F370060
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 261 | 168 | 256 | 42 |
Family's Representative Sequence
| Representative Sequence | 3300005295|Ga0065707_10427014|Ga0065707_104270141 |
| Length | 44 |
| Sequence | MAKGQKKSNREVRKPKAEKPKKLNASNPSLKPGGVAGLENIRNT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 3 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 4 | 2643221588 | Altererythrobacter sp. Root672 | Isolate | Unclassified |
| 5 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 6 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 7 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 8 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 9 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 10 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 13 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 43 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 45 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 46 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 47 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 48 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 49 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 50 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 51 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 52 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 53 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 54 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 113 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 114 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 115 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 116 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 117 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 118 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 119 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 120 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 121 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 122 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 123 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 124 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 125 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 126 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 127 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 128 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 129 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 130 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 131 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 132 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 133 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 134 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 135 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 136 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 137 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 138 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 139 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 150 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 151 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 152 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 153 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 154 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 155 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 156 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 157 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 158 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 159 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 160 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 161 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 162 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 164 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 165 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 166 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 167 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 168 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.7 |
| Metatranscriptomes | 0.38 |
| Isolates | 1.92 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.45 |
| Nodule | 0 |
| Rhizoplane | 4.98 |
| Rhizosphere | 81.99 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.58 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_3687313 | 2162886007 | Bacteria | 63168 |
| 2 | JGI24738J21930_10012160 | 3300002075 | Bacteria | 1882 |
| 3 | JGI24751J29686_10000362 | 3300002459 | Bacteria | 15798 |
| 4 | Ga0058862_12383326 | 3300004803 | Unclassified | 528 |
| 5 | Ga0065714_10345185 | 3300005288 | Bacteria | 641 |
| 6 | Ga0065704_10000204 | 3300005289 | Bacteria | 211587 |
| 7 | Ga0065704_10116625 | 3300005289 | Bacteria | 1850 |
| 8 | Ga0065712_10777282 | 3300005290 | Bacteria | 520 |
| 9 | Ga0065707_10427014 | 3300005295 | Bacteria | 824 |
| 10 | Ga0070658_10024254 | 3300005327 | Bacteria | 4866 |
| 11 | Ga0070658_10034117 | 3300005327 | Bacteria | 4094 |
| 12 | Ga0070683_100044720 | 3300005329 | Bacteria | 4085 |
| 13 | Ga0070683_100097029 | 3300005329 | Bacteria | 2773 |
| 14 | Ga0070670_100167837 | 3300005331 | Bacteria | 1903 |
| 15 | Ga0070670_100629349 | 3300005331 | Unclassified | 961 |
| 16 | Ga0070670_100854910 | 3300005331 | Bacteria | 823 |
| 17 | Ga0070670_101040093 | 3300005331 | Unclassified | 745 |
| 18 | Ga0070677_10228883 | 3300005333 | Bacteria | 912 |
| 19 | Ga0068869_100424795 | 3300005334 | Bacteria | 1097 |
| 20 | Ga0070666_10091698 | 3300005335 | Bacteria | 2088 |
| 21 | Ga0070680_100006627 | 3300005336 | Bacteria | 8807 |
| 22 | Ga0070680_100153492 | 3300005336 | Bacteria | 1934 |
| 23 | Ga0070680_100209740 | 3300005336 | Bacteria | 1643 |
| 24 | Ga0070680_100485477 | 3300005336 | Bacteria | 1056 |
| 25 | Ga0070682_100523881 | 3300005337 | Bacteria | 922 |
| 26 | Ga0070682_101129278 | 3300005337 | Bacteria | 658 |
| 27 | Ga0070660_100002787 | 3300005339 | Bacteria | 12002 |
| 28 | Ga0070661_100000551 | 3300005344 | Bacteria | 28749 |
| 29 | Ga0070661_100143389 | 3300005344 | Bacteria | 1801 |
| 30 | Ga0070661_100187755 | 3300005344 | Bacteria | 1575 |
| 31 | Ga0070692_10012846 | 3300005345 | Unclassified | 3890 |
| 32 | Ga0070669_100428025 | 3300005353 | Bacteria | 1087 |
| 33 | Ga0070675_100467451 | 3300005354 | Bacteria | 1133 |
| 34 | Ga0070675_101935986 | 3300005354 | Bacteria | 544 |
| 35 | Ga0070671_100000714 | 3300005355 | Bacteria | 23894 |
| 36 | Ga0070671_100559962 | 3300005355 | Bacteria | 986 |
| 37 | Ga0070674_101059170 | 3300005356 | Bacteria | 714 |
| 38 | Ga0070659_102024775 | 3300005366 | Unclassified | 517 |
| 39 | Ga0070667_100040129 | 3300005367 | Bacteria | 3925 |
| 40 | Ga0070667_100142065 | 3300005367 | Bacteria | 2103 |
| 41 | Ga0070701_10146169 | 3300005438 | Bacteria | 1357 |
| 42 | Ga0070663_100441457 | 3300005455 | Unclassified | 1071 |
| 43 | Ga0070662_100000429 | 3300005457 | Bacteria | 24862 |
| 44 | Ga0070662_100049541 | 3300005457 | Bacteria | 3029 |
| 45 | Ga0070681_10118718 | 3300005458 | Bacteria | 2581 |
| 46 | Ga0070681_11058484 | 3300005458 | Unclassified | 732 |
| 47 | Ga0070707_100230181 | 3300005468 | Bacteria | 1804 |
| 48 | Ga0070679_100078027 | 3300005530 | Bacteria | 3301 |
| 49 | Ga0070679_100086107 | 3300005530 | Bacteria | 3129 |
| 50 | Ga0070679_100276391 | 3300005530 | Bacteria | 1633 |
| 51 | Ga0070679_102024456 | 3300005530 | Unclassified | 525 |
| 52 | Ga0070684_100025729 | 3300005535 | Bacteria | 4949 |
| 53 | Ga0070684_101485479 | 3300005535 | Bacteria | 639 |
| 54 | Ga0068853_100009754 | 3300005539 | Bacteria | 7746 |
| 55 | Ga0068853_100083338 | 3300005539 | Bacteria | 2801 |
| 56 | Ga0070672_100876295 | 3300005543 | Bacteria | 792 |
| 57 | Ga0070696_101042014 | 3300005546 | Bacteria | 685 |
| 58 | Ga0070693_100031348 | 3300005547 | Unclassified | 2913 |
| 59 | Ga0070693_100176616 | 3300005547 | Bacteria | 1372 |
| 60 | Ga0068855_100011355 | 3300005563 | Bacteria | 10754 |
| 61 | Ga0068855_100687353 | 3300005563 | Bacteria | 1096 |
| 62 | Ga0070664_100007589 | 3300005564 | Bacteria | 8757 |
| 63 | Ga0070664_100628783 | 3300005564 | Bacteria | 997 |
| 64 | Ga0068857_100153270 | 3300005577 | Bacteria | 2089 |
| 65 | Ga0068854_100041647 | 3300005578 | Bacteria | 3246 |
| 66 | Ga0068854_100101136 | 3300005578 | Unclassified | 2161 |
| 67 | Ga0068852_100145459 | 3300005616 | Unclassified | 2198 |
| 68 | Ga0068852_100587153 | 3300005616 | Bacteria | 1117 |
| 69 | Ga0068859_100089483 | 3300005617 | Bacteria | 3129 |
| 70 | Ga0068859_102933236 | 3300005617 | Unclassified | 522 |
| 71 | Ga0068864_100999279 | 3300005618 | Bacteria | 830 |
| 72 | Ga0068864_101493066 | 3300005618 | Unclassified | 679 |
| 73 | Ga0068858_100006781 | 3300005842 | Bacteria | 11139 |
| 74 | Ga0068858_100220686 | 3300005842 | Unclassified | 1795 |
| 75 | Ga0068860_100133555 | 3300005843 | Unclassified | 2383 |
| 76 | Ga0075362_10045722 | 3300006177 | Bacteria | 1945 |
| 77 | Ga0075369_10046953 | 3300006186 | Bacteria | 1861 |
| 78 | Ga0075370_10629943 | 3300006353 | Bacteria | 650 |
| 79 | Ga0097620_100089481 | 3300006931 | Bacteria | 3129 |
| 80 | Ga0097620_102931634 | 3300006931 | Unclassified | 522 |
| 81 | Ga0105251_10077333 | 3300009011 | Bacteria | 1543 |
| 82 | Ga0105240_11438249 | 3300009093 | Bacteria | 724 |
| 83 | Ga0111539_11524227 | 3300009094 | Bacteria | 775 |
| 84 | Ga0105243_11733660 | 3300009148 | Bacteria | 654 |
| 85 | Ga0105241_10030319 | 3300009174 | Bacteria | 4041 |
| 86 | Ga0105241_10151746 | 3300009174 | Bacteria | 1896 |
| 87 | Ga0105241_10982350 | 3300009174 | Bacteria | 789 |
| 88 | Ga0105242_10941589 | 3300009176 | Bacteria | 867 |
| 89 | Ga0105248_10808184 | 3300009177 | Archaea | 1058 |
| 90 | Ga0105237_10034455 | 3300009545 | Bacteria | 5127 |
| 91 | Ga0105238_10291313 | 3300009551 | Bacteria | 1615 |
| 92 | Ga0105238_12943167 | 3300009551 | Bacteria | 512 |
| 93 | Ga0105249_10005683 | 3300009553 | Bacteria | 10783 |
| 94 | Ga0105239_10058275 | 3300010375 | Bacteria | 4238 |
| 95 | Ga0157373_10054312 | 3300013100 | Bacteria | 2847 |
| 96 | Ga0157373_10316121 | 3300013100 | Bacteria | 1110 |
| 97 | Ga0157373_11261357 | 3300013100 | Bacteria | 558 |
| 98 | Ga0157371_10006923 | 3300013102 | Bacteria | 9250 |
| 99 | Ga0157371_10013137 | 3300013102 | Bacteria | 6304 |
| 100 | Ga0157370_10086233 | 3300013104 | Unclassified | 2950 |
| 101 | Ga0157369_10034042 | 3300013105 | Bacteria | 5595 |
| 102 | Ga0157369_10542824 | 3300013105 | Bacteria | 1202 |
| 103 | Ga0163162_10005756 | 3300013306 | Bacteria | 11989 |
| 104 | Ga0163162_12002970 | 3300013306 | Bacteria | 663 |
| 105 | Ga0157372_10009190 | 3300013307 | Bacteria | 10507 |
| 106 | Ga0157372_10009440 | 3300013307 | Bacteria | 10379 |
| 107 | Ga0157375_12657693 | 3300013308 | Bacteria | 598 |
| 108 | Ga0157380_10092902 | 3300014326 | Bacteria | 2494 |
| 109 | Ga0157380_10998782 | 3300014326 | Bacteria | 870 |
| 110 | Ga0157380_11809894 | 3300014326 | Bacteria | 670 |
| 111 | Ga0157380_13119574 | 3300014326 | Bacteria | 529 |
| 112 | Ga0163161_10014040 | 3300017792 | Bacteria | 5577 |
| 113 | Ga0163161_11795068 | 3300017792 | Bacteria | 545 |
| 114 | Ga0209050_1030880 | 3300025298 | Bacteria | 1682 |
| 115 | Ga0209257_1000199 | 3300025304 | Bacteria | 148045 |
| 116 | Ga0207682_10006370 | 3300025893 | Bacteria | 4761 |
| 117 | Ga0207680_10410827 | 3300025903 | Unclassified | 957 |
| 118 | Ga0207705_10000765 | 3300025909 | Bacteria | 26497 |
| 119 | Ga0207705_10038755 | 3300025909 | Bacteria | 3413 |
| 120 | Ga0207705_10609571 | 3300025909 | Bacteria | 849 |
| 121 | Ga0207654_10586005 | 3300025911 | Bacteria | 795 |
| 122 | Ga0207654_11252030 | 3300025911 | Bacteria | 541 |
| 123 | Ga0207707_10016964 | 3300025912 | Bacteria | 6344 |
| 124 | Ga0207707_11218251 | 3300025912 | Unclassified | 608 |
| 125 | Ga0207695_11338055 | 3300025913 | Bacteria | 597 |
| 126 | Ga0207671_10225336 | 3300025914 | Bacteria | 1470 |
| 127 | Ga0207660_10014187 | 3300025917 | Bacteria | 5232 |
| 128 | Ga0207660_10039812 | 3300025917 | Bacteria | 3287 |
| 129 | Ga0207660_10124547 | 3300025917 | Bacteria | 1956 |
| 130 | Ga0207657_10024437 | 3300025919 | Bacteria | 5592 |
| 131 | Ga0207657_10090375 | 3300025919 | Bacteria | 2556 |
| 132 | Ga0207657_10595582 | 3300025919 | Bacteria | 863 |
| 133 | Ga0207657_11070779 | 3300025919 | Bacteria | 617 |
| 134 | Ga0207649_10005757 | 3300025920 | Bacteria | 6709 |
| 135 | Ga0207649_10108684 | 3300025920 | Bacteria | 1849 |
| 136 | Ga0207652_10003773 | 3300025921 | Bacteria | 12405 |
| 137 | Ga0207652_10047749 | 3300025921 | Bacteria | 3657 |
| 138 | Ga0207652_10107773 | 3300025921 | Bacteria | 2468 |
| 139 | Ga0207652_10120699 | 3300025921 | Bacteria | 2332 |
| 140 | Ga0207652_11809612 | 3300025921 | Unclassified | 516 |
| 141 | Ga0207681_10367481 | 3300025923 | Bacteria | 1155 |
| 142 | Ga0207681_10703369 | 3300025923 | Bacteria | 840 |
| 143 | Ga0207694_10318601 | 3300025924 | Unclassified | 1283 |
| 144 | Ga0207650_10117450 | 3300025925 | Bacteria | 2067 |
| 145 | Ga0207650_11311466 | 3300025925 | Bacteria | 616 |
| 146 | Ga0207659_11649110 | 3300025926 | Bacteria | 547 |
| 147 | Ga0207644_10000613 | 3300025931 | Bacteria | 22703 |
| 148 | Ga0207690_10006188 | 3300025932 | Bacteria | 7088 |
| 149 | Ga0207690_10034520 | 3300025932 | Plasmid | 3260 |
| 150 | Ga0207690_10212133 | 3300025932 | Bacteria | 1477 |
| 151 | Ga0207706_10007534 | 3300025933 | Bacteria | 10072 |
| 152 | Ga0207686_10715312 | 3300025934 | Bacteria | 797 |
| 153 | Ga0207709_10074680 | 3300025935 | Bacteria | 2164 |
| 154 | Ga0207669_11145680 | 3300025937 | Bacteria | 658 |
| 155 | Ga0207689_11403944 | 3300025942 | Bacteria | 585 |
| 156 | Ga0207679_10005480 | 3300025945 | Bacteria | 7952 |
| 157 | Ga0207679_11071110 | 3300025945 | Bacteria | 739 |
| 158 | Ga0207667_10041189 | 3300025949 | Bacteria | 4914 |
| 159 | Ga0207667_10144415 | 3300025949 | Unclassified | 2450 |
| 160 | Ga0207667_10952152 | 3300025949 | Bacteria | 848 |
| 161 | Ga0207712_10117211 | 3300025961 | Bacteria | 2008 |
| 162 | Ga0207712_10252392 | 3300025961 | Bacteria | 1426 |
| 163 | Ga0207640_10078747 | 3300025981 | Unclassified | 2244 |
| 164 | Ga0207658_10046079 | 3300025986 | Bacteria | 3182 |
| 165 | Ga0207658_10111536 | 3300025986 | Bacteria | 2163 |
| 166 | Ga0207703_10004639 | 3300026035 | Bacteria | 11227 |
| 167 | Ga0207639_10000426 | 3300026041 | Bacteria | 29198 |
| 168 | Ga0207639_10122924 | 3300026041 | Bacteria | 2136 |
| 169 | Ga0207678_10167773 | 3300026067 | Bacteria | 1874 |
| 170 | Ga0207678_10970087 | 3300026067 | Bacteria | 752 |
| 171 | Ga0207648_10763305 | 3300026089 | Bacteria | 899 |
| 172 | Ga0207674_10083937 | 3300026116 | Bacteria | 3184 |
| 173 | Ga0207674_10161104 | 3300026116 | Bacteria | 2198 |
| 174 | Ga0207698_10030190 | 3300026142 | Bacteria | 3894 |
| 175 | Ga0209995_1086683 | 3300027471 | Bacteria | 538 |
| 176 | Ga0268265_11128887 | 3300028380 | Bacteria | 779 |
| 177 | Ga0307513_10010440 | 3300031456 | Bacteria | 11641 |
| 178 | Ga0307408_100745984 | 3300031548 | Bacteria | 884 |
| 179 | Ga0307408_100892853 | 3300031548 | Bacteria | 813 |
| 180 | Ga0307405_10247129 | 3300031731 | Bacteria | 1325 |
| 181 | Ga0307413_10280991 | 3300031824 | Bacteria | 1252 |
| 182 | Ga0307410_10100158 | 3300031852 | Bacteria | 2075 |
| 183 | Ga0307406_10329968 | 3300031901 | Bacteria | 1184 |
| 184 | Ga0307406_11403288 | 3300031901 | Bacteria | 612 |
| 185 | Ga0307407_10290089 | 3300031903 | Bacteria | 1137 |
| 186 | Ga0307412_10418185 | 3300031911 | Bacteria | 1096 |
| 187 | Ga0307412_10743872 | 3300031911 | Bacteria | 846 |
| 188 | Ga0307409_101329465 | 3300031995 | Bacteria | 744 |
| 189 | Ga0307416_100135264 | 3300032002 | Bacteria | 2228 |
| 190 | Ga0307416_101742796 | 3300032002 | Bacteria | 727 |
| 191 | Ga0307414_10822510 | 3300032004 | Bacteria | 848 |
| 192 | Ga0307414_12221123 | 3300032004 | Bacteria | 512 |
| 193 | Ga0307411_10828320 | 3300032005 | Bacteria | 817 |
| 194 | Ga0307411_12217097 | 3300032005 | Bacteria | 515 |
| 195 | Ga0307415_100363446 | 3300032126 | Bacteria | 1223 |
| 196 | Ga0307415_100434259 | 3300032126 | Bacteria | 1131 |
| 197 | Ga0307415_101065631 | 3300032126 | Bacteria | 755 |
| 198 | Ga0395900_0383597 | 3300037418 | Bacteria | 1373 |
| 199 | Ga0395900_0631446 | 3300037418 | Unclassified | 1009 |
| 200 | Ga0395905_0815221 | 3300037471 | Unclassified | 836 |
| 201 | Ga0395901_0478081 | 3300038443 | Unclassified | 1271 |
| 202 | Ga0451802_1724416 | 3300041460 | Bacteria | 3206 |
| 203 | Ga0451806_083352 | 3300041462 | Bacteria | 2457 |
| 204 | Ga0451804_0605226 | 3300041463 | Bacteria | 711 |
| 205 | Ga0451835_1197099 | 3300041492 | Bacteria | 928 |
| 206 | Ga0451841_0714975 | 3300041498 | Bacteria | 557 |
| 207 | Ga0451855_1514891 | 3300041511 | Bacteria | 593 |
| 208 | Ga0451853_2244438 | 3300041512 | Bacteria | 892 |
| 209 | Ga0451853_2594310 | 3300041512 | Bacteria | 716 |
| 210 | Ga0439448_0329925 | 3300042005 | Bacteria | 543 |
| 211 | Ga0450912_000225 | 3300042116 | Bacteria | 2410 |
| 212 | Ga0439434_0119382 | 3300042435 | Bacteria | 859 |
| 213 | Ga0450893_0014894 | 3300042532 | Bacteria | 1308 |
| 214 | Ga0495590_0211544 | 3300046457 | Bacteria | 715 |
| 215 | Ga0495654_0224948 | 3300046530 | Bacteria | 792 |
| 216 | Ga0495598_0107411 | 3300046537 | Bacteria | 931 |
| 217 | Ga0495621_0044821 | 3300046539 | Bacteria | 1564 |
| 218 | Ga0495597_0312790 | 3300046542 | Bacteria | 608 |
| 219 | Ga0495622_0110028 | 3300046557 | Bacteria | 1261 |
| 220 | Ga0495633_0145590 | 3300046558 | Bacteria | 1095 |
| 221 | Ga0495589_0545232 | 3300046794 | Bacteria | 529 |
| 222 | Ga0495672_0064791 | 3300047320 | Bacteria | 2091 |
| 223 | Ga0495615_0020854 | 3300048090 | Bacteria | 1473 |
| 224 | Ga0496100_0528649 | 3300048903 | Bacteria | 911 |
| 225 | Ga0496102_0210120 | 3300048905 | Bacteria | 1835 |
| 226 | Ga0496108_0259292 | 3300048911 | Bacteria | 1513 |
| 227 | Ga0496109_1416627 | 3300048912 | Bacteria | 630 |
| 228 | Ga0496110_0061724 | 3300048913 | Bacteria | 3309 |
| 229 | Ga0496110_0315185 | 3300048913 | Bacteria | 1424 |
| 230 | Ga0496111_0115143 | 3300048914 | Bacteria | 1982 |
| 231 | Ga0496111_0462823 | 3300048914 | Unclassified | 935 |
| 232 | Ga0496112_1054378 | 3300048915 | Unclassified | 732 |
| 233 | Ga0496121_0319648 | 3300048924 | Bacteria | 1046 |
| 234 | Ga0496122_0000996 | 3300048925 | Bacteria | 50450 |
| 235 | Ga0496122_0252740 | 3300048925 | Bacteria | 984 |
| 236 | Ga0496122_0616110 | 3300048925 | Bacteria | 505 |
| 237 | Ga0496123_0000337 | 3300048926 | Bacteria | 88727 |
| 238 | Ga0496123_0308428 | 3300048926 | Bacteria | 752 |
| 239 | Ga0496124_0010408 | 3300048927 | Bacteria | 9420 |
| 240 | Ga0496124_0028878 | 3300048927 | Bacteria | 4952 |
| 241 | Ga0496124_0079741 | 3300048927 | Bacteria | 2695 |
| 242 | Ga0496125_0024423 | 3300048928 | Bacteria | 5559 |
| 243 | Ga0496125_0118299 | 3300048928 | Bacteria | 1898 |
| 244 | Ga0496125_0406087 | 3300048928 | Bacteria | 794 |
| 245 | Ga0496126_0242737 | 3300048929 | Bacteria | 1504 |
| 246 | Ga0496126_0500482 | 3300048929 | Bacteria | 971 |
| 247 | Ga0496126_0594589 | 3300048929 | Bacteria | 872 |
| 248 | Ga0496126_0942811 | 3300048929 | Bacteria | 651 |
| 249 | Ga0496126_1300092 | 3300048929 | Bacteria | 530 |
| 250 | Ga0495678_064397 | 3300049459 | Bacteria | 1365 |
| 251 | Ga0501242_010758 | 3300049674 | Bacteria | 1096 |
| 252 | nmdc:mga03683_302874_c1 | 3300050489 | Bacteria | 750 |
| 253 | nmdc:mga08y16_974394_c1 | 3300050511 | Unclassified | 829 |
| 254 | nmdc:mga0sz30_22553_c1 | 3300050516 | Bacteria | 2556 |
| 255 | Ga0500594_0001898 | 3300053118 | Bacteria | 4523 |
| 256 | Ga0500559_0502752 | 3300053136 | Bacteria | 556 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006353 | Ga0075370_10629943 | Ga0075370_106299432 | 29 |
| 2 | 3300009177 | Ga0105248_10808184 | Ga0105248_108081842 | 30 |
| 3 | 3300009551 | Ga0105238_10291313 | Ga0105238_102913132 | 30 |
| 4 | 3300025298 | Ga0209050_1030880 | Ga0209050_10308804 | 30 |
| 5 | 3300025304 | Ga0209257_1000199 | Ga0209257_100019968 | 30 |
| 6 | 3300025924 | Ga0207694_10318601 | Ga0207694_103186012 | 30 |
| 7 | 3300005842 | Ga0068858_100220686 | Ga0068858_1002206862 | 31 |
| 8 | 3300031456 | Ga0307513_10010440 | Ga0307513_1001044011 | 31 |
| 9 | 3300005578 | Ga0068854_100101136 | Ga0068854_1001011364 | 32 |
| 10 | 3300025981 | Ga0207640_10078747 | Ga0207640_100787474 | 32 |
| 11 | 3300048929 | Ga0496126_0500482 | Ga0496126_0500482_46_165 | 32 |
| 12 | 3300031548 | Ga0307408_100745984 | Ga0307408_1007459842 | 37 |
| 13 | 3300031911 | Ga0307412_10743872 | Ga0307412_107438721 | 37 |
| 14 | 3300032002 | Ga0307416_101742796 | Ga0307416_1017427961 | 37 |
| 15 | 3300032126 | Ga0307415_100363446 | Ga0307415_1003634462 | 37 |
| 16 | iso_pu_bacteria | 2599185359 | 2600225568 | 37 |
| 17 | iso_pu_bacteria | 2928526807 | 2928528561 | 37 |
| 18 | 3300005334 | Ga0068869_100424795 | Ga0068869_1004247953 | 38 |
| 19 | 3300009148 | Ga0105243_11733660 | Ga0105243_117336602 | 38 |
| 20 | 3300025893 | Ga0207682_10006370 | Ga0207682_100063704 | 38 |
| 21 | 3300025923 | Ga0207681_10703369 | Ga0207681_107033692 | 38 |
| 22 | 3300025935 | Ga0207709_10074680 | Ga0207709_100746805 | 38 |
| 23 | 3300025942 | Ga0207689_11403944 | Ga0207689_114039442 | 38 |
| 24 | iso_pu_bacteria | 2512564014 | 2512644743 | 38 |
| 25 | iso_pu_bacteria | 2643221588 | 2643950359 | 38 |
| 26 | iso_pu_bacteria | 2919709256 | 2919712179 | 38 |
| 27 | 3300005356 | Ga0070674_101059170 | Ga0070674_1010591702 | 39 |
| 28 | 3300025937 | Ga0207669_11145680 | Ga0207669_111456802 | 39 |
| 29 | 3300026067 | Ga0207678_10970087 | Ga0207678_109700872 | 39 |
| 30 | 3300046457 | Ga0495590_0211544 | Ga0495590_0211544_72_191 | 39 |
| 31 | 3300053136 | Ga0500559_0502752 | Ga0500559_0502752_123_245 | 39 |
| 32 | 3300005354 | Ga0070675_101935986 | Ga0070675_1019359861 | 40 |
| 33 | 3300005438 | Ga0070701_10146169 | Ga0070701_101461692 | 40 |
| 34 | 3300005543 | Ga0070672_100876295 | Ga0070672_1008762953 | 40 |
| 35 | 3300009176 | Ga0105242_10941589 | Ga0105242_109415893 | 40 |
| 36 | 3300013100 | Ga0157373_10316121 | Ga0157373_103161212 | 40 |
| 37 | 3300013105 | Ga0157369_10542824 | Ga0157369_105428241 | 40 |
| 38 | 3300013306 | Ga0163162_12002970 | Ga0163162_120029702 | 40 |
| 39 | 3300014326 | Ga0157380_10092902 | Ga0157380_100929021 | 40 |
| 40 | 3300025909 | Ga0207705_10609571 | Ga0207705_106095712 | 40 |
| 41 | 3300025911 | Ga0207654_10586005 | Ga0207654_105860051 | 40 |
| 42 | 3300025919 | Ga0207657_10595582 | Ga0207657_105955822 | 40 |
| 43 | 3300025926 | Ga0207659_11649110 | Ga0207659_116491101 | 40 |
| 44 | 3300025934 | Ga0207686_10715312 | Ga0207686_107153122 | 40 |
| 45 | 3300027471 | Ga0209995_1086683 | Ga0209995_10866831 | 40 |
| 46 | 3300041460 | Ga0451802_1724416 | Ga0451802_1724416_2927_3049 | 40 |
| 47 | 3300041462 | Ga0451806_083352 | Ga0451806_083352_1338_1460 | 40 |
| 48 | 3300041463 | Ga0451804_0605226 | Ga0451804_0605226_412_534 | 40 |
| 49 | 3300041492 | Ga0451835_1197099 | Ga0451835_1197099_573_695 | 40 |
| 50 | 3300041512 | Ga0451853_2244438 | Ga0451853_2244438_566_688 | 40 |
| 51 | 3300002075 | JGI24738J21930_10012160 | JGI24738J21930_100121604 | 41 |
| 52 | 3300005289 | Ga0065704_10116625 | Ga0065704_101166251 | 41 |
| 53 | 3300005331 | Ga0070670_100167837 | Ga0070670_1001678373 | 41 |
| 54 | 3300005353 | Ga0070669_100428025 | Ga0070669_1004280252 | 41 |
| 55 | 3300005355 | Ga0070671_100559962 | Ga0070671_1005599622 | 41 |
| 56 | 3300005367 | Ga0070667_100142065 | Ga0070667_1001420652 | 41 |
| 57 | 3300009011 | Ga0105251_10077333 | Ga0105251_100773332 | 41 |
| 58 | 3300009174 | Ga0105241_10151746 | Ga0105241_101517463 | 41 |
| 59 | 3300009545 | Ga0105237_10034455 | Ga0105237_100344556 | 41 |
| 60 | 3300009553 | Ga0105249_10005683 | Ga0105249_1000568316 | 41 |
| 61 | 3300013100 | Ga0157373_10054312 | Ga0157373_100543124 | 41 |
| 62 | 3300017792 | Ga0163161_10014040 | Ga0163161_100140405 | 41 |
| 63 | 3300017792 | Ga0163161_11795068 | Ga0163161_117950682 | 41 |
| 64 | 3300025914 | Ga0207671_10225336 | Ga0207671_102253362 | 41 |
| 65 | 3300025923 | Ga0207681_10367481 | Ga0207681_103674812 | 41 |
| 66 | 3300025925 | Ga0207650_10117450 | Ga0207650_101174504 | 41 |
| 67 | 3300025961 | Ga0207712_10117211 | Ga0207712_101172114 | 41 |
| 68 | 3300025986 | Ga0207658_10111536 | Ga0207658_101115363 | 41 |
| 69 | 3300026089 | Ga0207648_10763305 | Ga0207648_107633051 | 41 |
| 70 | 3300032005 | Ga0307411_12217097 | Ga0307411_122170972 | 41 |
| 71 | 3300037418 | Ga0395900_0383597 | Ga0395900_0383597_673_801 | 41 |
| 72 | 3300041498 | Ga0451841_0714975 | Ga0451841_0714975_320_448 | 41 |
| 73 | 3300046530 | Ga0495654_0224948 | Ga0495654_0224948_624_752 | 41 |
| 74 | 3300046542 | Ga0495597_0312790 | Ga0495597_0312790_392_520 | 41 |
| 75 | 3300046557 | Ga0495622_0110028 | Ga0495622_0110028_778_906 | 41 |
| 76 | 3300046558 | Ga0495633_0145590 | Ga0495633_0145590_768_896 | 41 |
| 77 | 3300047320 | Ga0495672_0064791 | Ga0495672_0064791_954_1082 | 41 |
| 78 | 3300048911 | Ga0496108_0259292 | Ga0496108_0259292_901_1029 | 41 |
| 79 | 3300048912 | Ga0496109_1416627 | Ga0496109_1416627_404_532 | 41 |
| 80 | 3300048913 | Ga0496110_0315185 | Ga0496110_0315185_538_666 | 41 |
| 81 | 3300048914 | Ga0496111_0462823 | Ga0496111_0462823_59_187 | 41 |
| 82 | 3300048915 | Ga0496112_1054378 | Ga0496112_1054378_208_336 | 41 |
| 83 | 3300048924 | Ga0496121_0319648 | Ga0496121_0319648_136_264 | 41 |
| 84 | 3300048925 | Ga0496122_0000996 | Ga0496122_0000996_18298_18426 | 41 |
| 85 | 3300048925 | Ga0496122_0252740 | Ga0496122_0252740_355_483 | 41 |
| 86 | 3300048925 | Ga0496122_0616110 | Ga0496122_0616110_53_181 | 41 |
| 87 | 3300048926 | Ga0496123_0000337 | Ga0496123_0000337_71441_71569 | 41 |
| 88 | 3300048926 | Ga0496123_0308428 | Ga0496123_0308428_351_479 | 41 |
| 89 | 3300048927 | Ga0496124_0010408 | Ga0496124_0010408_248_376 | 41 |
| 90 | 3300048927 | Ga0496124_0028878 | Ga0496124_0028878_953_1081 | 41 |
| 91 | 3300048927 | Ga0496124_0079741 | Ga0496124_0079741_830_958 | 41 |
| 92 | 3300048928 | Ga0496125_0024423 | Ga0496125_0024423_4454_4582 | 41 |
| 93 | 3300048928 | Ga0496125_0118299 | Ga0496125_0118299_207_335 | 41 |
| 94 | 3300048928 | Ga0496125_0406087 | Ga0496125_0406087_615_743 | 41 |
| 95 | 3300048929 | Ga0496126_0242737 | Ga0496126_0242737_411_539 | 41 |
| 96 | 3300048929 | Ga0496126_0594589 | Ga0496126_0594589_187_315 | 41 |
| 97 | 3300048929 | Ga0496126_0942811 | Ga0496126_0942811_22_150 | 41 |
| 98 | 3300048929 | Ga0496126_1300092 | Ga0496126_1300092_273_398 | 41 |
| 99 | 3300049459 | Ga0495678_064397 | Ga0495678_064397_854_982 | 41 |
| 100 | 3300049674 | Ga0501242_010758 | Ga0501242_010758_776_901 | 41 |
| 101 | 3300053118 | Ga0500594_0001898 | Ga0500594_0001898_3191_3319 | 41 |
| 102 | 2162886007 | SwRhRL2b_contig_3687313 | SwRhRL2b_0307.00003770 | 42 |
| 103 | 3300002459 | JGI24751J29686_10000362 | JGI24751J29686_1000036217 | 42 |
| 104 | 3300004803 | Ga0058862_12383326 | Ga0058862_123833261 | 42 |
| 105 | 3300005288 | Ga0065714_10345185 | Ga0065714_103451851 | 42 |
| 106 | 3300005289 | Ga0065704_10000204 | Ga0065704_1000020434 | 42 |
| 107 | 3300005290 | Ga0065712_10777282 | Ga0065712_107772821 | 42 |
| 108 | 3300005295 | Ga0065707_10427014 | Ga0065707_104270141 | 42 |
| 109 | 3300005327 | Ga0070658_10024254 | Ga0070658_100242548 | 42 |
| 110 | 3300005327 | Ga0070658_10034117 | Ga0070658_100341175 | 42 |
| 111 | 3300005329 | Ga0070683_100044720 | Ga0070683_1000447206 | 42 |
| 112 | 3300005329 | Ga0070683_100097029 | Ga0070683_1000970296 | 42 |
| 113 | 3300005331 | Ga0070670_100629349 | Ga0070670_1006293491 | 42 |
| 114 | 3300005331 | Ga0070670_100854910 | Ga0070670_1008549101 | 42 |
| 115 | 3300005331 | Ga0070670_101040093 | Ga0070670_1010400933 | 42 |
| 116 | 3300005333 | Ga0070677_10228883 | Ga0070677_102288832 | 42 |
| 117 | 3300005335 | Ga0070666_10091698 | Ga0070666_100916982 | 42 |
| 118 | 3300005336 | Ga0070680_100006627 | Ga0070680_1000066278 | 42 |
| 119 | 3300005336 | Ga0070680_100153492 | Ga0070680_1001534924 | 42 |
| 120 | 3300005336 | Ga0070680_100209740 | Ga0070680_1002097401 | 42 |
| 121 | 3300005336 | Ga0070680_100485477 | Ga0070680_1004854773 | 42 |
| 122 | 3300005337 | Ga0070682_100523881 | Ga0070682_1005238812 | 42 |
| 123 | 3300005337 | Ga0070682_101129278 | Ga0070682_1011292782 | 42 |
| 124 | 3300005339 | Ga0070660_100002787 | Ga0070660_1000027876 | 42 |
| 125 | 3300005344 | Ga0070661_100000551 | Ga0070661_1000005518 | 42 |
| 126 | 3300005344 | Ga0070661_100143389 | Ga0070661_1001433892 | 42 |
| 127 | 3300005344 | Ga0070661_100187755 | Ga0070661_1001877552 | 42 |
| 128 | 3300005345 | Ga0070692_10012846 | Ga0070692_100128465 | 42 |
| 129 | 3300005354 | Ga0070675_100467451 | Ga0070675_1004674512 | 42 |
| 130 | 3300005355 | Ga0070671_100000714 | Ga0070671_1000007146 | 42 |
| 131 | 3300005366 | Ga0070659_102024775 | Ga0070659_1020247752 | 42 |
| 132 | 3300005367 | Ga0070667_100040129 | Ga0070667_1000401296 | 42 |
| 133 | 3300005455 | Ga0070663_100441457 | Ga0070663_1004414573 | 42 |
| 134 | 3300005457 | Ga0070662_100000429 | Ga0070662_1000004299 | 42 |
| 135 | 3300005457 | Ga0070662_100049541 | Ga0070662_1000495412 | 42 |
| 136 | 3300005458 | Ga0070681_10118718 | Ga0070681_101187186 | 42 |
| 137 | 3300005458 | Ga0070681_11058484 | Ga0070681_110584842 | 42 |
| 138 | 3300005468 | Ga0070707_100230181 | Ga0070707_1002301814 | 42 |
| 139 | 3300005530 | Ga0070679_100078027 | Ga0070679_1000780272 | 42 |
| 140 | 3300005530 | Ga0070679_100086107 | Ga0070679_1000861075 | 42 |
| 141 | 3300005530 | Ga0070679_100276391 | Ga0070679_1002763912 | 42 |
| 142 | 3300005530 | Ga0070679_102024456 | Ga0070679_1020244562 | 42 |
| 143 | 3300005535 | Ga0070684_100025729 | Ga0070684_10002572911 | 42 |
| 144 | 3300005535 | Ga0070684_101485479 | Ga0070684_1014854792 | 42 |
| 145 | 3300005539 | Ga0068853_100009754 | Ga0068853_1000097548 | 42 |
| 146 | 3300005539 | Ga0068853_100083338 | Ga0068853_1000833387 | 42 |
| 147 | 3300005546 | Ga0070696_101042014 | Ga0070696_1010420142 | 42 |
| 148 | 3300005547 | Ga0070693_100031348 | Ga0070693_1000313485 | 42 |
| 149 | 3300005547 | Ga0070693_100176616 | Ga0070693_1001766164 | 42 |
| 150 | 3300005563 | Ga0068855_100011355 | Ga0068855_10001135512 | 42 |
| 151 | 3300005563 | Ga0068855_100687353 | Ga0068855_1006873533 | 42 |
| 152 | 3300005564 | Ga0070664_100007589 | Ga0070664_1000075895 | 42 |
| 153 | 3300005564 | Ga0070664_100628783 | Ga0070664_1006287833 | 42 |
| 154 | 3300005577 | Ga0068857_100153270 | Ga0068857_1001532705 | 42 |
| 155 | 3300005578 | Ga0068854_100041647 | Ga0068854_1000416475 | 42 |
| 156 | 3300005616 | Ga0068852_100145459 | Ga0068852_1001454593 | 42 |
| 157 | 3300005616 | Ga0068852_100587153 | Ga0068852_1005871533 | 42 |
| 158 | 3300005617 | Ga0068859_100089483 | Ga0068859_1000894835 | 42 |
| 159 | 3300005617 | Ga0068859_102933236 | Ga0068859_1029332361 | 42 |
| 160 | 3300005618 | Ga0068864_100999279 | Ga0068864_1009992792 | 42 |
| 161 | 3300005618 | Ga0068864_101493066 | Ga0068864_1014930662 | 42 |
| 162 | 3300005842 | Ga0068858_100006781 | Ga0068858_10000678110 | 42 |
| 163 | 3300005843 | Ga0068860_100133555 | Ga0068860_1001335556 | 42 |
| 164 | 3300006177 | Ga0075362_10045722 | Ga0075362_100457222 | 42 |
| 165 | 3300006186 | Ga0075369_10046953 | Ga0075369_100469532 | 42 |
| 166 | 3300006931 | Ga0097620_100089481 | Ga0097620_1000894815 | 42 |
| 167 | 3300006931 | Ga0097620_102931634 | Ga0097620_1029316341 | 42 |
| 168 | 3300009093 | Ga0105240_11438249 | Ga0105240_114382492 | 42 |
| 169 | 3300009094 | Ga0111539_11524227 | Ga0111539_115242272 | 42 |
| 170 | 3300009174 | Ga0105241_10030319 | Ga0105241_100303196 | 42 |
| 171 | 3300009174 | Ga0105241_10982350 | Ga0105241_109823502 | 42 |
| 172 | 3300009551 | Ga0105238_12943167 | Ga0105238_129431672 | 42 |
| 173 | 3300010375 | Ga0105239_10058275 | Ga0105239_100582757 | 42 |
| 174 | 3300013100 | Ga0157373_11261357 | Ga0157373_112613572 | 42 |
| 175 | 3300013102 | Ga0157371_10006923 | Ga0157371_100069238 | 42 |
| 176 | 3300013102 | Ga0157371_10013137 | Ga0157371_100131379 | 42 |
| 177 | 3300013104 | Ga0157370_10086233 | Ga0157370_100862335 | 42 |
| 178 | 3300013105 | Ga0157369_10034042 | Ga0157369_100340429 | 42 |
| 179 | 3300013306 | Ga0163162_10005756 | Ga0163162_100057565 | 42 |
| 180 | 3300013307 | Ga0157372_10009190 | Ga0157372_100091902 | 42 |
| 181 | 3300013307 | Ga0157372_10009440 | Ga0157372_1000944014 | 42 |
| 182 | 3300013308 | Ga0157375_12657693 | Ga0157375_126576931 | 42 |
| 183 | 3300014326 | Ga0157380_10998782 | Ga0157380_109987822 | 42 |
| 184 | 3300014326 | Ga0157380_11809894 | Ga0157380_118098942 | 42 |
| 185 | 3300014326 | Ga0157380_13119574 | Ga0157380_131195742 | 42 |
| 186 | 3300025903 | Ga0207680_10410827 | Ga0207680_104108272 | 42 |
| 187 | 3300025909 | Ga0207705_10000765 | Ga0207705_1000076523 | 42 |
| 188 | 3300025909 | Ga0207705_10038755 | Ga0207705_100387553 | 42 |
| 189 | 3300025911 | Ga0207654_11252030 | Ga0207654_112520302 | 42 |
| 190 | 3300025912 | Ga0207707_10016964 | Ga0207707_100169647 | 42 |
| 191 | 3300025912 | Ga0207707_11218251 | Ga0207707_112182513 | 42 |
| 192 | 3300025913 | Ga0207695_11338055 | Ga0207695_113380552 | 42 |
| 193 | 3300025917 | Ga0207660_10014187 | Ga0207660_100141879 | 42 |
| 194 | 3300025917 | Ga0207660_10039812 | Ga0207660_100398125 | 42 |
| 195 | 3300025917 | Ga0207660_10124547 | Ga0207660_101245472 | 42 |
| 196 | 3300025919 | Ga0207657_10024437 | Ga0207657_100244379 | 42 |
| 197 | 3300025919 | Ga0207657_10090375 | Ga0207657_100903754 | 42 |
| 198 | 3300025919 | Ga0207657_11070779 | Ga0207657_110707792 | 42 |
| 199 | 3300025920 | Ga0207649_10005757 | Ga0207649_100057574 | 42 |
| 200 | 3300025920 | Ga0207649_10108684 | Ga0207649_101086843 | 42 |
| 201 | 3300025921 | Ga0207652_10003773 | Ga0207652_1000377310 | 42 |
| 202 | 3300025921 | Ga0207652_10047749 | Ga0207652_100477494 | 42 |
| 203 | 3300025921 | Ga0207652_10107773 | Ga0207652_101077734 | 42 |
| 204 | 3300025921 | Ga0207652_10120699 | Ga0207652_101206993 | 42 |
| 205 | 3300025921 | Ga0207652_11809612 | Ga0207652_118096121 | 42 |
| 206 | 3300025925 | Ga0207650_11311466 | Ga0207650_113114662 | 42 |
| 207 | 3300025931 | Ga0207644_10000613 | Ga0207644_1000061320 | 42 |
| 208 | 3300025932 | Ga0207690_10006188 | Ga0207690_100061887 | 42 |
| 209 | 3300025932 | Ga0207690_10034520 | Ga0207690_100345202 | 42 |
| 210 | 3300025932 | Ga0207690_10212133 | Ga0207690_102121334 | 42 |
| 211 | 3300025933 | Ga0207706_10007534 | Ga0207706_1000753410 | 42 |
| 212 | 3300025945 | Ga0207679_10005480 | Ga0207679_100054809 | 42 |
| 213 | 3300025945 | Ga0207679_11071110 | Ga0207679_110711103 | 42 |
| 214 | 3300025949 | Ga0207667_10041189 | Ga0207667_100411891 | 42 |
| 215 | 3300025949 | Ga0207667_10144415 | Ga0207667_101444156 | 42 |
| 216 | 3300025949 | Ga0207667_10952152 | Ga0207667_109521522 | 42 |
| 217 | 3300025961 | Ga0207712_10252392 | Ga0207712_102523922 | 42 |
| 218 | 3300025986 | Ga0207658_10046079 | Ga0207658_100460797 | 42 |
| 219 | 3300026035 | Ga0207703_10004639 | Ga0207703_100046399 | 42 |
| 220 | 3300026041 | Ga0207639_10000426 | Ga0207639_1000042628 | 42 |
| 221 | 3300026041 | Ga0207639_10122924 | Ga0207639_101229243 | 42 |
| 222 | 3300026067 | Ga0207678_10167773 | Ga0207678_101677732 | 42 |
| 223 | 3300026116 | Ga0207674_10083937 | Ga0207674_100839376 | 42 |
| 224 | 3300026116 | Ga0207674_10161104 | Ga0207674_101611046 | 42 |
| 225 | 3300026142 | Ga0207698_10030190 | Ga0207698_100301904 | 42 |
| 226 | 3300028380 | Ga0268265_11128887 | Ga0268265_111288872 | 42 |
| 227 | 3300031548 | Ga0307408_100892853 | Ga0307408_1008928531 | 42 |
| 228 | 3300031731 | Ga0307405_10247129 | Ga0307405_102471292 | 42 |
| 229 | 3300031824 | Ga0307413_10280991 | Ga0307413_102809913 | 42 |
| 230 | 3300031852 | Ga0307410_10100158 | Ga0307410_101001582 | 42 |
| 231 | 3300031901 | Ga0307406_10329968 | Ga0307406_103299682 | 42 |
| 232 | 3300031901 | Ga0307406_11403288 | Ga0307406_114032882 | 42 |
| 233 | 3300031903 | Ga0307407_10290089 | Ga0307407_102900892 | 42 |
| 234 | 3300031911 | Ga0307412_10418185 | Ga0307412_104181852 | 42 |
| 235 | 3300031995 | Ga0307409_101329465 | Ga0307409_1013294652 | 42 |
| 236 | 3300032002 | Ga0307416_100135264 | Ga0307416_1001352642 | 42 |
| 237 | 3300032004 | Ga0307414_10822510 | Ga0307414_108225102 | 42 |
| 238 | 3300032004 | Ga0307414_12221123 | Ga0307414_122211232 | 42 |
| 239 | 3300032005 | Ga0307411_10828320 | Ga0307411_108283203 | 42 |
| 240 | 3300032126 | Ga0307415_100434259 | Ga0307415_1004342592 | 42 |
| 241 | 3300032126 | Ga0307415_101065631 | Ga0307415_1010656312 | 42 |
| 242 | 3300037418 | Ga0395900_0631446 | Ga0395900_0631446_175_306 | 42 |
| 243 | 3300037471 | Ga0395905_0815221 | Ga0395905_0815221_397_528 | 42 |
| 244 | 3300038443 | Ga0395901_0478081 | Ga0395901_0478081_826_957 | 42 |
| 245 | 3300041511 | Ga0451855_1514891 | Ga0451855_1514891_324_455 | 42 |
| 246 | 3300041512 | Ga0451853_2594310 | Ga0451853_2594310_185_316 | 42 |
| 247 | 3300042005 | Ga0439448_0329925 | Ga0439448_0329925_227_358 | 42 |
| 248 | 3300042116 | Ga0450912_000225 | Ga0450912_000225_2063_2194 | 42 |
| 249 | 3300042435 | Ga0439434_0119382 | Ga0439434_0119382_423_554 | 42 |
| 250 | 3300042532 | Ga0450893_0014894 | Ga0450893_0014894_430_561 | 42 |
| 251 | 3300046537 | Ga0495598_0107411 | Ga0495598_0107411_669_800 | 42 |
| 252 | 3300046539 | Ga0495621_0044821 | Ga0495621_0044821_476_607 | 42 |
| 253 | 3300046794 | Ga0495589_0545232 | Ga0495589_0545232_306_437 | 42 |
| 254 | 3300048090 | Ga0495615_0020854 | Ga0495615_0020854_890_1021 | 42 |
| 255 | 3300048903 | Ga0496100_0528649 | Ga0496100_0528649_194_325 | 42 |
| 256 | 3300048905 | Ga0496102_0210120 | Ga0496102_0210120_1381_1512 | 42 |
| 257 | 3300048913 | Ga0496110_0061724 | Ga0496110_0061724_2543_2674 | 42 |
| 258 | 3300048914 | Ga0496111_0115143 | Ga0496111_0115143_1317_1448 | 42 |
| 259 | 3300050489 | nmdc:mga03683_302874_c1 | nmdc:mga03683_302874_c1_586_720 | 42 |
| 260 | 3300050511 | nmdc:mga08y16_974394_c1 | nmdc:mga08y16_974394_c1_376_507 | 42 |
| 261 | 3300050516 | nmdc:mga0sz30_22553_c1 | nmdc:mga0sz30_22553_c1_558_692 | 42 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar