0496108_0617970_88_681 173
52 3300048915 Ga0496112_0045626 Ga0496112_0045626_3216_3809 173
53 3300048916 Ga0496113_0397840 Ga0496113_0397840_34_627 173
54 3300048924 Ga0496121_0006502 Ga0496121_0006502_1995_2588 173
55 3300048928 Ga0496125_0023876 Ga0496125_0023876_2122_2715 173
56 3300006948 Ga0099826_10062883 Ga0099826_100628832 175
57 3300005336 Ga0070680_100024591 Ga0070680_1000245912 176
58 3300005337 Ga0070682_100020897 Ga0070682_1000208973 176
59 3300005458 Ga0070681_10142250 Ga0070681_101422503 176
60 3300005530 Ga0070679_100044253 Ga0070679_1000442535 176
61 3300005539 Ga0068853_100167540 Ga0068853_1001675403 176
62 3300005563 Ga0068855_100000482 Ga0068855_10000048215 176
63 3300005614 Ga0068856_101424637 Ga0068856_1014246371 176
64 3300007788 Ga0099795_10190324 Ga0099795_101903242 176
65 3300009093 Ga0105240_10034295 Ga0105240_100342955 176
66 3300009545 Ga0105237_10129019 Ga0105237_101290192 176
67 3300009551 Ga0105238_10000745 Ga0105238_1000074527 176
68 3300010375 Ga0105239_10930521 Ga0105239_109305211 176
69 3300013104 Ga0157370_10002748 Ga0157370_1000274816 176
70 3300013105 Ga0157369_10002834 Ga0157369_1000283416 176
71 3300025912 Ga0207707_10019089 Ga0207707_100190896 176
72 3300025914 Ga0207671_10090701 Ga0207671_100907012 176
73 3300025917 Ga0207660_10033416 Ga0207660_100334164 176
74 3300025921 Ga0207652_10026989 Ga0207652_100269894 176
75 3300026078 Ga0207702_11031327 Ga0207702_110313271 176
76 3300048922 Ga0496119_0004103 Ga0496119_0004103_573_1127 176
77 3300048923 Ga0496120_0000098 Ga0496120_0000098_37383_37937 176
78 3300053178 Ga0500637_0010462 Ga0500637_0010462_3332_3871 176
79 3300005353 Ga0070669_100151983 Ga0070669_1001519833 177
80 3300005614 Ga0068856_100042650 Ga0068856_1000426502 177
81 3300009093 Ga0105240_10382419 Ga0105240_103824192 177
82 3300009545 Ga0105237_10518063 Ga0105237_105180632 177
83 3300013105 Ga0157369_10334419 Ga0157369_103344192 177
84 3300025923 Ga0207681_10237911 Ga0207681_102379112 177
85 3300026078 Ga0207702_10244908 Ga0207702_102449082 177
86 3300046537 Ga0495598_0233931 Ga0495598_0233931_103_660 177
87 iso_pu_bacteria 2643221585 2643934599 177
88 iso_pu_bacteria 2643221656 2644316085 177
89 3300003323 rootH1_10240058 rootH1_102400583 178
90 3300005331 Ga0070670_100252176 Ga0070670_1002521762 178
91 3300005364 Ga0070673_100779759 Ga0070673_1007797592 178
92 3300009545 Ga0105237_10091608 Ga0105237_100916085 178
93 3300014968 Ga0157379_10137832 Ga0157379_101378322 178
94 3300039450 Ga0436363_1191838 Ga0436363_1191838_308_910 178
95 3300046616 Ga0495668_0165359 Ga0495668_0165359_504_1100 178
96 3300003322 rootL2_10202661 rootL2_102026611 179
97 3300003322 rootL2_10293380 rootL2_102933802 179
98 3300005327 Ga0070658_10022096 Ga0070658_100220962 179
99 3300005328 Ga0070676_10142772 Ga0070676_101427722 179
100 3300005329 Ga0070683_100019692 Ga0070683_1000196923 179
101 3300005329 Ga0070683_100351804 Ga0070683_1003518042 179
102 3300005334 Ga0068869_100137952 Ga0068869_1001379522 179
103 3300005336 Ga0070680_100015253 Ga0070680_1000152534 179
104 3300005336 Ga0070680_100252506 Ga0070680_1002525062 179
105 3300005336 Ga0070680_100569327 Ga0070680_1005693272 179
106 3300005344 Ga0070661_100310231 Ga0070661_1003102312 179
107 3300005344 Ga0070661_100329447 Ga0070661_1003294471 179
108 3300005345 Ga0070692_10182579 Ga0070692_101825792 179
109 3300005347 Ga0070668_100044616 Ga0070668_1000446164 179
110 3300005366 Ga0070659_100075820 Ga0070659_1000758203 179
111 3300005436 Ga0070713_100093803 Ga0070713_1000938034 179
112 3300005441 Ga0070700_100063706 Ga0070700_1000637063 179
113 3300005457 Ga0070662_100021418 Ga0070662_1000214185 179
114 3300005458 Ga0070681_10000176 Ga0070681_1000017613 179
115 3300005458 Ga0070681_10009203 Ga0070681_100092033 179
116 3300005458 Ga0070681_10051030 Ga0070681_100510303 179
117 3300005458 Ga0070681_10094733 Ga0070681_100947334 179
118 3300005458 Ga0070681_10346639 Ga0070681_103466392 179
119 3300005530 Ga0070679_100058580 Ga0070679_1000585803 179
120 3300005530 Ga0070679_100291890 Ga0070679_1002918902 179
121 3300005535 Ga0070684_100015656 Ga0070684_1000156566 179
122 3300005535 Ga0070684_100183450 Ga0070684_1001834502 179
123 3300005535 Ga0070684_100190895 Ga0070684_1001908952 179
124 3300005548 Ga0070665_100013207 Ga0070665_1000132076 179
125 3300005548 Ga0070665_100027519 Ga0070665_1000275192 179
126 3300005548 Ga0070665_100037593 Ga0070665_1000375934 179
127 3300005548 Ga0070665_100061829 Ga0070665_1000618292 179
128 3300005548 Ga0070665_100332273 Ga0070665_1003322732 179
129 3300005577 Ga0068857_100280315 Ga0068857_1002803152 179
130 3300005577 Ga0068857_100313417 Ga0068857_1003134173 179
131 3300005616 Ga0068852_100267340 Ga0068852_1002673402 179
132 3300005719 Ga0068861_101176056 Ga0068861_1011760561 179
133 3300005841 Ga0068863_100834043 Ga0068863_1008340432 179
134 3300005842 Ga0068858_100273773 Ga0068858_1002737732 179
135 3300005844 Ga0068862_100009624 Ga0068862_1000096243 179
136 3300005844 Ga0068862_100040751 Ga0068862_1000407514 179
137 3300005844 Ga0068862_100234745 Ga0068862_1002347452 179
138 3300005937 Ga0081455_10000140 Ga0081455_1000014014 179
139 3300006237 Ga0097621_100670017 Ga0097621_1006700172 179
140 3300006358 Ga0068871_100072206 Ga0068871_1000722065 179
141 3300006844 Ga0075428_100048159 Ga0075428_1000481592 179
142 3300006846 Ga0075430_100002507 Ga0075430_10000250711 179
143 3300006846 Ga0075430_100206137 Ga0075430_1002061372 179
144 3300006847 Ga0075431_100020432 Ga0075431_1000204326 179
145 3300006880 Ga0075429_100103890 Ga0075429_1001038904 179
146 3300007265 Ga0099794_10053512 Ga0099794_100535121 179
147 3300009093 Ga0105240_10002942 Ga0105240_1000294226 179
148 3300009094 Ga0111539_10060969 Ga0111539_100609692 179
149 3300009094 Ga0111539_10201575 Ga0111539_102015752 179
150 3300009147 Ga0114129_10012970 Ga0114129_100129708 179
151 3300009147 Ga0114129_10416636 Ga0114129_104166362 179
152 3300009148 Ga0105243_10757694 Ga0105243_107576941 179
153 3300009148 Ga0105243_11165067 Ga0105243_111650671 179
154 3300009545 Ga0105237_10211798 Ga0105237_102117983 179
155 3300009545 Ga0105237_10460225 Ga0105237_104602252 179
156 3300009553 Ga0105249_10025778 Ga0105249_100257784 179
157 3300009553 Ga0105249_10123845 Ga0105249_101238452 179
158 3300013104 Ga0157370_10178071 Ga0157370_101780712 179
159 3300013104 Ga0157370_10428384 Ga0157370_104283842 179
160 3300013105 Ga0157369_10042638 Ga0157369_100426382 179
161 3300013105 Ga0157369_10132689 Ga0157369_101326894 179
162 3300013296 Ga0157374_10464432 Ga0157374_104644322 179
163 3300013307 Ga0157372_10295036 Ga0157372_102950363 179
164 3300013307 Ga0157372_10687900 Ga0157372_106879002 179
165 3300014968 Ga0157379_10049684 Ga0157379_100496844 179
166 3300014968 Ga0157379_10219184 Ga0157379_102191842 179
167 3300014969 Ga0157376_10231145 Ga0157376_102311452 179
168 3300025903 Ga0207680_10206499 Ga0207680_102064992 179
169 3300025907 Ga0207645_10141076 Ga0207645_101410762 179
170 3300025912 Ga0207707_10052889 Ga0207707_100528893 179
171 3300025912 Ga0207707_10121724 Ga0207707_101217242 179
172 3300025912 Ga0207707_10195107 Ga0207707_101951071 179
173 3300025914 Ga0207671_10025761 Ga0207671_100257613 179
174 3300025914 Ga0207671_10133837 Ga0207671_101338373 179
175 3300025917 Ga0207660_10101857 Ga0207660_101018572 179
176 3300025917 Ga0207660_10195232 Ga0207660_101952322 179
177 3300025917 Ga0207660_10397712 Ga0207660_103977122 179
178 3300025920 Ga0207649_10335518 Ga0207649_103355182 179
179 3300025921 Ga0207652_10073118 Ga0207652_100731183 179
180 3300025921 Ga0207652_10184588 Ga0207652_101845883 179
181 3300025921 Ga0207652_10359520 Ga0207652_103595202 179
182 3300025924 Ga0207694_10031588 Ga0207694_100315884 179
183 3300025924 Ga0207694_10286767 Ga0207694_102867673 179
184 3300025924 Ga0207694_10731034 Ga0207694_107310342 179
185 3300025928 Ga0207700_10429237 Ga0207700_104292372 179
186 3300025933 Ga0207706_10017412 Ga0207706_100174127 179
187 3300025935 Ga0207709_10531820 Ga0207709_105318202 179
188 3300025938 Ga0207704_10644939 Ga0207704_106449392 179
189 3300025942 Ga0207689_10394714 Ga0207689_103947142 179
190 3300025944 Ga0207661_10027813 Ga0207661_100278133 179
191 3300025944 Ga0207661_10035931 Ga0207661_100359314 179
192 3300025949 Ga0207667_10037806 Ga0207667_100378065 179
193 3300025949 Ga0207667_10093240 Ga0207667_100932402 179
194 3300025961 Ga0207712_10055191 Ga0207712_100551914 179
195 3300025961 Ga0207712_10083361 Ga0207712_100833612 179
196 3300025972 Ga0207668_10032978 Ga0207668_100329784 179
197 3300026075 Ga0207708_10049759 Ga0207708_100497593 179
198 3300026116 Ga0207674_10073430 Ga0207674_100734304 179
199 3300026118 Ga0207675_100003205 Ga0207675_1000032055 179
200 3300026118 Ga0207675_100456357 Ga0207675_1004563572 179
201 3300026142 Ga0207698_10342562 Ga0207698_103425622 179
202 3300027512 Ga0209179_1046642 Ga0209179_10466422 179
203 3300027907 Ga0207428_10118804 Ga0207428_101188043 179
204 3300028379 Ga0268266_10001570 Ga0268266_100015701 179
205 3300028379 Ga0268266_10010721 Ga0268266_100107216 179
206 3300028379 Ga0268266_10084602 Ga0268266_100846021 179
207 3300028379 Ga0268266_10115454 Ga0268266_101154542 179
208 3300028380 Ga0268265_10001552 Ga0268265_100015528 179
209 3300028380 Ga0268265_10033532 Ga0268265_100335324 179
210 3300028380 Ga0268265_10267837 Ga0268265_102678372 179
211 3300028381 Ga0268264_10755965 Ga0268264_107559652 179
212 3300028573 Ga0265334_10006156 Ga0265334_100061564 179
213 3300030521 Ga0307511_10000260 Ga0307511_1000026045 179
214 3300031250 Ga0265331_10007424 Ga0265331_100074243 179
215 3300031548 Ga0307408_100060854 Ga0307408_1000608542 179
216 3300031548 Ga0307408_100337100 Ga0307408_1003371002 179
217 3300031616 Ga0307508_10346145 Ga0307508_103461452 179
218 3300031730 Ga0307516_10001288 Ga0307516_1000128829 179
219 3300031901 Ga0307406_10456520 Ga0307406_104565202 179
220 3300033180 Ga0307510_10000008 Ga0307510_10000008220 179
221 3300033180 Ga0307510_10024198 Ga0307510_100241985 179
222 3300035113 Ga0373936_0072696 Ga0373936_0072696_57_635 179
223 3300038443 Ga0395901_1065049 Ga0395901_1065049_119_721 179
224 3300042133 Ga0450896_032236 Ga0450896_032236_46_627 179
225 3300044656 Ga0466969_0030463 Ga0466969_0030463_1659_2246 179
226 3300044684 Ga0466966_0084668 Ga0466966_0084668_362_949 179
227 3300044765 Ga0466970_0382618 Ga0466970_0382618_116_703 179
228 3300045049 Ga0466959_0004915 Ga0466959_0004915_5251_5838 179
229 3300045051 Ga0451576_1768775 Ga0451576_1768775_22_603 179
230 3300046507 Ga0495606_0231291 Ga0495606_0231291_85_663 179
231 3300046519 Ga0495632_0104683 Ga0495632_0104683_610_1182 179
232 3300046660 Ga0495625_0271708 Ga0495625_0271708_224_796 179
233 3300048905 Ga0496102_0002316 Ga0496102_0002316_7906_8469 179
234 3300048905 Ga0496102_0042364 Ga0496102_0042364_374_946 179
235 3300048906 Ga0496103_0022008 Ga0496103_0022008_3070_3642 179
236 3300048917 Ga0496114_0184293 Ga0496114_0184293_358_930 179
237 3300048919 Ga0496116_0004130 Ga0496116_0004130_215_787 179
238 3300048920 Ga0496117_0000117 Ga0496117_0000117_58334_58906 179
239 3300048921 Ga0496118_0000025 Ga0496118_0000025_260339_260911 179
240 3300048922 Ga0496119_0004474 Ga0496119_0004474_9132_9704 179
241 3300048922 Ga0496119_0237114 Ga0496119_0237114_143_715 179
242 3300048923 Ga0496120_0032813 Ga0496120_0032813_184_756 179
243 3300048924 Ga0496121_0015152 Ga0496121_0015152_4202_4774 179
244 3300048924 Ga0496121_0103346 Ga0496121_0103346_434_1036 179
245 3300048924 Ga0496121_0142807 Ga0496121_0142807_172_744 179
246 3300048927 Ga0496124_0071181 Ga0496124_0071181_1328_1900 179
247 3300048928 Ga0496125_0039847 Ga0496125_0039847_556_1128 179
248 3300048929 Ga0496126_0013978 Ga0496126_0013978_6240_6812 179
249 3300048929 Ga0496126_0086767 Ga0496126_0086767_1777_2349 179
250 3300050507 nmdc:mga05p37_1497_c1 nmdc:mga05p37_1497_c1_8704_9285 179
251 3300050507 nmdc:mga05p37_386035_c1 nmdc:mga05p37_386035_c1_580_1161 179
252 3300050508 nmdc:mga09592_537_c1 nmdc:mga09592_537_c1_4084_4665 179
253 3300050509 nmdc:mga0qj67_10621_c1 nmdc:mga0qj67_10621_c1_6098_6679 179
254 3300050510 nmdc:mga06r32_5829_c1 nmdc:mga06r32_5829_c1_193_774 179
255 3300050511 nmdc:mga08y16_128254_c1 nmdc:mga08y16_128254_c1_835_1416 179
256 3300050511 nmdc:mga08y16_65306_c1 nmdc:mga08y16_65306_c1_172_735 179
257 3300053096 Ga0500641_0176687 Ga0500641_0176687_228_800 179
258 3300053139 Ga0500568_0131809 Ga0500568_0131809_214_810 179
259 3300053178 Ga0500637_0002700 Ga0500637_0002700_5976_6581 179
260 3300053178 Ga0500637_0365381 Ga0500637_0365381_41_649 179
261 iso_pu_bacteria 2738541337 2739054113 179

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02630

SCO1-SenC

SCO1/SenC

59

191

0.97

PF00578

AhpC-TSA

AhpC/TSA family

55

194

0.78

PF08534

Redoxin

Redoxin

55

207

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wbr-assembly1.cif.gz_D structure of bradyrhizobium japonicum scoi with copper bound 0.933 23 176
1wp0-assembly1.cif.gz_A human sco1 0.9324 25 175
6n5u-assembly2.cif.gz_B crystal structure of arabidopsis thaliana scoi with copper bound 0.929 24 178
6n5u-assembly3.cif.gz_C crystal structure of arabidopsis thaliana scoi with copper bound 0.9258 24 178
2gt6-assembly1.cif.gz_A solution structure of human cu(i) sco1 0.9216 21 175
ID Description Score Start End Superfamily
af_Q54TT7_154_312_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9543 25 178 3.40.30.10
af_O42899_78_257_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9348 21 175 3.40.30.10
af_K7MTL0_161_316_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9293 39 178 3.40.30.10
af_Q4CYL4_166_345_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.923 21 178 3.40.30.10
af_Q4DE34_85_262_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9224 23 178 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A6L6PHQ9-F1-model_v4 Redoxin domain-containing protein 0.9948 24 179 GO:0046872
AF-A0A4Q3Y2B9-F1-model_v4 SCO family protein 0.9857 16 179 GO:0046872
AF-A0A432UXB7-F1-model_v4 Photosynthetic protein synthase I 0.9706 26 178 GO:0004130
GO:0009055
GO:0020037
GO:0046872
AF-A0A6L6PHQ9-F1-model_v4 Redoxin domain-containing protein 0.97 24 179 GO:0046872
AF-F3FW19-F1-model_v4 Twin-arginine translocation pathway signal 0.9695 64 165 GO:0046872

Feature Viewer

pLDDT pTM Quality
92.62 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map