F370156

General Info

Members Datasets Scaffolds Average Seq Length
261 187 522 136

Family's Representative Sequence

Representative Sequence 3300005439|Ga0070711_101557728|Ga0070711_1015577281
Length 156
Sequence MGQLLRLQERAQPEVTLFVDTSVWSLAFRRDVPAATAEVHALRHALESGQEIAMTGLVLQELLQGFSGPRARDRVIQRFSALPFLSPDRQDHIAAADLRNRCRRAGVQVGTIDAILAQLCLRYDLTLLTTDRDFQRIAAHSPLRVWSERGASGPLQ

Samples

Sample ID Description Type Environment
1 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
37 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
57 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
58 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
59 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
60 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
61 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
102 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
103 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
105 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
106 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
107 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
108 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
109 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
110 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
111 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
112 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
113 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
114 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
115 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
116 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
117 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
118 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
119 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
120 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
121 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
122 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
123 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
126 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
127 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
128 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
129 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
130 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
131 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
132 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
133 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
134 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
135 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
136 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
137 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
138 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
139 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
140 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
141 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
142 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
143 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
144 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
145 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
146 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
147 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
148 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
149 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
150 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
162 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
163 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
164 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
165 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
166 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
167 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
168 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
169 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
170 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
171 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
172 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
173 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
174 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
175 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
177 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
178 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
179 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
180 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
181 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
182 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
183 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
184 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
185 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
186 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
187 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.47
Metatranscriptomes 1.15
Isolates 0.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.15
Nodule 0
Rhizoplane 4.98
Rhizosphere 91.19
Stem 0
Stem Tuber 0
Unclassified 21.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070711_101557728 3300005439 Unclassified 577
2 Ga0070670_100047463 3300005331 Bacteria 3695
3 Ga0070666_10033018 3300005335 Bacteria 3422
4 Ga0070680_100323995 3300005336 Unclassified 1308
5 Ga0068868_100510813 3300005338 Bacteria 1054
6 Ga0070687_100074435 3300005343 Bacteria 1834
7 Ga0070669_100485566 3300005353 Unclassified 1023
8 Ga0070675_100177085 3300005354 Bacteria 1842
9 Ga0070675_101087115 3300005354 Bacteria 735
10 Ga0070671_100055254 3300005355 Bacteria 3303
11 Ga0070673_101111746 3300005364 Unclassified 738
12 Ga0070673_101128743 3300005364 Unclassified 733
13 Ga0070659_100486826 3300005366 Unclassified 1050
14 Ga0070667_100042968 3300005367 Bacteria 3792
15 Ga0070709_10258725 3300005434 Bacteria 1257
16 Ga0070714_101302093 3300005435 Bacteria 709
17 Ga0070713_101048677 3300005436 Unclassified 787
18 Ga0070713_101380111 3300005436 Bacteria 683
19 Ga0070711_100268964 3300005439 Bacteria 1344
20 Ga0070700_101322337 3300005441 Unclassified 606
21 Ga0070681_10436329 3300005458 Bacteria 1222
22 Ga0070681_11316318 3300005458 Unclassified 645
23 Ga0070706_100149391 3300005467 Bacteria 2181
24 Ga0070706_100505775 3300005467 Unclassified 1124
25 Ga0070706_100952108 3300005467 Unclassified 792
26 Ga0070707_101728531 3300005468 Unclassified 593
27 Ga0070698_100307548 3300005471 Bacteria 1516
28 Ga0070684_100289299 3300005535 Bacteria 1502
29 Ga0070697_101271768 3300005536 Bacteria 656
30 Ga0070665_100015753 3300005548 Bacteria 7596
31 Ga0068855_100001860 3300005563 Bacteria 26250
32 Ga0068855_100680298 3300005563 Bacteria 1103
33 Ga0070664_101921693 3300005564 Unclassified 561
34 Ga0068856_100202963 3300005614 Bacteria 1997
35 Ga0068856_101844108 3300005614 Bacteria 616
36 Ga0070702_100254470 3300005615 Bacteria 1192
37 Ga0070702_100974014 3300005615 Bacteria 669
38 Ga0068859_100399378 3300005617 Bacteria 1470
39 Ga0068864_100035477 3300005618 Bacteria 4246
40 Ga0068863_100341625 3300005841 Bacteria 1456
41 Ga0068858_100038908 3300005842 Bacteria 4411
42 Ga0068858_100046748 3300005842 Bacteria 4012
43 Ga0068858_100692655 3300005842 Bacteria 991
44 Ga0068862_100594017 3300005844 Bacteria 1062
45 Ga0070712_100271097 3300006175 Bacteria 1363
46 Ga0068871_100116514 3300006358 Bacteria 2252
47 Ga0068871_100408769 3300006358 Bacteria 1210
48 Ga0097620_100268293 3300006931 Unclassified 1799
49 Ga0097620_100399378 3300006931 Bacteria 1470
50 Ga0099794_10064624 3300007265 Bacteria 1783
51 Ga0105250_10127815 3300009092 Bacteria 1048
52 Ga0105240_10002419 3300009093 Bacteria 29998
53 Ga0105240_11001050 3300009093 Bacteria 894
54 Ga0105240_11485811 3300009093 Unclassified 711
55 Ga0111539_10614912 3300009094 Bacteria 1265
56 Ga0105242_12295026 3300009176 Bacteria 586
57 Ga0105248_10049611 3300009177 Bacteria 4708
58 Ga0105248_11018976 3300009177 Bacteria 935
59 Ga0105237_10017873 3300009545 Bacteria 7350
60 Ga0105237_10435117 3300009545 Bacteria 1317
61 Ga0105238_10336851 3300009551 Bacteria 1496
62 Ga0105238_10410662 3300009551 Bacteria 1348
63 Ga0105238_10880386 3300009551 Bacteria 913
64 Ga0105249_10417438 3300009553 Bacteria 1375
65 Ga0105249_11387078 3300009553 Bacteria 775
66 Ga0105239_10092244 3300010375 Plasmid 3343
67 Ga0105239_13201180 3300010375 Unclassified 533
68 Ga0105246_10174015 3300011119 Bacteria 1651
69 Ga0157370_10111782 3300013104 Bacteria 2553
70 Ga0157374_10031220 3300013296 Bacteria 4841
71 Ga0157374_10112518 3300013296 Bacteria 2619
72 Ga0157374_10284062 3300013296 Bacteria 1634
73 Ga0157374_10395803 3300013296 Bacteria 1377
74 Ga0163162_10060427 3300013306 Bacteria 3825
75 Ga0157372_11321941 3300013307 Bacteria 832
76 Ga0157372_11572316 3300013307 Bacteria 757
77 Ga0157375_10059392 3300013308 Bacteria 3788
78 Ga0163163_10060023 3300014325 Bacteria 3764
79 Ga0157377_10032095 3300014745 Bacteria 2858
80 Ga0157379_10329469 3300014968 Bacteria 1395
81 Ga0157376_10349311 3300014969 Bacteria 1415
82 Ga0157376_10731004 3300014969 Bacteria 997
83 Ga0157376_10890614 3300014969 Bacteria 907
84 Ga0213873_10141291 3300021358 Bacteria 719
85 Ga0213872_10140289 3300021361 Bacteria 1061
86 Ga0213872_10279441 3300021361 Unclassified 697
87 Ga0213874_10004834 3300021377 Bacteria 3108
88 Ga0213875_10238762 3300021388 Unclassified 856
89 Ga0224572_1068917 3300024225 Bacteria 654
90 Ga0207692_11023814 3300025898 Unclassified 546
91 Ga0207680_10162840 3300025903 Bacteria 1497
92 Ga0207647_10477912 3300025904 Bacteria 696
93 Ga0207645_11034025 3300025907 Unclassified 556
94 Ga0207705_10029233 3300025909 Bacteria 3929
95 Ga0207684_10664808 3300025910 Unclassified 887
96 Ga0207684_10719475 3300025910 Bacteria 847
97 Ga0207707_10082838 3300025912 Bacteria 2801
98 Ga0207695_10012170 3300025913 Bacteria 10342
99 Ga0207671_10127435 3300025914 Bacteria 1951
100 Ga0207671_10319091 3300025914 Bacteria 1229
101 Ga0207693_10071396 3300025915 Bacteria 2717
102 Ga0207663_10168099 3300025916 Unclassified 1555
103 Ga0207663_11393396 3300025916 Unclassified 565
104 Ga0207660_10583515 3300025917 Bacteria 910
105 Ga0207662_10073234 3300025918 Bacteria 2077
106 Ga0207662_10142964 3300025918 Unclassified 1517
107 Ga0207649_10049573 3300025920 Bacteria 2594
108 Ga0207652_10077063 3300025921 Bacteria 2908
109 Ga0207646_10046902 3300025922 Bacteria 3876
110 Ga0207681_11052878 3300025923 Unclassified 683
111 Ga0207694_10917316 3300025924 Bacteria 741
112 Ga0207650_10005470 3300025925 Bacteria 8667
113 Ga0207659_10033565 3300025926 Bacteria 3533
114 Ga0207659_10078677 3300025926 Bacteria 2430
115 Ga0207700_10422447 3300025928 Bacteria 1171
116 Ga0207700_11140211 3300025928 Bacteria 697
117 Ga0207700_11153618 3300025928 Unclassified 692
118 Ga0207664_10440330 3300025929 Bacteria 1162
119 Ga0207644_10026975 3300025931 Bacteria 3965
120 Ga0207686_11379171 3300025934 Bacteria 580
121 Ga0207670_10474430 3300025936 Bacteria 1012
122 Ga0207711_10280614 3300025941 Bacteria 1534
123 Ga0207689_10365273 3300025942 Bacteria 1200
124 Ga0207661_10606128 3300025944 Unclassified 1005
125 Ga0207667_10184877 3300025949 Bacteria 2139
126 Ga0207667_10601359 3300025949 Bacteria 1109
127 Ga0207651_10164834 3300025960 Bacteria 1741
128 Ga0207651_10310399 3300025960 Bacteria 1315
129 Ga0207712_10089123 3300025961 Bacteria 2267
130 Ga0207658_10026176 3300025986 Bacteria 4087
131 Ga0207677_10130107 3300026023 Bacteria 1909
132 Ga0207677_10166507 3300026023 Bacteria 1718
133 Ga0207703_10034961 3300026035 Bacteria 3991
134 Ga0207703_10493809 3300026035 Bacteria 1148
135 Ga0207708_11712074 3300026075 Unclassified 552
136 Ga0207702_10142955 3300026078 Bacteria 2167
137 Ga0207702_10433932 3300026078 Bacteria 1272
138 Ga0207702_11041697 3300026078 Bacteria 812
139 Ga0207641_10336350 3300026088 Bacteria 1435
140 Ga0207676_10029040 3300026095 Bacteria 4136
141 Ga0268266_10011642 3300028379 Bacteria 7637
142 Ga0268265_10373849 3300028380 Unclassified 1309
143 Ga0265338_10010516 3300028800 Bacteria 10828
144 Ga0265765_1035603 3300030879 Unclassified 648
145 Ga0265760_10000592 3300031090 Bacteria 10319
146 Ga0265760_10007851 3300031090 Bacteria 3048
147 Ga0265340_10018017 3300031247 Unclassified 3650
148 Ga0265340_10332324 3300031247 Bacteria 672
149 Ga0265327_10008418 3300031251 Bacteria 7685
150 Ga0265316_10930403 3300031344 Unclassified 606
151 Ga0307508_10257021 3300031616 Bacteria 1342
152 Ga0307514_10559760 3300031649 Unclassified 525
153 Ga0265342_10498038 3300031712 Bacteria 622
154 Ga0307413_11331240 3300031824 Unclassified 629
155 Ga0307411_10747758 3300032005 Bacteria 856
156 Ga0307411_11452294 3300032005 Unclassified 629
157 Ga0373926_0002202 3300035083 Bacteria 6146
158 Ga0373926_0044813 3300035083 Unclassified 1585
159 Ga0373934_0179227 3300035086 Bacteria 871
160 Ga0373923_0048556 3300035111 Unclassified 1772
161 Ga0373957_0094655 3300035120 Unclassified 1190
162 Ga0373943_0008051 3300035170 Bacteria 4727
163 Ga0373946_0005436 3300035171 Bacteria 4593
164 Ga0373946_0178778 3300035171 Bacteria 1006
165 Ga0373924_0000274 3300035410 Bacteria 15809
166 Ga0373935_0286163 3300035692 Unclassified 1161
167 Ga0373927_0010272 3300035695 Bacteria 6252
168 Ga0373933_0143968 3300035724 Bacteria 1506
169 Ga0373947_0021546 3300035725 Bacteria 3730
170 Ga0373937_0211416 3300036401 Unclassified 1825
171 Ga0373937_0396986 3300036401 Bacteria 1308
172 Ga0373925_0055733 3300037068 Bacteria 2960
173 Ga0373925_0645168 3300037068 Unclassified 872
174 Ga0436364_1238640 3300037853 Bacteria 2306
175 Ga0436360_0147667 3300039438 Bacteria 3518
176 Ga0436360_1158351 3300039438 Bacteria 2054
177 Ga0436361_0486366 3300039447 Bacteria 7033
178 Ga0436361_1154908 3300039447 Bacteria 2151
179 Ga0436363_1120757 3300039450 Unclassified 665
180 Ga0436363_1531025 3300039450 Bacteria 3861
181 Ga0436362_0072881 3300039453 Bacteria 4322
182 Ga0436362_0411937 3300039453 Unclassified 858
183 Ga0436362_1077158 3300039453 Bacteria 804
184 Ga0436362_1199237 3300039453 Bacteria 1293
185 Ga0439451_068831 3300042009 Bacteria 709
186 Ga0439435_0044670 3300042436 Bacteria 1250
187 Ga0466964_0329613 3300044706 Unclassified 778
188 Ga0453684_0567964 3300044712 Bacteria 1247
189 Ga0495603_0778946 3300046455 Bacteria 546
190 Ga0495580_0051581 3300046472 Unclassified 2908
191 Ga0495582_0060534 3300046473 Bacteria 2089
192 Ga0495639_0185028 3300046475 Bacteria 1015
193 Ga0495665_0033254 3300046531 Unclassified 2758
194 Ga0495598_0047010 3300046537 Bacteria 1284
195 Ga0495621_0021099 3300046539 Bacteria 2144
196 Ga0495657_0048572 3300046675 Unclassified 2862
197 Ga0496100_1220069 3300048903 Unclassified 593
198 Ga0496102_1262210 3300048905 Unclassified 658
199 Ga0496104_0004317 3300048907 Bacteria 12368
200 Ga0496104_0211604 3300048907 Bacteria 1850
201 Ga0496105_0141820 3300048908 Bacteria 1978
202 Ga0496110_0156262 3300048913 Bacteria 2066
203 Ga0496111_1175981 3300048914 Unclassified 544
204 Ga0496112_0158602 3300048915 Bacteria 2229
205 Ga0496112_0238528 3300048915 Bacteria 1771
206 Ga0496112_0365909 3300048915 Bacteria 1383
207 Ga0496112_0380086 3300048915 Bacteria 1353
208 Ga0496113_0000290 3300048916 Bacteria 23756
209 Ga0496113_0037642 3300048916 Bacteria 3552
210 Ga0501031_0108981 3300049568 Bacteria 1808
211 Ga0501031_0123160 3300049568 Bacteria 1694
212 Ga0501033_0011865 3300049570 Bacteria 6659
213 Ga0501034_0000421 3300049571 Bacteria 71070
214 Ga0501038_0092855 3300049574 Bacteria 2526
215 Ga0501039_0116177 3300049575 Bacteria 2094
216 Ga0501040_0253047 3300049576 Bacteria 1256
217 Ga0501041_0025796 3300049577 Bacteria 3533
218 Ga0501042_0143185 3300049578 Bacteria 1723
219 Ga0501046_0228015 3300049580 Bacteria 1377
220 Ga0501047_0013879 3300049581 Bacteria 7651
221 Ga0501047_0056646 3300049581 Bacteria 3791
222 Ga0501047_0527812 3300049581 Unclassified 1006
223 Ga0501048_0560894 3300049582 Bacteria 819
224 Ga0501068_0037899 3300049584 Bacteria 2886
225 Ga0501068_0753143 3300049584 Bacteria 638
226 Ga0501069_0068264 3300049585 Bacteria 1990
227 Ga0501070_0008630 3300049586 Bacteria 8614
228 Ga0501070_0631412 3300049586 Bacteria 852
229 Ga0501071_0584161 3300049587 Bacteria 858
230 Ga0501071_0584164 3300049587 Bacteria 858
231 Ga0501071_1266634 3300049587 Unclassified 570
232 Ga0501072_0081650 3300049588 Bacteria 2562
233 Ga0501073_0102680 3300049589 Bacteria 1985
234 Ga0501074_0051249 3300049590 Bacteria 2978
235 Ga0501075_0029053 3300049591 Bacteria 4086
236 Ga0501076_0071716 3300049592 Bacteria 2771
237 Ga0501076_1279404 3300049592 Bacteria 603
238 Ga0501077_0386233 3300049593 Bacteria 894
239 Ga0501079_0044868 3300049741 Bacteria 3412
240 Ga0501079_0087102 3300049741 Bacteria 2417
241 Ga0501080_0050162 3300049742 Bacteria 3885
242 Ga0501080_0497690 3300049742 Bacteria 1089
243 Ga0501081_0130752 3300049743 Bacteria 1793
244 Ga0501081_0585795 3300049743 Bacteria 834
245 Ga0501083_0035016 3300049744 Bacteria 3431
246 Ga0501035_0098453 3300049822 Bacteria 2567
247 Ga0501035_1021711 3300049822 Bacteria 649
248 Ga0501045_0121826 3300049824 Bacteria 1936
249 nmdc:mga08y16_401743_c1 3300050511 Bacteria 1402
250 Ga0495601_0142228 3300053077 Unclassified 1565
251 Ga0495612_0113369 3300053078 Unclassified 1162
252 Ga0495619_0019484 3300053085 Bacteria 4314
253 Ga0500595_103663 3300053119 Unclassified 813
254 Ga0500637_0029766 3300053178 Bacteria 3032
255 Ga0500625_000850 3300053729 Bacteria 9383
256 Ga0501084_0148266 3300054114 Bacteria 1976
257 Ga0501084_0707416 3300054114 Bacteria 850
258 Ga0501082_0072258 3300060353 Bacteria 2971
259 Ga0501082_0907543 3300060353 Bacteria 770
260 Ga0530510_0125354 3300061734 Bacteria 1887
261 2920112417 2920107658 Bacteria 10042636
262 Ga0070711_101557728
263 Ga0070670_100047463
264 Ga0070666_10033018
265 Ga0070680_100323995
266 Ga0068868_100510813
267 Ga0070687_100074435
268 Ga0070669_100485566
269 Ga0070675_100177085
270 Ga0070675_101087115
271 Ga0070671_100055254
272 Ga0070673_101111746
273 Ga0070673_101128743
274 Ga0070659_100486826
275 Ga0070667_100042968
276 Ga0070709_10258725
277 Ga0070714_101302093
278 Ga0070713_101048677
279 Ga0070713_101380111
280 Ga0070711_100268964
281 Ga0070700_101322337
282 Ga0070681_10436329
283 Ga0070681_11316318
284 Ga0070706_100149391
285 Ga0070706_100505775
286 Ga0070706_100952108
287 Ga0070707_101728531
288 Ga0070698_100307548
289 Ga0070684_100289299
290 Ga0070697_101271768
291 Ga0070665_100015753
292 Ga0068855_100001860
293 Ga0068855_100680298
294 Ga0070664_101921693
295 Ga0068856_100202963
296 Ga0068856_101844108
297 Ga0070702_100254470
298 Ga0070702_100974014
299 Ga0068859_100399378
300 Ga0068864_100035477
301 Ga0068863_100341625
302 Ga0068858_100038908
303 Ga0068858_100046748
304 Ga0068858_100692655
305 Ga0068862_100594017
306 Ga0070712_100271097
307 Ga0068871_100116514
308 Ga0068871_100408769
309 Ga0097620_100268293
310 Ga0097620_100399378
311 Ga0099794_10064624
312 Ga0105250_10127815
313 Ga0105240_10002419
314 Ga0105240_11001050
315 Ga0105240_11485811
316 Ga0111539_10614912
317 Ga0105242_12295026
318 Ga0105248_10049611
319 Ga0105248_11018976
320 Ga0105237_10017873
321 Ga0105237_10435117
322 Ga0105238_10336851
323 Ga0105238_10410662
324 Ga0105238_10880386
325 Ga0105249_10417438
326 Ga0105249_11387078
327 Ga0105239_10092244
328 Ga0105239_13201180
329 Ga0105246_10174015
330 Ga0157370_10111782
331 Ga0157374_10031220
332 Ga0157374_10112518
333 Ga0157374_10284062
334 Ga0157374_10395803
335 Ga0163162_10060427
336 Ga0157372_11321941
337 Ga0157372_11572316
338 Ga0157375_10059392
339 Ga0163163_10060023
340 Ga0157377_10032095
341 Ga0157379_10329469
342 Ga0157376_10349311
343 Ga0157376_10731004
344 Ga0157376_10890614
345 Ga0213873_10141291
346 Ga0213872_10140289
347 Ga0213872_10279441
348 Ga0213874_10004834
349 Ga0213875_10238762
350 Ga0224572_1068917
351 Ga0207692_11023814
352 Ga0207680_10162840
353 Ga0207647_10477912
354 Ga0207645_11034025
355 Ga0207705_10029233
356 Ga0207684_10664808
357 Ga0207684_10719475
358 Ga0207707_10082838
359 Ga0207695_10012170
360 Ga0207671_10127435
361 Ga0207671_10319091
362 Ga0207693_10071396
363 Ga0207663_10168099
364 Ga0207663_11393396
365 Ga0207660_10583515
366 Ga0207662_10073234
367 Ga0207662_10142964
368 Ga0207649_10049573
369 Ga0207652_10077063
370 Ga0207646_10046902
371 Ga0207681_11052878
372 Ga0207694_10917316
373 Ga0207650_10005470
374 Ga0207659_10033565
375 Ga0207659_10078677
376 Ga0207700_10422447
377 Ga0207700_11140211
378 Ga0207700_11153618
379 Ga0207664_10440330
380 Ga0207644_10026975
381 Ga0207686_11379171
382 Ga0207670_10474430
383 Ga0207711_10280614
384 Ga0207689_10365273
385 Ga0207661_10606128
386 Ga0207667_10184877
387 Ga0207667_10601359
388 Ga0207651_10164834
389 Ga0207651_10310399
390 Ga0207712_10089123
391 Ga0207658_10026176
392 Ga0207677_10130107
393 Ga0207677_10166507
394 Ga0207703_10034961
395 Ga0207703_10493809
396 Ga0207708_11712074
397 Ga0207702_10142955
398 Ga0207702_10433932
399 Ga0207702_11041697
400 Ga0207641_10336350
401 Ga0207676_10029040
402 Ga0268266_10011642
403 Ga0268265_10373849
404 Ga0265338_10010516
405 Ga0265765_1035603
406 Ga0265760_10000592
407 Ga0265760_10007851
408 Ga0265340_10018017
409 Ga0265340_10332324
410 Ga0265327_10008418
411 Ga0265316_10930403
412 Ga0307508_10257021
413 Ga0307514_10559760
414 Ga0265342_10498038
415 Ga0307413_11331240
416 Ga0307411_10747758
417 Ga0307411_11452294
418 Ga0373926_0002202
419 Ga0373926_0044813
420 Ga0373934_0179227
421 Ga0373923_0048556
422 Ga0373957_0094655
423 Ga0373943_0008051
424 Ga0373946_0005436
425 Ga0373946_0178778
426 Ga0373924_0000274
427 Ga0373935_0286163
428 Ga0373927_0010272
429 Ga0373933_0143968
430 Ga0373947_0021546
431 Ga0373937_0211416
432 Ga0373937_0396986
433 Ga0373925_0055733
434 Ga0373925_0645168
435 Ga0436364_1238640
436 Ga0436360_0147667
437 Ga0436360_1158351
438 Ga0436361_0486366
439 Ga0436361_1154908
440 Ga0436363_1120757
441 Ga0436363_1531025
442 Ga0436362_0072881
443 Ga0436362_0411937
444 Ga0436362_1077158
445 Ga0436362_1199237
446 Ga0439451_068831
447 Ga0439435_0044670
448 Ga0466964_0329613
449 Ga0453684_0567964
450 Ga0495603_0778946
451 Ga0495580_0051581
452 Ga0495582_0060534
453 Ga0495639_0185028
454 Ga0495665_0033254
455 Ga0495598_0047010
456 Ga0495621_0021099
457 Ga0495657_0048572
458 Ga0496100_1220069
459 Ga0496102_1262210
460 Ga0496104_0004317
461 Ga0496104_0211604
462 Ga0496105_0141820
463 Ga0496110_0156262
464 Ga0496111_1175981
465 Ga0496112_0158602
466 Ga0496112_0238528
467 Ga0496112_0365909
468 Ga0496112_0380086
469 Ga0496113_0000290
470 Ga0496113_0037642
471 Ga0501031_0108981
472 Ga0501031_0123160
473 Ga0501033_0011865
474 Ga0501034_0000421
475 Ga0501038_0092855
476 Ga0501039_0116177
477 Ga0501040_0253047
478 Ga0501041_0025796
479 Ga0501042_0143185
480 Ga0501046_0228015
481 Ga0501047_0013879
482 Ga0501047_0056646
483 Ga0501047_0527812
484 Ga0501048_0560894
485 Ga0501068_0037899
486 Ga0501068_0753143
487 Ga0501069_0068264
488 Ga0501070_0008630
489 Ga0501070_0631412
490 Ga0501071_0584161
491 Ga0501071_0584164
492 Ga0501071_1266634
493 Ga0501072_0081650
494 Ga0501073_0102680
495 Ga0501074_0051249
496 Ga0501075_0029053
497 Ga0501076_0071716
498 Ga0501076_1279404
499 Ga0501077_0386233
500 Ga0501079_0044868
501 Ga0501079_0087102
502 Ga0501080_0050162
503 Ga0501080_0497690
504 Ga0501081_0130752
505 Ga0501081_0585795
506 Ga0501083_0035016
507 Ga0501035_0098453
508 Ga0501035_1021711
509 Ga0501045_0121826
510 nmdc:mga08y16_401743_c1
511 Ga0495601_0142228
512 Ga0495612_0113369
513 Ga0495619_0019484
514 Ga0500595_103663
515 Ga0500637_0029766
516 Ga0500625_000850
517 Ga0501084_0148266
518 Ga0501084_0707416
519 Ga0501082_0072258
520 Ga0501082_0907543
521 Ga0530510_0125354
522 2920112417

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01850

PIN

PIN domain

17

140

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4chg-assembly3.cif.gz_E crystal structure of vapbc15 complex from mycobacterium tuberculosis 0.8981 3 135
6a7v-assembly1.cif.gz_E crystal structure of mycobacterium tuberculosis vapbc11 toxin-antitoxin complex 0.8865 1 135
4chg-assembly3.cif.gz_E crystal structure of vapbc15 complex from mycobacterium tuberculosis 0.8855 3 135
5sv2-assembly1.cif.gz_A-2 toxin vapc21 from mycobacterium tuberculosis 0.8225 2 135
6sd6-assembly1.cif.gz_C structure of vapbc from shigella sonnei 0.8105 1 135
ID Description Score Start End Superfamily
af_P9WFA5_1_133_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.904 3 133 3.40.50.1010
af_P9WFB5_2_126_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8904 41 132 3.40.50.1010
af_P9WFA5_1_133_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8849 3 133 3.40.50.1010
4chgB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8774 4 135 3.40.50.1010
af_Q4E5R5_256_364_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8733 77 111 1.10.287.70
ID Description Score Start End GO Terms
AF-A0A2V8JRN2-F1-model_v4 VapC toxin family PIN domain ribonuclease 0.9959 1 121 GO:0004540
AF-A0A536PUZ8-F1-model_v4 PIN domain-containing protein 0.993 68 135 GO:0004518
AF-A0A352VPK6-F1-model_v4 VapC toxin family PIN domain ribonuclease 0.9897 1 107
AF-A0A2W4K4Q9-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9841 1 133 GO:0000287
GO:0004540
GO:0090729
AF-A0A3B8UPQ0-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9824 1 135 GO:0000287
GO:0004540
GO:0090729

Map