F370165

General Info

Members Datasets Scaffolds Average Seq Length
261 157 522 87

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100101647|Ga0070708_1001016473
Length 86
Sequence MCTYSTEHVPAAGSGKGATGWFRLSEVSVYLDHPAHALAGHTLNIDFLSPAQGPSARVAVELTAQTALALARAIESTLAAAPPGLA

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
36 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
46 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
47 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
74 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
75 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
76 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
77 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
78 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
79 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
80 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
81 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
82 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
83 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
84 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
85 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
86 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
87 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
88 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
89 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
90 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
91 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
92 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
93 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
94 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
95 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
96 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
97 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
98 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
99 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
100 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
101 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
102 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
103 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
104 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
105 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
106 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
107 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
108 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
109 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
110 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
111 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
112 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
113 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
114 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
115 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
116 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
117 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
118 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
119 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
120 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
121 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
122 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
123 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
137 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
138 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
139 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
140 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
141 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
142 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
143 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
144 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
145 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
146 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
148 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
149 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
150 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
151 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
152 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
153 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
154 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
155 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
156 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
157 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.49
Metatranscriptomes 4.98
Isolates 1.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.05
Rhizosphere 89.27
Stem 0
Stem Tuber 0
Unclassified 2.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100101647 3300005445 Bacteria 2633
2 JGI24740J21852_10043374 3300001979 Bacteria 1341
3 JGI24737J22298_10058577 3300001990 Bacteria 1161
4 JGI24735J21928_10086317 3300002067 Bacteria 899
5 JGI24735J21928_10147914 3300002067 Bacteria 678
6 Ga0070658_10759526 3300005327 Bacteria 842
7 Ga0070658_11978993 3300005327 Bacteria 503
8 Ga0070683_100056302 3300005329 Bacteria 3651
9 Ga0070683_100492400 3300005329 Bacteria 1171
10 Ga0070683_101065989 3300005329 Bacteria 776
11 Ga0070683_101220910 3300005329 Bacteria 722
12 Ga0070680_100182596 3300005336 Bacteria 1767
13 Ga0070682_101404965 3300005337 Unclassified 597
14 Ga0068868_101831232 3300005338 Bacteria 574
15 Ga0070660_101665978 3300005339 Bacteria 543
16 Ga0070687_100192345 3300005343 Bacteria 1230
17 Ga0070661_100267452 3300005344 Bacteria 1323
18 Ga0070661_101735312 3300005344 Bacteria 529
19 Ga0070659_100927155 3300005366 Bacteria 762
20 Ga0070659_101089402 3300005366 Bacteria 704
21 Ga0070709_10407650 3300005434 Bacteria 1016
22 Ga0070714_102224855 3300005435 Bacteria 534
23 Ga0070708_100069217 3300005445 Bacteria 3173
24 Ga0070663_101440104 3300005455 Bacteria 611
25 Ga0070663_101459839 3300005455 Bacteria 607
26 Ga0070681_10703768 3300005458 Bacteria 926
27 Ga0070685_11053429 3300005466 Bacteria 612
28 Ga0070706_100140585 3300005467 Bacteria 2254
29 Ga0070698_100624690 3300005471 Bacteria 1018
30 Ga0070698_101829926 3300005471 Bacteria 560
31 Ga0070679_100009833 3300005530 Bacteria 9049
32 Ga0070679_100119678 3300005530 Bacteria 2618
33 Ga0070679_100301215 3300005530 Bacteria 1554
34 Ga0070679_100849571 3300005530 Bacteria 856
35 Ga0070684_100736358 3300005535 Bacteria 920
36 Ga0070684_100809547 3300005535 Bacteria 876
37 Ga0070695_101315885 3300005545 Bacteria 597
38 Ga0070665_100000310 3300005548 Bacteria 75775
39 Ga0070665_100522339 3300005548 Bacteria 1199
40 Ga0070664_101253507 3300005564 Bacteria 700
41 Ga0070664_101367298 3300005564 Bacteria 669
42 Ga0068857_100379930 3300005577 Bacteria 1312
43 Ga0068856_100801009 3300005614 Bacteria 962
44 Ga0068859_100013916 3300005617 Bacteria 8072
45 Ga0068860_101215182 3300005843 Bacteria 774
46 Ga0070717_10073695 3300006028 Bacteria 2854
47 Ga0068865_100760021 3300006881 Bacteria 833
48 Ga0068865_101173330 3300006881 Bacteria 679
49 Ga0097620_100013916 3300006931 Bacteria 8072
50 Ga0105244_10301964 3300009036 Bacteria 741
51 Ga0105245_10571062 3300009098 Bacteria 1155
52 Ga0105247_10012404 3300009101 Bacteria 5118
53 Ga0105243_10086782 3300009148 Bacteria 2567
54 Ga0105242_10042688 3300009176 Bacteria 3664
55 Ga0105242_11464057 3300009176 Bacteria 712
56 Ga0105248_11020109 3300009177 Bacteria 935
57 Ga0105246_10048278 3300011119 Bacteria 2909
58 Ga0105246_10098919 3300011119 Bacteria 2120
59 Ga0157369_10524199 3300013105 Bacteria 1225
60 Ga0157369_10650907 3300013105 Bacteria 1087
61 Ga0157369_10698072 3300013105 Bacteria 1045
62 Ga0157374_11290357 3300013296 Bacteria 752
63 Ga0157372_13039374 3300013307 Bacteria 536
64 Ga0157375_10533729 3300013308 Bacteria 1336
65 Ga0157375_13069264 3300013308 Bacteria 557
66 Ga0163163_10096487 3300014325 Bacteria 2976
67 Ga0163163_11157511 3300014325 Bacteria 836
68 Ga0157379_11489094 3300014968 Bacteria 658
69 Ga0163161_10699855 3300017792 Bacteria 844
70 Ga0197907_11137903 3300020069 Bacteria 768
71 Ga0197907_11202911 3300020069 Bacteria 822
72 Ga0206356_10036690 3300020070 Bacteria 2437
73 Ga0206356_10313673 3300020070 Bacteria 891
74 Ga0206354_10685403 3300020081 Bacteria 550
75 Ga0206354_10705592 3300020081 Bacteria 802
76 Ga0206353_10963521 3300020082 Bacteria 2154
77 Ga0206353_11314918 3300020082 Bacteria 543
78 Ga0206353_11321212 3300020082 Bacteria 1764
79 Ga0206353_11347839 3300020082 Bacteria 645
80 Ga0206353_11526191 3300020082 Bacteria 2026
81 Ga0206353_11935975 3300020082 Bacteria 637
82 Ga0224712_10421402 3300022467 Bacteria 638
83 Ga0207710_10006007 3300025900 Bacteria 5203
84 Ga0207688_10596241 3300025901 Unclassified 696
85 Ga0207647_10015699 3300025904 Bacteria 5186
86 Ga0207647_10085925 3300025904 Bacteria 1881
87 Ga0207705_10460367 3300025909 Bacteria 987
88 Ga0207684_10108394 3300025910 Bacteria 2377
89 Ga0207707_10179510 3300025912 Bacteria 1849
90 Ga0207707_10657861 3300025912 Bacteria 883
91 Ga0207660_10446387 3300025917 Bacteria 1046
92 Ga0207657_10179899 3300025919 Bacteria 1710
93 Ga0207649_10721059 3300025920 Bacteria 774
94 Ga0207652_10320590 3300025921 Bacteria 1399
95 Ga0207652_11027349 3300025921 Bacteria 723
96 Ga0207646_10062112 3300025922 Bacteria 3335
97 Ga0207646_11270590 3300025922 Bacteria 644
98 Ga0207687_10491068 3300025927 Bacteria 1024
99 Ga0207706_11363159 3300025933 Bacteria 584
100 Ga0207686_10224014 3300025934 Bacteria 1360
101 Ga0207686_10746514 3300025934 Bacteria 781
102 Ga0207686_11072385 3300025934 Bacteria 656
103 Ga0207704_11339297 3300025938 Bacteria 613
104 Ga0207711_10792098 3300025941 Bacteria 883
105 Ga0207711_10945340 3300025941 Bacteria 801
106 Ga0207661_10006734 3300025944 Bacteria 8132
107 Ga0207661_11106609 3300025944 Bacteria 729
108 Ga0207661_11128667 3300025944 Bacteria 722
109 Ga0207661_11426159 3300025944 Bacteria 635
110 Ga0207667_11283671 3300025949 Bacteria 709
111 Ga0207702_11831281 3300026078 Bacteria 599
112 Ga0207674_10088769 3300026116 Bacteria 3084
113 Ga0268266_10004222 3300028379 Bacteria 13835
114 Ga0307405_11588780 3300031731 Bacteria 577
115 Ga0373943_0798382 3300035170 Bacteria 562
116 Ga0395899_0090514 3300037312 Bacteria 2218
117 Ga0395900_0306254 3300037418 Bacteria 1573
118 Ga0395898_0015366 3300037466 Bacteria 7850
119 Ga0395898_0025462 3300037466 Bacteria 5961
120 Ga0395901_0010996 3300038443 Bacteria 9169
121 Ga0395901_0089487 3300038443 Bacteria 3221
122 Ga0436365_1611719 3300039437 Bacteria 1962
123 Ga0451793_1661995 3300041452 Bacteria 1219
124 Ga0466969_0097391 3300044656 Bacteria 1388
125 Ga0466972_0039653 3300044658 Bacteria 2298
126 Ga0466965_0253710 3300044683 Bacteria 944
127 Ga0466966_0537790 3300044684 Bacteria 703
128 Ga0466961_0039189 3300044693 Bacteria 3038
129 Ga0466961_0115989 3300044693 Bacteria 1683
130 Ga0466961_0129086 3300044693 Bacteria 1585
131 Ga0466961_0133501 3300044693 Bacteria 1555
132 Ga0466961_0256891 3300044693 Bacteria 1072
133 Ga0466963_0014678 3300044694 Bacteria 4833
134 Ga0466963_0020992 3300044694 Bacteria 4115
135 Ga0466963_0025425 3300044694 Bacteria 3776
136 Ga0466963_0044875 3300044694 Bacteria 2910
137 Ga0466963_0141618 3300044694 Bacteria 1666
138 Ga0466963_0314497 3300044694 Bacteria 1102
139 Ga0466963_0887076 3300044694 Bacteria 629
140 Ga0466964_0167337 3300044706 Bacteria 1032
141 Ga0466971_0027059 3300044719 Bacteria 2567
142 Ga0466971_0402026 3300044719 Bacteria 668
143 Ga0466957_0023694 3300044842 Bacteria 3630
144 Ga0466957_0165461 3300044842 Bacteria 1438
145 Ga0466957_0496956 3300044842 Bacteria 845
146 Ga0466960_0312928 3300044901 Bacteria 887
147 Ga0466960_0725434 3300044901 Bacteria 598
148 Ga0466959_0107339 3300045049 Bacteria 1995
149 Ga0466959_0113539 3300045049 Bacteria 1931
150 Ga0466959_0167745 3300045049 Bacteria 1541
151 Ga0466958_0031890 3300045836 Bacteria 3132
152 Ga0466958_0125937 3300045836 Bacteria 1606
153 Ga0466958_0404933 3300045836 Bacteria 881
154 Ga0466958_0576530 3300045836 Bacteria 731
155 Ga0466958_0717883 3300045836 Bacteria 651
156 Ga0466967_0060598 3300045976 Bacteria 3354
157 Ga0466967_0083948 3300045976 Bacteria 2881
158 Ga0466967_0271960 3300045976 Bacteria 1624
159 Ga0466967_0274480 3300045976 Unclassified 1616
160 Ga0466967_0287030 3300045976 Bacteria 1580
161 Ga0466967_0524322 3300045976 Bacteria 1164
162 Ga0466967_0940812 3300045976 Bacteria 860
163 Ga0466967_2153595 3300045976 Bacteria 554
164 Ga0495629_0408735 3300046459 Bacteria 922
165 Ga0495653_0305936 3300046463 Bacteria 1035
166 Ga0495664_0424083 3300046477 Bacteria 798
167 Ga0495608_0125127 3300046511 Bacteria 1647
168 Ga0495608_0558212 3300046511 Unclassified 690
169 Ga0495630_0490643 3300046517 Bacteria 942
170 Ga0495667_0530516 3300046559 Bacteria 736
171 Ga0495635_0118209 3300046663 Bacteria 1809
172 Ga0495657_0437516 3300046675 Bacteria 767
173 Ga0495658_0387021 3300046683 Bacteria 891
174 Ga0495604_0218313 3300047317 Bacteria 1314
175 Ga0495674_0789863 3300047319 Bacteria 739
176 Ga0495676_0721841 3300047321 Unclassified 644
177 Ga0495680_0165417 3300047322 Bacteria 1604
178 Ga0495680_0179700 3300047322 Bacteria 1528
179 Ga0495593_0520872 3300047673 Unclassified 596
180 Ga0496100_0530856 3300048903 Bacteria 909
181 Ga0496101_0192746 3300048904 Bacteria 1573
182 Ga0496101_1096477 3300048904 Bacteria 625
183 Ga0496102_0000110 3300048905 Bacteria 117178
184 Ga0496102_0000346 3300048905 Bacteria 56298
185 Ga0496102_0055620 3300048905 Bacteria 3608
186 Ga0496102_1231875 3300048905 Bacteria 668
187 Ga0496103_0000135 3300048906 Bacteria 77221
188 Ga0496103_0077317 3300048906 Bacteria 2089
189 Ga0496103_0085609 3300048906 Bacteria 1986
190 Ga0496104_1221822 3300048907 Bacteria 655
191 Ga0496107_0471608 3300048910 Bacteria 932
192 Ga0496108_0738110 3300048911 Bacteria 852
193 Ga0496109_0050499 3300048912 Bacteria 3788
194 Ga0496110_0250269 3300048913 Bacteria 1613
195 Ga0496114_0002498 3300048917 Bacteria 14039
196 Ga0496114_0166436 3300048917 Bacteria 1919
197 Ga0496114_0565579 3300048917 Bacteria 1004
198 Ga0496114_0784960 3300048917 Bacteria 831
199 Ga0496115_1191157 3300048918 Bacteria 573
200 Ga0496118_0069442 3300048921 Bacteria 2551
201 Ga0496119_0000153 3300048922 Bacteria 95945
202 Ga0496120_0002595 3300048923 Bacteria 17940
203 Ga0496121_0374811 3300048924 Bacteria 940
204 Ga0501031_0000154 3300049568 Bacteria 38960
205 Ga0501032_0000079 3300049569 Bacteria 83317
206 Ga0501032_0021408 3300049569 Bacteria 4494
207 Ga0501032_0024832 3300049569 Bacteria 4134
208 Ga0501033_0000278 3300049570 Bacteria 49428
209 Ga0501033_0096310 3300049570 Bacteria 2162
210 Ga0501033_0231949 3300049570 Bacteria 1311
211 Ga0501033_0309891 3300049570 Bacteria 1110
212 Ga0501034_0001706 3300049571 Bacteria 28285
213 Ga0501034_0409331 3300049571 Bacteria 1278
214 Ga0501036_0007779 3300049572 Bacteria 8765
215 Ga0501036_0038194 3300049572 Bacteria 4063
216 Ga0501037_0002734 3300049573 Bacteria 12747
217 Ga0501038_0000901 3300049574 Bacteria 26334
218 Ga0501038_0168855 3300049574 Bacteria 1772
219 Ga0501039_0071665 3300049575 Bacteria 2692
220 Ga0501039_0221236 3300049575 Bacteria 1488
221 Ga0501042_0032878 3300049578 Bacteria 3675
222 Ga0501043_0000263 3300049579 Bacteria 47686
223 Ga0501043_0015058 3300049579 Bacteria 6056
224 Ga0501043_0075618 3300049579 Bacteria 2645
225 Ga0501046_0000740 3300049580 Bacteria 31614
226 Ga0501047_0001680 3300049581 Bacteria 21539
227 Ga0501047_0040148 3300049581 Bacteria 4526
228 Ga0501047_0491504 3300049581 Bacteria 1054
229 Ga0501048_0000103 3300049582 Bacteria 46821
230 Ga0501067_0011268 3300049583 Bacteria 4949
231 Ga0501068_0137135 3300049584 Bacteria 1532
232 Ga0501069_0001278 3300049585 Bacteria 12324
233 Ga0501069_0113217 3300049585 Bacteria 1546
234 Ga0501070_0000852 3300049586 Bacteria 27667
235 Ga0501070_0000869 3300049586 Bacteria 27485
236 Ga0501070_0093379 3300049586 Bacteria 2489
237 Ga0501071_0140469 3300049587 Bacteria 1798
238 Ga0501073_0004261 3300049589 Bacteria 10721
239 Ga0501073_0289319 3300049589 Bacteria 1131
240 Ga0501074_0000185 3300049590 Bacteria 33746
241 Ga0501074_0072969 3300049590 Bacteria 2465
242 Ga0501079_0328428 3300049741 Bacteria 1198
243 Ga0501080_0000349 3300049742 Bacteria 35411
244 Ga0501083_0041242 3300049744 Bacteria 3131
245 Ga0501083_0096996 3300049744 Bacteria 1945
246 Ga0501035_0001810 3300049822 Bacteria 21613
247 Ga0501035_0004943 3300049822 Bacteria 12646
248 Ga0501035_0343775 3300049822 Bacteria 1249
249 Ga0501044_0000922 3300049823 Bacteria 35394
250 Ga0501044_0008793 3300049823 Bacteria 11047
251 Ga0495601_0245693 3300053077 Bacteria 1169
252 Ga0495595_0203427 3300053084 Bacteria 986
253 Ga0495619_0068479 3300053085 Bacteria 2371
254 Ga0501084_0003393 3300054114 Bacteria 12911
255 Ga0501082_0361676 3300060353 Bacteria 1266
256 Ga0466962_0034331 3300061719 Bacteria 2428
257 Ga0466962_0591547 3300061719 Bacteria 565
258 2643850009 2643221567 Bacteria 4163945
259 2644136012 2643221624 Bacteria 4384879
260 2799184093 2799112218 Bacteria 4315149
261 2837269832 2837268691 Bacteria 7850704
262 Ga0070708_100101647
263 JGI24740J21852_10043374
264 JGI24737J22298_10058577
265 JGI24735J21928_10086317
266 JGI24735J21928_10147914
267 Ga0070658_10759526
268 Ga0070658_11978993
269 Ga0070683_100056302
270 Ga0070683_100492400
271 Ga0070683_101065989
272 Ga0070683_101220910
273 Ga0070680_100182596
274 Ga0070682_101404965
275 Ga0068868_101831232
276 Ga0070660_101665978
277 Ga0070687_100192345
278 Ga0070661_100267452
279 Ga0070661_101735312
280 Ga0070659_100927155
281 Ga0070659_101089402
282 Ga0070709_10407650
283 Ga0070714_102224855
284 Ga0070708_100069217
285 Ga0070663_101440104
286 Ga0070663_101459839
287 Ga0070681_10703768
288 Ga0070685_11053429
289 Ga0070706_100140585
290 Ga0070698_100624690
291 Ga0070698_101829926
292 Ga0070679_100009833
293 Ga0070679_100119678
294 Ga0070679_100301215
295 Ga0070679_100849571
296 Ga0070684_100736358
297 Ga0070684_100809547
298 Ga0070695_101315885
299 Ga0070665_100000310
300 Ga0070665_100522339
301 Ga0070664_101253507
302 Ga0070664_101367298
303 Ga0068857_100379930
304 Ga0068856_100801009
305 Ga0068859_100013916
306 Ga0068860_101215182
307 Ga0070717_10073695
308 Ga0068865_100760021
309 Ga0068865_101173330
310 Ga0097620_100013916
311 Ga0105244_10301964
312 Ga0105245_10571062
313 Ga0105247_10012404
314 Ga0105243_10086782
315 Ga0105242_10042688
316 Ga0105242_11464057
317 Ga0105248_11020109
318 Ga0105246_10048278
319 Ga0105246_10098919
320 Ga0157369_10524199
321 Ga0157369_10650907
322 Ga0157369_10698072
323 Ga0157374_11290357
324 Ga0157372_13039374
325 Ga0157375_10533729
326 Ga0157375_13069264
327 Ga0163163_10096487
328 Ga0163163_11157511
329 Ga0157379_11489094
330 Ga0163161_10699855
331 Ga0197907_11137903
332 Ga0197907_11202911
333 Ga0206356_10036690
334 Ga0206356_10313673
335 Ga0206354_10685403
336 Ga0206354_10705592
337 Ga0206353_10963521
338 Ga0206353_11314918
339 Ga0206353_11321212
340 Ga0206353_11347839
341 Ga0206353_11526191
342 Ga0206353_11935975
343 Ga0224712_10421402
344 Ga0207710_10006007
345 Ga0207688_10596241
346 Ga0207647_10015699
347 Ga0207647_10085925
348 Ga0207705_10460367
349 Ga0207684_10108394
350 Ga0207707_10179510
351 Ga0207707_10657861
352 Ga0207660_10446387
353 Ga0207657_10179899
354 Ga0207649_10721059
355 Ga0207652_10320590
356 Ga0207652_11027349
357 Ga0207646_10062112
358 Ga0207646_11270590
359 Ga0207687_10491068
360 Ga0207706_11363159
361 Ga0207686_10224014
362 Ga0207686_10746514
363 Ga0207686_11072385
364 Ga0207704_11339297
365 Ga0207711_10792098
366 Ga0207711_10945340
367 Ga0207661_10006734
368 Ga0207661_11106609
369 Ga0207661_11128667
370 Ga0207661_11426159
371 Ga0207667_11283671
372 Ga0207702_11831281
373 Ga0207674_10088769
374 Ga0268266_10004222
375 Ga0307405_11588780
376 Ga0373943_0798382
377 Ga0395899_0090514
378 Ga0395900_0306254
379 Ga0395898_0015366
380 Ga0395898_0025462
381 Ga0395901_0010996
382 Ga0395901_0089487
383 Ga0436365_1611719
384 Ga0451793_1661995
385 Ga0466969_0097391
386 Ga0466972_0039653
387 Ga0466965_0253710
388 Ga0466966_0537790
389 Ga0466961_0039189
390 Ga0466961_0115989
391 Ga0466961_0129086
392 Ga0466961_0133501
393 Ga0466961_0256891
394 Ga0466963_0014678
395 Ga0466963_0020992
396 Ga0466963_0025425
397 Ga0466963_0044875
398 Ga0466963_0141618
399 Ga0466963_0314497
400 Ga0466963_0887076
401 Ga0466964_0167337
402 Ga0466971_0027059
403 Ga0466971_0402026
404 Ga0466957_0023694
405 Ga0466957_0165461
406 Ga0466957_0496956
407 Ga0466960_0312928
408 Ga0466960_0725434
409 Ga0466959_0107339
410 Ga0466959_0113539
411 Ga0466959_0167745
412 Ga0466958_0031890
413 Ga0466958_0125937
414 Ga0466958_0404933
415 Ga0466958_0576530
416 Ga0466958_0717883
417 Ga0466967_0060598
418 Ga0466967_0083948
419 Ga0466967_0271960
420 Ga0466967_0274480
421 Ga0466967_0287030
422 Ga0466967_0524322
423 Ga0466967_0940812
424 Ga0466967_2153595
425 Ga0495629_0408735
426 Ga0495653_0305936
427 Ga0495664_0424083
428 Ga0495608_0125127
429 Ga0495608_0558212
430 Ga0495630_0490643
431 Ga0495667_0530516
432 Ga0495635_0118209
433 Ga0495657_0437516
434 Ga0495658_0387021
435 Ga0495604_0218313
436 Ga0495674_0789863
437 Ga0495676_0721841
438 Ga0495680_0165417
439 Ga0495680_0179700
440 Ga0495593_0520872
441 Ga0496100_0530856
442 Ga0496101_0192746
443 Ga0496101_1096477
444 Ga0496102_0000110
445 Ga0496102_0000346
446 Ga0496102_0055620
447 Ga0496102_1231875
448 Ga0496103_0000135
449 Ga0496103_0077317
450 Ga0496103_0085609
451 Ga0496104_1221822
452 Ga0496107_0471608
453 Ga0496108_0738110
454 Ga0496109_0050499
455 Ga0496110_0250269
456 Ga0496114_0002498
457 Ga0496114_0166436
458 Ga0496114_0565579
459 Ga0496114_0784960
460 Ga0496115_1191157
461 Ga0496118_0069442
462 Ga0496119_0000153
463 Ga0496120_0002595
464 Ga0496121_0374811
465 Ga0501031_0000154
466 Ga0501032_0000079
467 Ga0501032_0021408
468 Ga0501032_0024832
469 Ga0501033_0000278
470 Ga0501033_0096310
471 Ga0501033_0231949
472 Ga0501033_0309891
473 Ga0501034_0001706
474 Ga0501034_0409331
475 Ga0501036_0007779
476 Ga0501036_0038194
477 Ga0501037_0002734
478 Ga0501038_0000901
479 Ga0501038_0168855
480 Ga0501039_0071665
481 Ga0501039_0221236
482 Ga0501042_0032878
483 Ga0501043_0000263
484 Ga0501043_0015058
485 Ga0501043_0075618
486 Ga0501046_0000740
487 Ga0501047_0001680
488 Ga0501047_0040148
489 Ga0501047_0491504
490 Ga0501048_0000103
491 Ga0501067_0011268
492 Ga0501068_0137135
493 Ga0501069_0001278
494 Ga0501069_0113217
495 Ga0501070_0000852
496 Ga0501070_0000869
497 Ga0501070_0093379
498 Ga0501071_0140469
499 Ga0501073_0004261
500 Ga0501073_0289319
501 Ga0501074_0000185
502 Ga0501074_0072969
503 Ga0501079_0328428
504 Ga0501080_0000349
505 Ga0501083_0041242
506 Ga0501083_0096996
507 Ga0501035_0001810
508 Ga0501035_0004943
509 Ga0501035_0343775
510 Ga0501044_0000922
511 Ga0501044_0008793
512 Ga0495601_0245693
513 Ga0495595_0203427
514 Ga0495619_0068479
515 Ga0501084_0003393
516 Ga0501082_0361676
517 Ga0466962_0034331
518 Ga0466962_0591547
519 2643850009
520 2644136012
521 2799184093
522 2837269832

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19812

DUF6295

Family of unknown function (DUF6295)

1

86

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ogj-assembly6.cif.gz_E crystal structure of a dihydroorotase 0.696 4 32
2ogj-assembly7.cif.gz_F crystal structure of a dihydroorotase 0.6845 4 32
2ogj-assembly3.cif.gz_B crystal structure of a dihydroorotase 0.5693 4 64
3k44-assembly4.cif.gz_D crystal structure of drosophila melanogaster pur-alpha 0.5482 1 82
4e1r-assembly1.cif.gz_A crystal structure of the dimerization domain of lsr2 from mycobacterium tuberculosis in the p 31 2 1 space group 0.542 45 84
ID Description Score Start End Superfamily
af_Q9V4D9_1_181_3.30.2450.30 Alpha Beta;2-Layer Sandwich;Secreted effector protein pipB2 fold; 0.7362 3 80 3.30.2450.30
2ogjF01 Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 0.6845 4 32 2.30.40.10
af_Q55GX9_873_1080_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.6239 4 32 3.30.420.10
2icsA01 Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 0.5974 6 31 2.30.40.10
af_G5EDJ4_2_146_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.5651 7 62 2.30.29.30
ID Description Score Start End GO Terms
AF-A0A6B2RQZ6-F1-model_v4 DUF3467 domain-containing protein 0.8966 7 88
AF-A0A6L7WEY9-F1-model_v4 Uncharacterized protein 0.8898 5 81
AF-A0A2W6CU51-F1-model_v4 Uncharacterized protein 0.8879 1 87
AF-A0A6B2RQZ6-F1-model_v4 DUF3467 domain-containing protein 0.8862 7 88
AF-A0A6I1R3A0-F1-model_v4 Uncharacterized protein 0.8782 1 81

Map