F370186

General Info

Members Datasets Scaffolds Average Seq Length
261 165 522 139

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100990065|Ga0070707_1009900651
Length 153
Sequence MSAVGRNRGSGAMIQEFKAFIARGNVLDLAVAVIIGAAFGAIVTSLTGDVIMPLVGALFGGADLSNHFVLLSVPEGYSGSINDYAALKEAGAAMIGYGAFLTALINFVILAFVIFLLVRTANRLIATKGEAPPAGPSELDLLAEIRDELRKRT

Samples

Sample ID Description Type Environment
1 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
48 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
74 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
75 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
76 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
77 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
78 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
79 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
80 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
81 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
82 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
83 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
84 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
85 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
86 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
87 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
88 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
89 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
90 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
91 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
92 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
93 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
94 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
95 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
96 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
97 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
98 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
99 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
100 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
101 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
102 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
103 3300044671 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E Metagenome Unclassified
104 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
105 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
106 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
107 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
108 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
109 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
110 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
111 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
112 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
113 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
114 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
115 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
116 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
117 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
118 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
119 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
120 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
121 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
122 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
123 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
124 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
125 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
126 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
127 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
128 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
129 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
130 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
131 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
132 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
133 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
134 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
135 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
136 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
137 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
138 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
139 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
140 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
141 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
142 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
143 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
144 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
145 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
146 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
147 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
148 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
149 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
150 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
151 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
153 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
154 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
155 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
156 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
157 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
158 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
159 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
160 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
161 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
162 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
163 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
164 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
165 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.98
Nodule 0
Rhizoplane 4.21
Rhizosphere 85.82
Stem 0
Stem Tuber 0
Unclassified 1.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070707_100990065 3300005468 Bacteria 806
2 Ga0065712_10456989 3300005290 Bacteria 681
3 Ga0065715_10205444 3300005293 Bacteria 1339
4 Ga0065715_10616322 3300005293 Bacteria 698
5 Ga0070658_10308526 3300005327 Bacteria 1350
6 Ga0070676_10784448 3300005328 Bacteria 702
7 Ga0070670_100081891 3300005331 Bacteria 2773
8 Ga0070666_10013870 3300005335 Bacteria 5121
9 Ga0070666_10189371 3300005335 Bacteria 1445
10 Ga0068868_100277961 3300005338 Bacteria 1416
11 Ga0070660_101696896 3300005339 Bacteria 538
12 Ga0070661_100098650 3300005344 Bacteria 2170
13 Ga0070661_100206497 3300005344 Bacteria 1502
14 Ga0070661_100521780 3300005344 Bacteria 953
15 Ga0070668_100017686 3300005347 Bacteria 5346
16 Ga0070668_100422173 3300005347 Bacteria 1142
17 Ga0070675_100185968 3300005354 Bacteria 1798
18 Ga0070675_101094441 3300005354 Bacteria 733
19 Ga0070671_100817784 3300005355 Bacteria 812
20 Ga0070667_100244194 3300005367 Bacteria 1604
21 Ga0070662_100720467 3300005457 Bacteria 845
22 Ga0070698_101778839 3300005471 Bacteria 569
23 Ga0068853_100327449 3300005539 Bacteria 1421
24 Ga0070672_100020534 3300005543 Bacteria 4819
25 Ga0070672_100297887 3300005543 Bacteria 1366
26 Ga0070672_100319067 3300005543 Bacteria 1320
27 Ga0070672_101226131 3300005543 Bacteria 669
28 Ga0070696_100018992 3300005546 Bacteria 4653
29 Ga0070696_100247775 3300005546 Bacteria 1346
30 Ga0070693_100802082 3300005547 Bacteria 698
31 Ga0070665_100122998 3300005548 Bacteria 2597
32 Ga0070665_100223244 3300005548 Bacteria 1885
33 Ga0070664_100041467 3300005564 Bacteria 3884
34 Ga0068859_101132432 3300005617 Bacteria 861
35 Ga0068864_100031250 3300005618 Bacteria 4517
36 Ga0068861_100492862 3300005719 Bacteria 1106
37 Ga0068858_101826388 3300005842 Bacteria 600
38 Ga0068860_100010996 3300005843 Bacteria 8923
39 Ga0068862_100004145 3300005844 Bacteria 12281
40 Ga0068862_100599993 3300005844 Bacteria 1057
41 Ga0081455_10659276 3300005937 Bacteria 672
42 Ga0075364_10061574 3300006051 Bacteria 2462
43 Ga0075369_10038024 3300006186 Bacteria 2052
44 Ga0075428_101845080 3300006844 Bacteria 629
45 Ga0097620_101132229 3300006931 Bacteria 861
46 Ga0105244_10026348 3300009036 Bacteria 3148
47 Ga0111539_10715170 3300009094 Bacteria 1166
48 Ga0105241_10821269 3300009174 Bacteria 858
49 Ga0105248_10233895 3300009177 Bacteria 2069
50 Ga0105248_12081668 3300009177 Bacteria 645
51 Ga0105237_10007880 3300009545 Bacteria 11612
52 Ga0105237_10344493 3300009545 Bacteria 1494
53 Ga0105239_11211057 3300010375 Bacteria 870
54 Ga0157370_10257329 3300013104 Bacteria 1614
55 Ga0157369_10158950 3300013105 Bacteria 2386
56 Ga0163162_12019370 3300013306 Bacteria 661
57 Ga0157372_10273019 3300013307 Bacteria 1965
58 Ga0157372_12932719 3300013307 Bacteria 546
59 Ga0157375_10030002 3300013308 Bacteria 5121
60 Ga0157375_10965644 3300013308 Bacteria 993
61 Ga0163163_10657113 3300014325 Bacteria 1112
62 Ga0163163_11976986 3300014325 Unclassified 643
63 Ga0157380_10085317 3300014326 Bacteria 2591
64 Ga0157380_11101766 3300014326 Bacteria 833
65 Ga0157380_12086229 3300014326 Bacteria 630
66 Ga0157380_12137126 3300014326 Bacteria 623
67 Ga0157380_12616342 3300014326 Bacteria 571
68 Ga0163161_10060133 3300017792 Bacteria 2765
69 Ga0207682_10076630 3300025893 Bacteria 1425
70 Ga0207692_10784195 3300025898 Bacteria 622
71 Ga0207688_10122928 3300025901 Bacteria 1516
72 Ga0207680_10019101 3300025903 Unclassified 3661
73 Ga0207705_10334787 3300025909 Bacteria 1165
74 Ga0207695_10028601 3300025913 Bacteria 6174
75 Ga0207671_10002107 3300025914 Bacteria 21712
76 Ga0207671_10602227 3300025914 Bacteria 876
77 Ga0207649_10661831 3300025920 Bacteria 808
78 Ga0207649_10777603 3300025920 Bacteria 746
79 Ga0207646_10764410 3300025922 Bacteria 862
80 Ga0207681_10121373 3300025923 Bacteria 1917
81 Ga0207650_10094862 3300025925 Bacteria 2286
82 Ga0207650_10255522 3300025925 Bacteria 1420
83 Ga0207650_10474483 3300025925 Bacteria 1043
84 Ga0207659_11206920 3300025926 Bacteria 650
85 Ga0207706_10028754 3300025933 Bacteria 4962
86 Ga0207706_10524251 3300025933 Bacteria 1021
87 Ga0207691_10038815 3300025940 Bacteria 4406
88 Ga0207711_10192405 3300025941 Bacteria 1860
89 Ga0207679_10663571 3300025945 Bacteria 944
90 Ga0207668_10000646 3300025972 Bacteria 21435
91 Ga0207668_10045803 3300025972 Bacteria 2985
92 Ga0207658_10485533 3300025986 Bacteria 1098
93 Ga0207639_10299259 3300026041 Bacteria 1421
94 Ga0207708_10099320 3300026075 Bacteria 2251
95 Ga0207674_10377405 3300026116 Bacteria 1371
96 Ga0207683_10696169 3300026121 Bacteria 942
97 Ga0209974_10128258 3300027876 Bacteria 903
98 Ga0268266_10107748 3300028379 Bacteria 2464
99 Ga0268266_10340114 3300028379 Bacteria 1408
100 Ga0268265_10099710 3300028380 Bacteria 2342
101 Ga0268265_11072761 3300028380 Bacteria 798
102 Ga0314311_1107797 3300030733 Bacteria 1510
103 Ga0316178_1016738 3300030735 Bacteria 1356
104 Ga0316180_1006606 3300030736 Bacteria 1790
105 Ga0316183_1144312 3300030742 Bacteria 2210
106 Ga0316182_1265982 3300030745 Bacteria 1012
107 Ga0307513_10505180 3300031456 Bacteria 926
108 Ga0307408_100262813 3300031548 Bacteria 1429
109 Ga0307405_10117546 3300031731 Bacteria 1813
110 Ga0307405_10237155 3300031731 Bacteria 1348
111 Ga0307405_10433026 3300031731 Bacteria 1038
112 Ga0307413_10021374 3300031824 Bacteria 3463
113 Ga0307413_10047874 3300031824 Bacteria 2552
114 Ga0307413_10069798 3300031824 Bacteria 2206
115 Ga0307413_10166064 3300031824 Bacteria 1557
116 Ga0307413_10276459 3300031824 Bacteria 1260
117 Ga0307413_11184515 3300031824 Bacteria 664
118 Ga0307413_11251583 3300031824 Bacteria 647
119 Ga0307413_12099919 3300031824 Bacteria 511
120 Ga0307410_10019097 3300031852 Bacteria 4161
121 Ga0307410_10069777 3300031852 Bacteria 2432
122 Ga0307410_10092300 3300031852 Bacteria 2152
123 Ga0307410_10398382 3300031852 Bacteria 1111
124 Ga0307410_11310994 3300031852 Bacteria 633
125 Ga0307406_10290916 3300031901 Bacteria 1251
126 Ga0307406_11280893 3300031901 Bacteria 639
127 Ga0307407_10004747 3300031903 Bacteria 5812
128 Ga0307407_10141307 3300031903 Bacteria 1553
129 Ga0307407_10179938 3300031903 Bacteria 1401
130 Ga0307407_10211775 3300031903 Bacteria 1305
131 Ga0307407_10480271 3300031903 Bacteria 907
132 Ga0307407_10575545 3300031903 Bacteria 835
133 Ga0307407_10627889 3300031903 Bacteria 803
134 Ga0307412_10141352 3300031911 Bacteria 1763
135 Ga0307412_10366744 3300031911 Bacteria 1162
136 Ga0307409_100018886 3300031995 Bacteria 4651
137 Ga0307409_100072476 3300031995 Bacteria 2743
138 Ga0307409_100081859 3300031995 Bacteria 2611
139 Ga0307409_100167803 3300031995 Bacteria 1928
140 Ga0307409_100195299 3300031995 Bacteria 1805
141 Ga0307409_100202452 3300031995 Bacteria 1777
142 Ga0307409_100224973 3300031995 Bacteria 1696
143 Ga0307409_100863757 3300031995 Bacteria 916
144 Ga0307409_101369890 3300031995 Bacteria 733
145 Ga0307409_101410131 3300031995 Bacteria 723
146 Ga0307416_100207884 3300032002 Bacteria 1864
147 Ga0307416_100243550 3300032002 Bacteria 1744
148 Ga0307416_100612622 3300032002 Bacteria 1170
149 Ga0307416_100693893 3300032002 Bacteria 1106
150 Ga0307414_10024954 3300032004 Bacteria 3820
151 Ga0307414_10263133 3300032004 Bacteria 1440
152 Ga0307414_10342328 3300032004 Bacteria 1280
153 Ga0307414_10537744 3300032004 Bacteria 1039
154 Ga0307414_10644290 3300032004 Bacteria 954
155 Ga0307414_10763983 3300032004 Bacteria 879
156 Ga0307414_11121798 3300032004 Bacteria 727
157 Ga0307411_10026929 3300032005 Bacteria 3469
158 Ga0307411_10041514 3300032005 Bacteria 2927
159 Ga0307411_10057460 3300032005 Bacteria 2570
160 Ga0307411_10100373 3300032005 Bacteria 2045
161 Ga0307411_10107378 3300032005 Bacteria 1989
162 Ga0307411_10173568 3300032005 Bacteria 1628
163 Ga0307411_10223142 3300032005 Bacteria 1463
164 Ga0307411_10359839 3300032005 Bacteria 1189
165 Ga0307411_10762140 3300032005 Bacteria 849
166 Ga0307411_10941463 3300032005 Bacteria 770
167 Ga0307415_100224601 3300032126 Bacteria 1508
168 Ga0307415_100306384 3300032126 Bacteria 1318
169 Ga0307415_100624111 3300032126 Bacteria 963
170 Ga0307415_100777936 3300032126 Bacteria 871
171 Ga0307415_101705853 3300032126 Bacteria 607
172 Ga0307415_101756194 3300032126 Bacteria 599
173 Ga0307415_101878307 3300032126 Bacteria 581
174 Ga0307415_101983566 3300032126 Bacteria 566
175 Ga0373955_1035053 3300035172 Bacteria 506
176 Ga0373927_0021876 3300035695 Unclassified 4192
177 Ga0373937_0915930 3300036401 Unclassified 825
178 Ga0395900_0564954 3300037418 Bacteria 1081
179 Ga0395905_0010320 3300037471 Bacteria 9089
180 Ga0395905_0015469 3300037471 Bacteria 7253
181 Ga0395905_0175075 3300037471 Bacteria 2015
182 Ga0395905_0251327 3300037471 Bacteria 1651
183 Ga0439447_031186 3300041407 Bacteria 1339
184 Ga0439465_0218029 3300041413 Bacteria 699
185 Ga0451802_1154787 3300041460 Bacteria 721
186 Ga0451853_0784489 3300041512 Bacteria 1636
187 Ga0439432_104362 3300042006 Bacteria 846
188 Ga0439462_0002157 3300042015 Bacteria 4525
189 Ga0466977_0000280 3300044666 Bacteria 14748
190 Ga0466978_0578894 3300044671 Bacteria 558
191 Ga0466963_0119623 3300044694 Bacteria 1812
192 Ga0466967_0060818 3300045976 Bacteria 3349
193 Ga0466967_0152962 3300045976 Bacteria 2158
194 Ga0495590_0151380 3300046457 Bacteria 841
195 Ga0495591_033790 3300046458 Bacteria 1511
196 Ga0495653_0275074 3300046463 Bacteria 1107
197 Ga0495653_0489385 3300046463 Bacteria 768
198 Ga0495650_0044469 3300046471 Bacteria 1877
199 Ga0495580_0021978 3300046472 Unclassified 4702
200 Ga0495664_0036305 3300046477 Bacteria 2904
201 Ga0495583_0099262 3300046506 Bacteria 1244
202 Ga0495606_0043768 3300046507 Bacteria 2982
203 Ga0495606_0169940 3300046507 Bacteria 1265
204 Ga0495628_0090941 3300046516 Bacteria 2362
205 Ga0495630_0457631 3300046517 Bacteria 978
206 Ga0495648_0164109 3300046524 Bacteria 1145
207 Ga0495642_0103156 3300046528 Bacteria 1215
208 Ga0495652_0444823 3300046529 Bacteria 908
209 Ga0495586_0140743 3300046535 Bacteria 1354
210 Ga0495598_0047861 3300046537 Bacteria 1277
211 Ga0495621_0020368 3300046539 Bacteria 2176
212 Ga0495667_0071089 3300046559 Bacteria 2270
213 Ga0495656_0094877 3300046615 Bacteria 1371
214 Ga0495668_0124548 3300046616 Bacteria 1410
215 Ga0495668_0647777 3300046616 Bacteria 584
216 Ga0495635_0453861 3300046663 Bacteria 847
217 Ga0495588_0725146 3300046674 Bacteria 520
218 Ga0495623_0088122 3300046679 Bacteria 1911
219 Ga0495646_0052766 3300046680 Bacteria 2454
220 Ga0495624_0104993 3300046690 Bacteria 1738
221 Ga0495649_0035481 3300046694 Bacteria 2743
222 Ga0495649_0075463 3300046694 Bacteria 1805
223 Ga0495604_0060221 3300047317 Bacteria 2908
224 Ga0495674_0480593 3300047319 Bacteria 995
225 Ga0495675_0145462 3300047444 Bacteria 1467
226 Ga0495602_0430186 3300048088 Bacteria 935
227 Ga0495615_0001475 3300048090 Bacteria 3522
228 Ga0496101_0181190 3300048904 Bacteria 1622
229 Ga0496101_1085936 3300048904 Bacteria 628
230 Ga0496102_0045568 3300048905 Bacteria 3982
231 Ga0496103_0017788 3300048906 Bacteria 4258
232 Ga0496103_0126995 3300048906 Bacteria 1627
233 Ga0496105_0138184 3300048908 Bacteria 2006
234 Ga0496108_0016861 3300048911 Bacteria 5970
235 Ga0496109_1019700 3300048912 Bacteria 765
236 Ga0496110_1241022 3300048913 Bacteria 654
237 Ga0496114_0114415 3300048917 Bacteria 2314
238 Ga0496116_0192302 3300048919 Bacteria 1079
239 Ga0496117_0006520 3300048920 Bacteria 11761
240 Ga0496118_0000370 3300048921 Bacteria 75668
241 Ga0496121_0683416 3300048924 Bacteria 620
242 Ga0496122_0023515 3300048925 Bacteria 5429
243 Ga0496122_0348843 3300048925 Bacteria 774
244 Ga0496124_0047144 3300048927 Bacteria 3688
245 Ga0496126_0597000 3300048929 Bacteria 870
246 Ga0496126_0930392 3300048929 Bacteria 657
247 Ga0501031_0764443 3300049568 Bacteria 620
248 Ga0501072_0286838 3300049588 Bacteria 1309
249 Ga0501044_0000053 3300049823 Bacteria 141732
250 nmdc:mga03683_69157_c1 3300050489 Bacteria 1506
251 nmdc:mga00v17_53441_c1 3300050491 Bacteria 2462
252 nmdc:mga07m45_354901_c1 3300050496 Bacteria 852
253 nmdc:mga08y16_434562_c1 3300050511 Bacteria 1340
254 nmdc:mga0sz30_29167_c1 3300050516 Bacteria 2273
255 Ga0500647_0322276 3300053091 Bacteria 653
256 Ga0500614_009200 3300053123 Bacteria 2105
257 Ga0500658_0245841 3300053134 Bacteria 822
258 Ga0500559_0032841 3300053136 Bacteria 2232
259 Ga0500604_0214228 3300053151 Bacteria 663
260 Ga0500616_0000451 3300053153 Bacteria 53891
261 Ga0500587_001700 3300053739 Bacteria 3128
262 Ga0070707_100990065
263 Ga0065712_10456989
264 Ga0065715_10205444
265 Ga0065715_10616322
266 Ga0070658_10308526
267 Ga0070676_10784448
268 Ga0070670_100081891
269 Ga0070666_10013870
270 Ga0070666_10189371
271 Ga0068868_100277961
272 Ga0070660_101696896
273 Ga0070661_100098650
274 Ga0070661_100206497
275 Ga0070661_100521780
276 Ga0070668_100017686
277 Ga0070668_100422173
278 Ga0070675_100185968
279 Ga0070675_101094441
280 Ga0070671_100817784
281 Ga0070667_100244194
282 Ga0070662_100720467
283 Ga0070698_101778839
284 Ga0068853_100327449
285 Ga0070672_100020534
286 Ga0070672_100297887
287 Ga0070672_100319067
288 Ga0070672_101226131
289 Ga0070696_100018992
290 Ga0070696_100247775
291 Ga0070693_100802082
292 Ga0070665_100122998
293 Ga0070665_100223244
294 Ga0070664_100041467
295 Ga0068859_101132432
296 Ga0068864_100031250
297 Ga0068861_100492862
298 Ga0068858_101826388
299 Ga0068860_100010996
300 Ga0068862_100004145
301 Ga0068862_100599993
302 Ga0081455_10659276
303 Ga0075364_10061574
304 Ga0075369_10038024
305 Ga0075428_101845080
306 Ga0097620_101132229
307 Ga0105244_10026348
308 Ga0111539_10715170
309 Ga0105241_10821269
310 Ga0105248_10233895
311 Ga0105248_12081668
312 Ga0105237_10007880
313 Ga0105237_10344493
314 Ga0105239_11211057
315 Ga0157370_10257329
316 Ga0157369_10158950
317 Ga0163162_12019370
318 Ga0157372_10273019
319 Ga0157372_12932719
320 Ga0157375_10030002
321 Ga0157375_10965644
322 Ga0163163_10657113
323 Ga0163163_11976986
324 Ga0157380_10085317
325 Ga0157380_11101766
326 Ga0157380_12086229
327 Ga0157380_12137126
328 Ga0157380_12616342
329 Ga0163161_10060133
330 Ga0207682_10076630
331 Ga0207692_10784195
332 Ga0207688_10122928
333 Ga0207680_10019101
334 Ga0207705_10334787
335 Ga0207695_10028601
336 Ga0207671_10002107
337 Ga0207671_10602227
338 Ga0207649_10661831
339 Ga0207649_10777603
340 Ga0207646_10764410
341 Ga0207681_10121373
342 Ga0207650_10094862
343 Ga0207650_10255522
344 Ga0207650_10474483
345 Ga0207659_11206920
346 Ga0207706_10028754
347 Ga0207706_10524251
348 Ga0207691_10038815
349 Ga0207711_10192405
350 Ga0207679_10663571
351 Ga0207668_10000646
352 Ga0207668_10045803
353 Ga0207658_10485533
354 Ga0207639_10299259
355 Ga0207708_10099320
356 Ga0207674_10377405
357 Ga0207683_10696169
358 Ga0209974_10128258
359 Ga0268266_10107748
360 Ga0268266_10340114
361 Ga0268265_10099710
362 Ga0268265_11072761
363 Ga0314311_1107797
364 Ga0316178_1016738
365 Ga0316180_1006606
366 Ga0316183_1144312
367 Ga0316182_1265982
368 Ga0307513_10505180
369 Ga0307408_100262813
370 Ga0307405_10117546
371 Ga0307405_10237155
372 Ga0307405_10433026
373 Ga0307413_10021374
374 Ga0307413_10047874
375 Ga0307413_10069798
376 Ga0307413_10166064
377 Ga0307413_10276459
378 Ga0307413_11184515
379 Ga0307413_11251583
380 Ga0307413_12099919
381 Ga0307410_10019097
382 Ga0307410_10069777
383 Ga0307410_10092300
384 Ga0307410_10398382
385 Ga0307410_11310994
386 Ga0307406_10290916
387 Ga0307406_11280893
388 Ga0307407_10004747
389 Ga0307407_10141307
390 Ga0307407_10179938
391 Ga0307407_10211775
392 Ga0307407_10480271
393 Ga0307407_10575545
394 Ga0307407_10627889
395 Ga0307412_10141352
396 Ga0307412_10366744
397 Ga0307409_100018886
398 Ga0307409_100072476
399 Ga0307409_100081859
400 Ga0307409_100167803
401 Ga0307409_100195299
402 Ga0307409_100202452
403 Ga0307409_100224973
404 Ga0307409_100863757
405 Ga0307409_101369890
406 Ga0307409_101410131
407 Ga0307416_100207884
408 Ga0307416_100243550
409 Ga0307416_100612622
410 Ga0307416_100693893
411 Ga0307414_10024954
412 Ga0307414_10263133
413 Ga0307414_10342328
414 Ga0307414_10537744
415 Ga0307414_10644290
416 Ga0307414_10763983
417 Ga0307414_11121798
418 Ga0307411_10026929
419 Ga0307411_10041514
420 Ga0307411_10057460
421 Ga0307411_10100373
422 Ga0307411_10107378
423 Ga0307411_10173568
424 Ga0307411_10223142
425 Ga0307411_10359839
426 Ga0307411_10762140
427 Ga0307411_10941463
428 Ga0307415_100224601
429 Ga0307415_100306384
430 Ga0307415_100624111
431 Ga0307415_100777936
432 Ga0307415_101705853
433 Ga0307415_101756194
434 Ga0307415_101878307
435 Ga0307415_101983566
436 Ga0373955_1035053
437 Ga0373927_0021876
438 Ga0373937_0915930
439 Ga0395900_0564954
440 Ga0395905_0010320
441 Ga0395905_0015469
442 Ga0395905_0175075
443 Ga0395905_0251327
444 Ga0439447_031186
445 Ga0439465_0218029
446 Ga0451802_1154787
447 Ga0451853_0784489
448 Ga0439432_104362
449 Ga0439462_0002157
450 Ga0466977_0000280
451 Ga0466978_0578894
452 Ga0466963_0119623
453 Ga0466967_0060818
454 Ga0466967_0152962
455 Ga0495590_0151380
456 Ga0495591_033790
457 Ga0495653_0275074
458 Ga0495653_0489385
459 Ga0495650_0044469
460 Ga0495580_0021978
461 Ga0495664_0036305
462 Ga0495583_0099262
463 Ga0495606_0043768
464 Ga0495606_0169940
465 Ga0495628_0090941
466 Ga0495630_0457631
467 Ga0495648_0164109
468 Ga0495642_0103156
469 Ga0495652_0444823
470 Ga0495586_0140743
471 Ga0495598_0047861
472 Ga0495621_0020368
473 Ga0495667_0071089
474 Ga0495656_0094877
475 Ga0495668_0124548
476 Ga0495668_0647777
477 Ga0495635_0453861
478 Ga0495588_0725146
479 Ga0495623_0088122
480 Ga0495646_0052766
481 Ga0495624_0104993
482 Ga0495649_0035481
483 Ga0495649_0075463
484 Ga0495604_0060221
485 Ga0495674_0480593
486 Ga0495675_0145462
487 Ga0495602_0430186
488 Ga0495615_0001475
489 Ga0496101_0181190
490 Ga0496101_1085936
491 Ga0496102_0045568
492 Ga0496103_0017788
493 Ga0496103_0126995
494 Ga0496105_0138184
495 Ga0496108_0016861
496 Ga0496109_1019700
497 Ga0496110_1241022
498 Ga0496114_0114415
499 Ga0496116_0192302
500 Ga0496117_0006520
501 Ga0496118_0000370
502 Ga0496121_0683416
503 Ga0496122_0023515
504 Ga0496122_0348843
505 Ga0496124_0047144
506 Ga0496126_0597000
507 Ga0496126_0930392
508 Ga0501031_0764443
509 Ga0501072_0286838
510 Ga0501044_0000053
511 nmdc:mga03683_69157_c1
512 nmdc:mga00v17_53441_c1
513 nmdc:mga07m45_354901_c1
514 nmdc:mga08y16_434562_c1
515 nmdc:mga0sz30_29167_c1
516 Ga0500647_0322276
517 Ga0500614_009200
518 Ga0500658_0245841
519 Ga0500559_0032841
520 Ga0500604_0214228
521 Ga0500616_0000451
522 Ga0500587_001700

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01741

MscL

Large-conductance mechanosensitive channel, MscL

13

150

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6dqe-assembly1.cif.gz_A linked kdm5a jmj domain bound to the inhibitor n67 i.e. 2-(5-phenyl-4-(phenyl(2-(piperidin-1-yl)ethoxy)methyl)-1h-pyrazol-1-yl)isonicotinic acid 0.7478 70 84
6dqa-assembly1.cif.gz_A linked kdm5a jmj domain bound to inhibitor n70 i.e.[2-((3-aminophenyl)(2-(piperidin-1-yl)ethoxy)methyl)thieno[3,2-b]pyridine-7-carboxylic acid] 0.7366 70 84
6ctd-assembly1.cif.gz_C c-terminal domain truncation of the mycobacterium tuberculosis mechanosensitive channel of large conductance mscl 0.6126 4 107
4y7k-assembly1.cif.gz_D structure of an archaeal mechanosensitive channel in closed state 0.611 1 115
6ctd-assembly1.cif.gz_C c-terminal domain truncation of the mycobacterium tuberculosis mechanosensitive channel of large conductance mscl 0.5692 4 107
ID Description Score Start End Superfamily
af_P68805_1_94_1.10.1200.120 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;Large-conductance mechanosensitive channel, MscL; domain 1 0.7458 1 116 1.10.1200.120
af_P68805_1_94_1.10.1200.120 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;Large-conductance mechanosensitive channel, MscL; domain 1 0.7331 1 116 1.10.1200.120
2oarA01 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;Large-conductance mechanosensitive channel, MscL; domain 1 0.5852 1 111 1.10.1200.120
2oarA01 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;Large-conductance mechanosensitive channel, MscL; domain 1 0.5756 1 111 1.10.1200.120
2oarD00 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;Large-conductance mechanosensitive channel, MscL; domain 1 0.5013 1 138 1.10.1200.120
ID Description Score Start End GO Terms
AF-A0A1Y1YNH5-F1-model_v4 MscL-domain-containing protein 0.9007 1 113 GO:0005886
GO:0008381
AF-A0A1F9EY47-F1-model_v4 Mechanosensitive ion channel protein MscL 0.87 1 107 GO:0005886
GO:0008381
AF-A0A2M8NIP0-F1-model_v4 Large-conductance mechanosensitive channel 0.8624 1 125 GO:0005886
GO:0008381
AF-D5U6R9-F1-model_v4 Large-conductance mechanosensitive channel 0.8605 1 119 GO:0005886
GO:0008381
AF-A0A6A6URQ1-F1-model_v4 Gated mechanosensitive channel 0.857 2 113 GO:0005509
GO:0008381
GO:0016020

Map