F370060

General Info

Members Datasets Scaffolds Average Seq Length
261 168 256 42

Family's Representative Sequence

Representative Sequence 3300005295|Ga0065707_10427014|Ga0065707_104270141
Length 44
Sequence MAKGQKKSNREVRKPKAEKPKKLNASNPSLKPGGVAGLENIRNT

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
3 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
4 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
5 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
6 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
9 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
52 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
53 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
113 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
114 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
115 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
116 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
117 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
118 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
119 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
120 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
121 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
122 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
123 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
124 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
125 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
126 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
127 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
128 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
129 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
130 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
131 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
132 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
133 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
134 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
135 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
136 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
137 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
138 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
139 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
140 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
141 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
142 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
143 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
144 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
145 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
146 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
147 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
148 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
149 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
150 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
151 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
152 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
153 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
154 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
155 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
156 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
157 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
158 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
159 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
160 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
161 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
162 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
163 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
164 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
165 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
166 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
167 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
168 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.7
Metatranscriptomes 0.38
Isolates 1.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.45
Nodule 0
Rhizoplane 4.98
Rhizosphere 81.99
Stem 0
Stem Tuber 0
Unclassified 9.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3687313 2162886007 Bacteria 63168
2 JGI24738J21930_10012160 3300002075 Bacteria 1882
3 JGI24751J29686_10000362 3300002459 Bacteria 15798
4 Ga0058862_12383326 3300004803 Unclassified 528
5 Ga0065714_10345185 3300005288 Bacteria 641
6 Ga0065704_10000204 3300005289 Bacteria 211587
7 Ga0065704_10116625 3300005289 Bacteria 1850
8 Ga0065712_10777282 3300005290 Bacteria 520
9 Ga0065707_10427014 3300005295 Bacteria 824
10 Ga0070658_10024254 3300005327 Bacteria 4866
11 Ga0070658_10034117 3300005327 Bacteria 4094
12 Ga0070683_100044720 3300005329 Bacteria 4085
13 Ga0070683_100097029 3300005329 Bacteria 2773
14 Ga0070670_100167837 3300005331 Bacteria 1903
15 Ga0070670_100629349 3300005331 Unclassified 961
16 Ga0070670_100854910 3300005331 Bacteria 823
17 Ga0070670_101040093 3300005331 Unclassified 745
18 Ga0070677_10228883 3300005333 Bacteria 912
19 Ga0068869_100424795 3300005334 Bacteria 1097
20 Ga0070666_10091698 3300005335 Bacteria 2088
21 Ga0070680_100006627 3300005336 Bacteria 8807
22 Ga0070680_100153492 3300005336 Bacteria 1934
23 Ga0070680_100209740 3300005336 Bacteria 1643
24 Ga0070680_100485477 3300005336 Bacteria 1056
25 Ga0070682_100523881 3300005337 Bacteria 922
26 Ga0070682_101129278 3300005337 Bacteria 658
27 Ga0070660_100002787 3300005339 Bacteria 12002
28 Ga0070661_100000551 3300005344 Bacteria 28749
29 Ga0070661_100143389 3300005344 Bacteria 1801
30 Ga0070661_100187755 3300005344 Bacteria 1575
31 Ga0070692_10012846 3300005345 Unclassified 3890
32 Ga0070669_100428025 3300005353 Bacteria 1087
33 Ga0070675_100467451 3300005354 Bacteria 1133
34 Ga0070675_101935986 3300005354 Bacteria 544
35 Ga0070671_100000714 3300005355 Bacteria 23894
36 Ga0070671_100559962 3300005355 Bacteria 986
37 Ga0070674_101059170 3300005356 Bacteria 714
38 Ga0070659_102024775 3300005366 Unclassified 517
39 Ga0070667_100040129 3300005367 Bacteria 3925
40 Ga0070667_100142065 3300005367 Bacteria 2103
41 Ga0070701_10146169 3300005438 Bacteria 1357
42 Ga0070663_100441457 3300005455 Unclassified 1071
43 Ga0070662_100000429 3300005457 Bacteria 24862
44 Ga0070662_100049541 3300005457 Bacteria 3029
45 Ga0070681_10118718 3300005458 Bacteria 2581
46 Ga0070681_11058484 3300005458 Unclassified 732
47 Ga0070707_100230181 3300005468 Bacteria 1804
48 Ga0070679_100078027 3300005530 Bacteria 3301
49 Ga0070679_100086107 3300005530 Bacteria 3129
50 Ga0070679_100276391 3300005530 Bacteria 1633
51 Ga0070679_102024456 3300005530 Unclassified 525
52 Ga0070684_100025729 3300005535 Bacteria 4949
53 Ga0070684_101485479 3300005535 Bacteria 639
54 Ga0068853_100009754 3300005539 Bacteria 7746
55 Ga0068853_100083338 3300005539 Bacteria 2801
56 Ga0070672_100876295 3300005543 Bacteria 792
57 Ga0070696_101042014 3300005546 Bacteria 685
58 Ga0070693_100031348 3300005547 Unclassified 2913
59 Ga0070693_100176616 3300005547 Bacteria 1372
60 Ga0068855_100011355 3300005563 Bacteria 10754
61 Ga0068855_100687353 3300005563 Bacteria 1096
62 Ga0070664_100007589 3300005564 Bacteria 8757
63 Ga0070664_100628783 3300005564 Bacteria 997
64 Ga0068857_100153270 3300005577 Bacteria 2089
65 Ga0068854_100041647 3300005578 Bacteria 3246
66 Ga0068854_100101136 3300005578 Unclassified 2161
67 Ga0068852_100145459 3300005616 Unclassified 2198
68 Ga0068852_100587153 3300005616 Bacteria 1117
69 Ga0068859_100089483 3300005617 Bacteria 3129
70 Ga0068859_102933236 3300005617 Unclassified 522
71 Ga0068864_100999279 3300005618 Bacteria 830
72 Ga0068864_101493066 3300005618 Unclassified 679
73 Ga0068858_100006781 3300005842 Bacteria 11139
74 Ga0068858_100220686 3300005842 Unclassified 1795
75 Ga0068860_100133555 3300005843 Unclassified 2383
76 Ga0075362_10045722 3300006177 Bacteria 1945
77 Ga0075369_10046953 3300006186 Bacteria 1861
78 Ga0075370_10629943 3300006353 Bacteria 650
79 Ga0097620_100089481 3300006931 Bacteria 3129
80 Ga0097620_102931634 3300006931 Unclassified 522
81 Ga0105251_10077333 3300009011 Bacteria 1543
82 Ga0105240_11438249 3300009093 Bacteria 724
83 Ga0111539_11524227 3300009094 Bacteria 775
84 Ga0105243_11733660 3300009148 Bacteria 654
85 Ga0105241_10030319 3300009174 Bacteria 4041
86 Ga0105241_10151746 3300009174 Bacteria 1896
87 Ga0105241_10982350 3300009174 Bacteria 789
88 Ga0105242_10941589 3300009176 Bacteria 867
89 Ga0105248_10808184 3300009177 Archaea 1058
90 Ga0105237_10034455 3300009545 Bacteria 5127
91 Ga0105238_10291313 3300009551 Bacteria 1615
92 Ga0105238_12943167 3300009551 Bacteria 512
93 Ga0105249_10005683 3300009553 Bacteria 10783
94 Ga0105239_10058275 3300010375 Bacteria 4238
95 Ga0157373_10054312 3300013100 Bacteria 2847
96 Ga0157373_10316121 3300013100 Bacteria 1110
97 Ga0157373_11261357 3300013100 Bacteria 558
98 Ga0157371_10006923 3300013102 Bacteria 9250
99 Ga0157371_10013137 3300013102 Bacteria 6304
100 Ga0157370_10086233 3300013104 Unclassified 2950
101 Ga0157369_10034042 3300013105 Bacteria 5595
102 Ga0157369_10542824 3300013105 Bacteria 1202
103 Ga0163162_10005756 3300013306 Bacteria 11989
104 Ga0163162_12002970 3300013306 Bacteria 663
105 Ga0157372_10009190 3300013307 Bacteria 10507
106 Ga0157372_10009440 3300013307 Bacteria 10379
107 Ga0157375_12657693 3300013308 Bacteria 598
108 Ga0157380_10092902 3300014326 Bacteria 2494
109 Ga0157380_10998782 3300014326 Bacteria 870
110 Ga0157380_11809894 3300014326 Bacteria 670
111 Ga0157380_13119574 3300014326 Bacteria 529
112 Ga0163161_10014040 3300017792 Bacteria 5577
113 Ga0163161_11795068 3300017792 Bacteria 545
114 Ga0209050_1030880 3300025298 Bacteria 1682
115 Ga0209257_1000199 3300025304 Bacteria 148045
116 Ga0207682_10006370 3300025893 Bacteria 4761
117 Ga0207680_10410827 3300025903 Unclassified 957
118 Ga0207705_10000765 3300025909 Bacteria 26497
119 Ga0207705_10038755 3300025909 Bacteria 3413
120 Ga0207705_10609571 3300025909 Bacteria 849
121 Ga0207654_10586005 3300025911 Bacteria 795
122 Ga0207654_11252030 3300025911 Bacteria 541
123 Ga0207707_10016964 3300025912 Bacteria 6344
124 Ga0207707_11218251 3300025912 Unclassified 608
125 Ga0207695_11338055 3300025913 Bacteria 597
126 Ga0207671_10225336 3300025914 Bacteria 1470
127 Ga0207660_10014187 3300025917 Bacteria 5232
128 Ga0207660_10039812 3300025917 Bacteria 3287
129 Ga0207660_10124547 3300025917 Bacteria 1956
130 Ga0207657_10024437 3300025919 Bacteria 5592
131 Ga0207657_10090375 3300025919 Bacteria 2556
132 Ga0207657_10595582 3300025919 Bacteria 863
133 Ga0207657_11070779 3300025919 Bacteria 617
134 Ga0207649_10005757 3300025920 Bacteria 6709
135 Ga0207649_10108684 3300025920 Bacteria 1849
136 Ga0207652_10003773 3300025921 Bacteria 12405
137 Ga0207652_10047749 3300025921 Bacteria 3657
138 Ga0207652_10107773 3300025921 Bacteria 2468
139 Ga0207652_10120699 3300025921 Bacteria 2332
140 Ga0207652_11809612 3300025921 Unclassified 516
141 Ga0207681_10367481 3300025923 Bacteria 1155
142 Ga0207681_10703369 3300025923 Bacteria 840
143 Ga0207694_10318601 3300025924 Unclassified 1283
144 Ga0207650_10117450 3300025925 Bacteria 2067
145 Ga0207650_11311466 3300025925 Bacteria 616
146 Ga0207659_11649110 3300025926 Bacteria 547
147 Ga0207644_10000613 3300025931 Bacteria 22703
148 Ga0207690_10006188 3300025932 Bacteria 7088
149 Ga0207690_10034520 3300025932 Plasmid 3260
150 Ga0207690_10212133 3300025932 Bacteria 1477
151 Ga0207706_10007534 3300025933 Bacteria 10072
152 Ga0207686_10715312 3300025934 Bacteria 797
153 Ga0207709_10074680 3300025935 Bacteria 2164
154 Ga0207669_11145680 3300025937 Bacteria 658
155 Ga0207689_11403944 3300025942 Bacteria 585
156 Ga0207679_10005480 3300025945 Bacteria 7952
157 Ga0207679_11071110 3300025945 Bacteria 739
158 Ga0207667_10041189 3300025949 Bacteria 4914
159 Ga0207667_10144415 3300025949 Unclassified 2450
160 Ga0207667_10952152 3300025949 Bacteria 848
161 Ga0207712_10117211 3300025961 Bacteria 2008
162 Ga0207712_10252392 3300025961 Bacteria 1426
163 Ga0207640_10078747 3300025981 Unclassified 2244
164 Ga0207658_10046079 3300025986 Bacteria 3182
165 Ga0207658_10111536 3300025986 Bacteria 2163
166 Ga0207703_10004639 3300026035 Bacteria 11227
167 Ga0207639_10000426 3300026041 Bacteria 29198
168 Ga0207639_10122924 3300026041 Bacteria 2136
169 Ga0207678_10167773 3300026067 Bacteria 1874
170 Ga0207678_10970087 3300026067 Bacteria 752
171 Ga0207648_10763305 3300026089 Bacteria 899
172 Ga0207674_10083937 3300026116 Bacteria 3184
173 Ga0207674_10161104 3300026116 Bacteria 2198
174 Ga0207698_10030190 3300026142 Bacteria 3894
175 Ga0209995_1086683 3300027471 Bacteria 538
176 Ga0268265_11128887 3300028380 Bacteria 779
177 Ga0307513_10010440 3300031456 Bacteria 11641
178 Ga0307408_100745984 3300031548 Bacteria 884
179 Ga0307408_100892853 3300031548 Bacteria 813
180 Ga0307405_10247129 3300031731 Bacteria 1325
181 Ga0307413_10280991 3300031824 Bacteria 1252
182 Ga0307410_10100158 3300031852 Bacteria 2075
183 Ga0307406_10329968 3300031901 Bacteria 1184
184 Ga0307406_11403288 3300031901 Bacteria 612
185 Ga0307407_10290089 3300031903 Bacteria 1137
186 Ga0307412_10418185 3300031911 Bacteria 1096
187 Ga0307412_10743872 3300031911 Bacteria 846
188 Ga0307409_101329465 3300031995 Bacteria 744
189 Ga0307416_100135264 3300032002 Bacteria 2228
190 Ga0307416_101742796 3300032002 Bacteria 727
191 Ga0307414_10822510 3300032004 Bacteria 848
192 Ga0307414_12221123 3300032004 Bacteria 512
193 Ga0307411_10828320 3300032005 Bacteria 817
194 Ga0307411_12217097 3300032005 Bacteria 515
195 Ga0307415_100363446 3300032126 Bacteria 1223
196 Ga0307415_100434259 3300032126 Bacteria 1131
197 Ga0307415_101065631 3300032126 Bacteria 755
198 Ga0395900_0383597 3300037418 Bacteria 1373
199 Ga0395900_0631446 3300037418 Unclassified 1009
200 Ga0395905_0815221 3300037471 Unclassified 836
201 Ga0395901_0478081 3300038443 Unclassified 1271
202 Ga0451802_1724416 3300041460 Bacteria 3206
203 Ga0451806_083352 3300041462 Bacteria 2457
204 Ga0451804_0605226 3300041463 Bacteria 711
205 Ga0451835_1197099 3300041492 Bacteria 928
206 Ga0451841_0714975 3300041498 Bacteria 557
207 Ga0451855_1514891 3300041511 Bacteria 593
208 Ga0451853_2244438 3300041512 Bacteria 892
209 Ga0451853_2594310 3300041512 Bacteria 716
210 Ga0439448_0329925 3300042005 Bacteria 543
211 Ga0450912_000225 3300042116 Bacteria 2410
212 Ga0439434_0119382 3300042435 Bacteria 859
213 Ga0450893_0014894 3300042532 Bacteria 1308
214 Ga0495590_0211544 3300046457 Bacteria 715
215 Ga0495654_0224948 3300046530 Bacteria 792
216 Ga0495598_0107411 3300046537 Bacteria 931
217 Ga0495621_0044821 3300046539 Bacteria 1564
218 Ga0495597_0312790 3300046542 Bacteria 608
219 Ga0495622_0110028 3300046557 Bacteria 1261
220 Ga0495633_0145590 3300046558 Bacteria 1095
221 Ga0495589_0545232 3300046794 Bacteria 529
222 Ga0495672_0064791 3300047320 Bacteria 2091
223 Ga0495615_0020854 3300048090 Bacteria 1473
224 Ga0496100_0528649 3300048903 Bacteria 911
225 Ga0496102_0210120 3300048905 Bacteria 1835
226 Ga0496108_0259292 3300048911 Bacteria 1513
227 Ga0496109_1416627 3300048912 Bacteria 630
228 Ga0496110_0061724 3300048913 Bacteria 3309
229 Ga0496110_0315185 3300048913 Bacteria 1424
230 Ga0496111_0115143 3300048914 Bacteria 1982
231 Ga0496111_0462823 3300048914 Unclassified 935
232 Ga0496112_1054378 3300048915 Unclassified 732
233 Ga0496121_0319648 3300048924 Bacteria 1046
234 Ga0496122_0000996 3300048925 Bacteria 50450
235 Ga0496122_0252740 3300048925 Bacteria 984
236 Ga0496122_0616110 3300048925 Bacteria 505
237 Ga0496123_0000337 3300048926 Bacteria 88727
238 Ga0496123_0308428 3300048926 Bacteria 752
239 Ga0496124_0010408 3300048927 Bacteria 9420
240 Ga0496124_0028878 3300048927 Bacteria 4952
241 Ga0496124_0079741 3300048927 Bacteria 2695
242 Ga0496125_0024423 3300048928 Bacteria 5559
243 Ga0496125_0118299 3300048928 Bacteria 1898
244 Ga0496125_0406087 3300048928 Bacteria 794
245 Ga0496126_0242737 3300048929 Bacteria 1504
246 Ga0496126_0500482 3300048929 Bacteria 971
247 Ga0496126_0594589 3300048929 Bacteria 872
248 Ga0496126_0942811 3300048929 Bacteria 651
249 Ga0496126_1300092 3300048929 Bacteria 530
250 Ga0495678_064397 3300049459 Bacteria 1365
251 Ga0501242_010758 3300049674 Bacteria 1096
252 nmdc:mga03683_302874_c1 3300050489 Bacteria 750
253 nmdc:mga08y16_974394_c1 3300050511 Unclassified 829
254 nmdc:mga0sz30_22553_c1 3300050516 Bacteria 2556
255 Ga0500594_0001898 3300053118 Bacteria 4523
256 Ga0500559_0502752 3300053136 Bacteria 556

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006353 Ga0075370_10629943 Ga0075370_106299432 29
2 3300009177 Ga0105248_10808184 Ga0105248_108081842 30
3 3300009551 Ga0105238_10291313 Ga0105238_102913132 30
4 3300025298 Ga0209050_1030880 Ga0209050_10308804 30
5 3300025304 Ga0209257_1000199 Ga0209257_100019968 30
6 3300025924 Ga0207694_10318601 Ga0207694_103186012 30
7 3300005842 Ga0068858_100220686 Ga0068858_1002206862 31
8 3300031456 Ga0307513_10010440 Ga0307513_1001044011 31
9 3300005578 Ga0068854_100101136 Ga0068854_1001011364 32
10 3300025981 Ga0207640_10078747 Ga0207640_100787474 32
11 3300048929 Ga0496126_0500482 Ga0496126_0500482_46_165 32
12 3300031548 Ga0307408_100745984 Ga0307408_1007459842 37
13 3300031911 Ga0307412_10743872 Ga0307412_107438721 37
14 3300032002 Ga0307416_101742796 Ga0307416_1017427961 37
15 3300032126 Ga0307415_100363446 Ga0307415_1003634462 37
16 iso_pu_bacteria 2599185359 2600225568 37
17 iso_pu_bacteria 2928526807 2928528561 37
18 3300005334 Ga0068869_100424795 Ga0068869_1004247953 38
19 3300009148 Ga0105243_11733660 Ga0105243_117336602 38
20 3300025893 Ga0207682_10006370 Ga0207682_100063704 38
21 3300025923 Ga0207681_10703369 Ga0207681_107033692 38
22 3300025935 Ga0207709_10074680 Ga0207709_100746805 38
23 3300025942 Ga0207689_11403944 Ga0207689_114039442 38
24 iso_pu_bacteria 2512564014 2512644743 38
25 iso_pu_bacteria 2643221588 2643950359 38
26 iso_pu_bacteria 2919709256 2919712179 38
27 3300005356 Ga0070674_101059170 Ga0070674_1010591702 39
28 3300025937 Ga0207669_11145680 Ga0207669_111456802 39
29 3300026067 Ga0207678_10970087 Ga0207678_109700872 39
30 3300046457 Ga0495590_0211544 Ga0495590_0211544_72_191 39
31 3300053136 Ga0500559_0502752 Ga0500559_0502752_123_245 39
32 3300005354 Ga0070675_101935986 Ga0070675_1019359861 40
33 3300005438 Ga0070701_10146169 Ga0070701_101461692 40
34 3300005543 Ga0070672_100876295 Ga0070672_1008762953 40
35 3300009176 Ga0105242_10941589 Ga0105242_109415893 40
36 3300013100 Ga0157373_10316121 Ga0157373_103161212 40
37 3300013105 Ga0157369_10542824 Ga0157369_105428241 40
38 3300013306 Ga0163162_12002970 Ga0163162_120029702 40
39 3300014326 Ga0157380_10092902 Ga0157380_100929021 40
40 3300025909 Ga0207705_10609571 Ga0207705_106095712 40
41 3300025911 Ga0207654_10586005 Ga0207654_105860051 40
42 3300025919 Ga0207657_10595582 Ga0207657_105955822 40
43 3300025926 Ga0207659_11649110 Ga0207659_116491101 40
44 3300025934 Ga0207686_10715312 Ga0207686_107153122 40
45 3300027471 Ga0209995_1086683 Ga0209995_10866831 40
46 3300041460 Ga0451802_1724416 Ga0451802_1724416_2927_3049 40
47 3300041462 Ga0451806_083352 Ga0451806_083352_1338_1460 40
48 3300041463 Ga0451804_0605226 Ga0451804_0605226_412_534 40
49 3300041492 Ga0451835_1197099 Ga0451835_1197099_573_695 40
50 3300041512 Ga0451853_2244438 Ga0451853_2244438_566_688 40
51 3300002075 JGI24738J21930_10012160 JGI24738J21930_100121604 41
52 3300005289 Ga0065704_10116625 Ga0065704_101166251 41
53 3300005331 Ga0070670_100167837 Ga0070670_1001678373 41
54 3300005353 Ga0070669_100428025 Ga0070669_1004280252 41
55 3300005355 Ga0070671_100559962 Ga0070671_1005599622 41
56 3300005367 Ga0070667_100142065 Ga0070667_1001420652 41
57 3300009011 Ga0105251_10077333 Ga0105251_100773332 41
58 3300009174 Ga0105241_10151746 Ga0105241_101517463 41
59 3300009545 Ga0105237_10034455 Ga0105237_100344556 41
60 3300009553 Ga0105249_10005683 Ga0105249_1000568316 41
61 3300013100 Ga0157373_10054312 Ga0157373_100543124 41
62 3300017792 Ga0163161_10014040 Ga0163161_100140405 41
63 3300017792 Ga0163161_11795068 Ga0163161_117950682 41
64 3300025914 Ga0207671_10225336 Ga0207671_102253362 41
65 3300025923 Ga0207681_10367481 Ga0207681_103674812 41
66 3300025925 Ga0207650_10117450 Ga0207650_101174504 41
67 3300025961 Ga0207712_10117211 Ga0207712_101172114 41
68 3300025986 Ga0207658_10111536 Ga0207658_101115363 41
69 3300026089 Ga0207648_10763305 Ga0207648_107633051 41
70 3300032005 Ga0307411_12217097 Ga0307411_122170972 41
71 3300037418 Ga0395900_0383597 Ga0395900_0383597_673_801 41
72 3300041498 Ga0451841_0714975 Ga0451841_0714975_320_448 41
73 3300046530 Ga0495654_0224948 Ga0495654_0224948_624_752 41
74 3300046542 Ga0495597_0312790 Ga0495597_0312790_392_520 41
75 3300046557 Ga0495622_0110028 Ga0495622_0110028_778_906 41
76 3300046558 Ga0495633_0145590 Ga0495633_0145590_768_896 41
77 3300047320 Ga0495672_0064791 Ga0495672_0064791_954_1082 41
78 3300048911 Ga0496108_0259292 Ga0496108_0259292_901_1029 41
79 3300048912 Ga0496109_1416627 Ga0496109_1416627_404_532 41
80 3300048913 Ga0496110_0315185 Ga0496110_0315185_538_666 41
81 3300048914 Ga0496111_0462823 Ga0496111_0462823_59_187 41
82 3300048915 Ga0496112_1054378 Ga0496112_1054378_208_336 41
83 3300048924 Ga0496121_0319648 Ga0496121_0319648_136_264 41
84 3300048925 Ga0496122_0000996 Ga0496122_0000996_18298_18426 41
85 3300048925 Ga0496122_0252740 Ga0496122_0252740_355_483 41
86 3300048925 Ga0496122_0616110 Ga0496122_0616110_53_181 41
87 3300048926 Ga0496123_0000337 Ga0496123_0000337_71441_71569 41
88 3300048926 Ga0496123_0308428 Ga0496123_0308428_351_479 41
89 3300048927 Ga0496124_0010408 Ga0496124_0010408_248_376 41
90 3300048927 Ga0496124_0028878 Ga0496124_0028878_953_1081 41
91 3300048927 Ga0496124_0079741 Ga0496124_0079741_830_958 41
92 3300048928 Ga0496125_0024423 Ga0496125_0024423_4454_4582 41
93 3300048928 Ga0496125_0118299 Ga0496125_0118299_207_335 41
94 3300048928 Ga0496125_0406087 Ga0496125_0406087_615_743 41
95 3300048929 Ga0496126_0242737 Ga0496126_0242737_411_539 41
96 3300048929 Ga0496126_0594589 Ga0496126_0594589_187_315 41
97 3300048929 Ga0496126_0942811 Ga0496126_0942811_22_150 41
98 3300048929 Ga0496126_1300092 Ga0496126_1300092_273_398 41
99 3300049459 Ga0495678_064397 Ga0495678_064397_854_982 41
100 3300049674 Ga0501242_010758 Ga0501242_010758_776_901 41
101 3300053118 Ga0500594_0001898 Ga0500594_0001898_3191_3319 41
102 2162886007 SwRhRL2b_contig_3687313 SwRhRL2b_0307.00003770 42
103 3300002459 JGI24751J29686_10000362 JGI24751J29686_1000036217 42
104 3300004803 Ga0058862_12383326 Ga0058862_123833261 42
105 3300005288 Ga0065714_10345185 Ga0065714_103451851 42
106 3300005289 Ga0065704_10000204 Ga0065704_1000020434 42
107 3300005290 Ga0065712_10777282 Ga0065712_107772821 42
108 3300005295 Ga0065707_10427014 Ga0065707_104270141 42
109 3300005327 Ga0070658_10024254 Ga0070658_100242548 42
110 3300005327 Ga0070658_10034117 Ga0070658_100341175 42
111 3300005329 Ga0070683_100044720 Ga0070683_1000447206 42
112 3300005329 Ga0070683_100097029 Ga0070683_1000970296 42
113 3300005331 Ga0070670_100629349 Ga0070670_1006293491 42
114 3300005331 Ga0070670_100854910 Ga0070670_1008549101 42
115 3300005331 Ga0070670_101040093 Ga0070670_1010400933 42
116 3300005333 Ga0070677_10228883 Ga0070677_102288832 42
117 3300005335 Ga0070666_10091698 Ga0070666_100916982 42
118 3300005336 Ga0070680_100006627 Ga0070680_1000066278 42
119 3300005336 Ga0070680_100153492 Ga0070680_1001534924 42
120 3300005336 Ga0070680_100209740 Ga0070680_1002097401 42
121 3300005336 Ga0070680_100485477 Ga0070680_1004854773 42
122 3300005337 Ga0070682_100523881 Ga0070682_1005238812 42
123 3300005337 Ga0070682_101129278 Ga0070682_1011292782 42
124 3300005339 Ga0070660_100002787 Ga0070660_1000027876 42
125 3300005344 Ga0070661_100000551 Ga0070661_1000005518 42
126 3300005344 Ga0070661_100143389 Ga0070661_1001433892 42
127 3300005344 Ga0070661_100187755 Ga0070661_1001877552 42
128 3300005345 Ga0070692_10012846 Ga0070692_100128465 42
129 3300005354 Ga0070675_100467451 Ga0070675_1004674512 42
130 3300005355 Ga0070671_100000714 Ga0070671_1000007146 42
131 3300005366 Ga0070659_102024775 Ga0070659_1020247752 42
132 3300005367 Ga0070667_100040129 Ga0070667_1000401296 42
133 3300005455 Ga0070663_100441457 Ga0070663_1004414573 42
134 3300005457 Ga0070662_100000429 Ga0070662_1000004299 42
135 3300005457 Ga0070662_100049541 Ga0070662_1000495412 42
136 3300005458 Ga0070681_10118718 Ga0070681_101187186 42
137 3300005458 Ga0070681_11058484 Ga0070681_110584842 42
138 3300005468 Ga0070707_100230181 Ga0070707_1002301814 42
139 3300005530 Ga0070679_100078027 Ga0070679_1000780272 42
140 3300005530 Ga0070679_100086107 Ga0070679_1000861075 42
141 3300005530 Ga0070679_100276391 Ga0070679_1002763912 42
142 3300005530 Ga0070679_102024456 Ga0070679_1020244562 42
143 3300005535 Ga0070684_100025729 Ga0070684_10002572911 42
144 3300005535 Ga0070684_101485479 Ga0070684_1014854792 42
145 3300005539 Ga0068853_100009754 Ga0068853_1000097548 42
146 3300005539 Ga0068853_100083338 Ga0068853_1000833387 42
147 3300005546 Ga0070696_101042014 Ga0070696_1010420142 42
148 3300005547 Ga0070693_100031348 Ga0070693_1000313485 42
149 3300005547 Ga0070693_100176616 Ga0070693_1001766164 42
150 3300005563 Ga0068855_100011355 Ga0068855_10001135512 42
151 3300005563 Ga0068855_100687353 Ga0068855_1006873533 42
152 3300005564 Ga0070664_100007589 Ga0070664_1000075895 42
153 3300005564 Ga0070664_100628783 Ga0070664_1006287833 42
154 3300005577 Ga0068857_100153270 Ga0068857_1001532705 42
155 3300005578 Ga0068854_100041647 Ga0068854_1000416475 42
156 3300005616 Ga0068852_100145459 Ga0068852_1001454593 42
157 3300005616 Ga0068852_100587153 Ga0068852_1005871533 42
158 3300005617 Ga0068859_100089483 Ga0068859_1000894835 42
159 3300005617 Ga0068859_102933236 Ga0068859_1029332361 42
160 3300005618 Ga0068864_100999279 Ga0068864_1009992792 42
161 3300005618 Ga0068864_101493066 Ga0068864_1014930662 42
162 3300005842 Ga0068858_100006781 Ga0068858_10000678110 42
163 3300005843 Ga0068860_100133555 Ga0068860_1001335556 42
164 3300006177 Ga0075362_10045722 Ga0075362_100457222 42
165 3300006186 Ga0075369_10046953 Ga0075369_100469532 42
166 3300006931 Ga0097620_100089481 Ga0097620_1000894815 42
167 3300006931 Ga0097620_102931634 Ga0097620_1029316341 42
168 3300009093 Ga0105240_11438249 Ga0105240_114382492 42
169 3300009094 Ga0111539_11524227 Ga0111539_115242272 42
170 3300009174 Ga0105241_10030319 Ga0105241_100303196 42
171 3300009174 Ga0105241_10982350 Ga0105241_109823502 42
172 3300009551 Ga0105238_12943167 Ga0105238_129431672 42
173 3300010375 Ga0105239_10058275 Ga0105239_100582757 42
174 3300013100 Ga0157373_11261357 Ga0157373_112613572 42
175 3300013102 Ga0157371_10006923 Ga0157371_100069238 42
176 3300013102 Ga0157371_10013137 Ga0157371_100131379 42
177 3300013104 Ga0157370_10086233 Ga0157370_100862335 42
178 3300013105 Ga0157369_10034042 Ga0157369_100340429 42
179 3300013306 Ga0163162_10005756 Ga0163162_100057565 42
180 3300013307 Ga0157372_10009190 Ga0157372_100091902 42
181 3300013307 Ga0157372_10009440 Ga0157372_1000944014 42
182 3300013308 Ga0157375_12657693 Ga0157375_126576931 42
183 3300014326 Ga0157380_10998782 Ga0157380_109987822 42
184 3300014326 Ga0157380_11809894 Ga0157380_118098942 42
185 3300014326 Ga0157380_13119574 Ga0157380_131195742 42
186 3300025903 Ga0207680_10410827 Ga0207680_104108272 42
187 3300025909 Ga0207705_10000765 Ga0207705_1000076523 42
188 3300025909 Ga0207705_10038755 Ga0207705_100387553 42
189 3300025911 Ga0207654_11252030 Ga0207654_112520302 42
190 3300025912 Ga0207707_10016964 Ga0207707_100169647 42
191 3300025912 Ga0207707_11218251 Ga0207707_112182513 42
192 3300025913 Ga0207695_11338055 Ga0207695_113380552 42
193 3300025917 Ga0207660_10014187 Ga0207660_100141879 42
194 3300025917 Ga0207660_10039812 Ga0207660_100398125 42
195 3300025917 Ga0207660_10124547 Ga0207660_101245472 42
196 3300025919 Ga0207657_10024437 Ga0207657_100244379 42
197 3300025919 Ga0207657_10090375 Ga0207657_100903754 42
198 3300025919 Ga0207657_11070779 Ga0207657_110707792 42
199 3300025920 Ga0207649_10005757 Ga0207649_100057574 42
200 3300025920 Ga0207649_10108684 Ga0207649_101086843 42
201 3300025921 Ga0207652_10003773 Ga0207652_1000377310 42
202 3300025921 Ga0207652_10047749 Ga0207652_100477494 42
203 3300025921 Ga0207652_10107773 Ga0207652_101077734 42
204 3300025921 Ga0207652_10120699 Ga0207652_101206993 42
205 3300025921 Ga0207652_11809612 Ga0207652_118096121 42
206 3300025925 Ga0207650_11311466 Ga0207650_113114662 42
207 3300025931 Ga0207644_10000613 Ga0207644_1000061320 42
208 3300025932 Ga0207690_10006188 Ga0207690_100061887 42
209 3300025932 Ga0207690_10034520 Ga0207690_100345202 42
210 3300025932 Ga0207690_10212133 Ga0207690_102121334 42
211 3300025933 Ga0207706_10007534 Ga0207706_1000753410 42
212 3300025945 Ga0207679_10005480 Ga0207679_100054809 42
213 3300025945 Ga0207679_11071110 Ga0207679_110711103 42
214 3300025949 Ga0207667_10041189 Ga0207667_100411891 42
215 3300025949 Ga0207667_10144415 Ga0207667_101444156 42
216 3300025949 Ga0207667_10952152 Ga0207667_109521522 42
217 3300025961 Ga0207712_10252392 Ga0207712_102523922 42
218 3300025986 Ga0207658_10046079 Ga0207658_100460797 42
219 3300026035 Ga0207703_10004639 Ga0207703_100046399 42
220 3300026041 Ga0207639_10000426 Ga0207639_1000042628 42
221 3300026041 Ga0207639_10122924 Ga0207639_101229243 42
222 3300026067 Ga0207678_10167773 Ga0207678_101677732 42
223 3300026116 Ga0207674_10083937 Ga0207674_100839376 42
224 3300026116 Ga0207674_10161104 Ga0207674_101611046 42
225 3300026142 Ga0207698_10030190 Ga0207698_100301904 42
226 3300028380 Ga0268265_11128887 Ga0268265_111288872 42
227 3300031548 Ga0307408_100892853 Ga0307408_1008928531 42
228 3300031731 Ga0307405_10247129 Ga0307405_102471292 42
229 3300031824 Ga0307413_10280991 Ga0307413_102809913 42
230 3300031852 Ga0307410_10100158 Ga0307410_101001582 42
231 3300031901 Ga0307406_10329968 Ga0307406_103299682 42
232 3300031901 Ga0307406_11403288 Ga0307406_114032882 42
233 3300031903 Ga0307407_10290089 Ga0307407_102900892 42
234 3300031911 Ga0307412_10418185 Ga0307412_104181852 42
235 3300031995 Ga0307409_101329465 Ga0307409_1013294652 42
236 3300032002 Ga0307416_100135264 Ga0307416_1001352642 42
237 3300032004 Ga0307414_10822510 Ga0307414_108225102 42
238 3300032004 Ga0307414_12221123 Ga0307414_122211232 42
239 3300032005 Ga0307411_10828320 Ga0307411_108283203 42
240 3300032126 Ga0307415_100434259 Ga0307415_1004342592 42
241 3300032126 Ga0307415_101065631 Ga0307415_1010656312 42
242 3300037418 Ga0395900_0631446 Ga0395900_0631446_175_306 42
243 3300037471 Ga0395905_0815221 Ga0395905_0815221_397_528 42
244 3300038443 Ga0395901_0478081 Ga0395901_0478081_826_957 42
245 3300041511 Ga0451855_1514891 Ga0451855_1514891_324_455 42
246 3300041512 Ga0451853_2594310 Ga0451853_2594310_185_316 42
247 3300042005 Ga0439448_0329925 Ga0439448_0329925_227_358 42
248 3300042116 Ga0450912_000225 Ga0450912_000225_2063_2194 42
249 3300042435 Ga0439434_0119382 Ga0439434_0119382_423_554 42
250 3300042532 Ga0450893_0014894 Ga0450893_0014894_430_561 42
251 3300046537 Ga0495598_0107411 Ga0495598_0107411_669_800 42
252 3300046539 Ga0495621_0044821 Ga0495621_0044821_476_607 42
253 3300046794 Ga0495589_0545232 Ga0495589_0545232_306_437 42
254 3300048090 Ga0495615_0020854 Ga0495615_0020854_890_1021 42
255 3300048903 Ga0496100_0528649 Ga0496100_0528649_194_325 42
256 3300048905 Ga0496102_0210120 Ga0496102_0210120_1381_1512 42
257 3300048913 Ga0496110_0061724 Ga0496110_0061724_2543_2674 42
258 3300048914 Ga0496111_0115143 Ga0496111_0115143_1317_1448 42
259 3300050489 nmdc:mga03683_302874_c1 nmdc:mga03683_302874_c1_586_720 42
260 3300050511 nmdc:mga08y16_974394_c1 nmdc:mga08y16_974394_c1_376_507 42
261 3300050516 nmdc:mga0sz30_22553_c1 nmdc:mga0sz30_22553_c1_558_692 42

Feature Viewer

pLDDT pTM Quality
69.81 0.19 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map