F369818

General Info

Members Datasets Scaffolds Average Seq Length
260 174 520 158

Family's Representative Sequence

Representative Sequence 3300046535|Ga0495586_0060464|Ga0495586_0060464_377_934
Length 185
Sequence LAQFSSLSNVAKPQDSADDAGMQIEKDTVATIDYTLTDPSGQVIDSSEGRQPIAYLHGASNIVPGLETALEGKNVGESIKVTIPPEQGYGARDPNLVQPVPRSNFQGIQEIKPGMQFQAQTAEGARVVTVVQVDDQNVTVDANHPLAGMELKFDVKIVDVRKATPEELTHGRAHDAGGHNHDHGH

Samples

Sample ID Description Type Environment
1 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
2 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
105 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
106 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
107 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
108 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
109 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
110 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
111 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
112 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
113 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
114 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
115 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
116 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
117 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
118 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
119 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
120 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
121 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
122 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
123 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
124 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
125 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
126 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
127 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
128 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
129 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
130 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
131 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
132 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
133 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
134 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
135 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
136 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
137 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
138 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
139 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
140 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
141 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
142 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
143 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
144 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
145 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
146 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
147 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
148 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
149 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
150 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
151 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
152 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
153 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
154 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
155 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
156 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
157 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
161 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
162 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
163 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
164 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
165 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
166 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
167 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
168 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
169 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
170 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
171 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
172 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
173 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
174 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.08
Metatranscriptomes 1.54
Isolates 0.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.69
Rhizosphere 95.38
Stem 0
Stem Tuber 0
Unclassified 16.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495586_0060464 3300046535 Bacteria 2060
2 JGI24033J26618_1000084 3300002155 Bacteria 13676
3 rootH2_10076778 3300003320 Bacteria 6464
4 rootL2_10058638 3300003322 Bacteria 7682
5 Ga0065704_10003046 3300005289 Bacteria 5827
6 Ga0065715_10435633 3300005293 Bacteria 842
7 Ga0070676_10008811 3300005328 Bacteria 5446
8 Ga0070683_100002357 3300005329 Bacteria 15000
9 Ga0070683_100098821 3300005329 Bacteria 2747
10 Ga0070683_100273759 3300005329 Unclassified 1606
11 Ga0070683_100354946 3300005329 Bacteria 1396
12 Ga0070690_100006835 3300005330 Bacteria 6490
13 Ga0070690_100008710 3300005330 Bacteria 5854
14 Ga0070670_100780863 3300005331 Bacteria 862
15 Ga0070666_10022714 3300005335 Bacteria 4077
16 Ga0070666_10506688 3300005335 Bacteria 875
17 Ga0070682_101154253 3300005337 Bacteria 651
18 Ga0068868_100037049 3300005338 Bacteria 3779
19 Ga0068868_100196125 3300005338 Unclassified 1681
20 Ga0068868_100645993 3300005338 Bacteria 942
21 Ga0070689_100019679 3300005340 Bacteria 4994
22 Ga0070689_100030209 3300005340 Bacteria 4111
23 Ga0070689_100092405 3300005340 Unclassified 2387
24 Ga0070691_10042555 3300005341 Unclassified 2150
25 Ga0070687_100087207 3300005343 Unclassified 1717
26 Ga0070687_100268686 3300005343 Bacteria 1068
27 Ga0070687_100662324 3300005343 Bacteria 725
28 Ga0070687_100664631 3300005343 Unclassified 724
29 Ga0070661_100014195 3300005344 Bacteria 5611
30 Ga0070692_10786292 3300005345 Bacteria 648
31 Ga0070668_100008719 3300005347 Bacteria 7531
32 Ga0070669_100001756 3300005353 Bacteria 15637
33 Ga0070675_100052164 3300005354 Bacteria 3362
34 Ga0070675_100054665 3300005354 Bacteria 3285
35 Ga0070675_100070956 3300005354 Unclassified 2889
36 Ga0070675_100261318 3300005354 Unclassified 1517
37 Ga0070675_100430510 3300005354 Bacteria 1181
38 Ga0070671_100650852 3300005355 Unclassified 912
39 Ga0070671_100773316 3300005355 Bacteria 835
40 Ga0070674_100009252 3300005356 Bacteria 5897
41 Ga0070674_100410731 3300005356 Bacteria 1108
42 Ga0070673_100010017 3300005364 Bacteria 6395
43 Ga0070673_100045657 3300005364 Bacteria 3399
44 Ga0070673_100273164 3300005364 Bacteria 1480
45 Ga0070673_100536001 3300005364 Bacteria 1062
46 Ga0070688_100007395 3300005365 Bacteria 5918
47 Ga0070688_100075324 3300005365 Bacteria 2169
48 Ga0070659_100026364 3300005366 Bacteria 4472
49 Ga0070659_100100574 3300005366 Unclassified 2327
50 Ga0070667_100228086 3300005367 Unclassified 1660
51 Ga0070667_100238809 3300005367 Bacteria 1622
52 Ga0070701_10075729 3300005438 Unclassified 1810
53 Ga0070705_100514554 3300005440 Bacteria 911
54 Ga0070700_100004122 3300005441 Bacteria 7575
55 Ga0070694_100031181 3300005444 Unclassified 3494
56 Ga0070678_100011089 3300005456 Bacteria 5542
57 Ga0070678_100120493 3300005456 Unclassified 2068
58 Ga0070662_100086093 3300005457 Unclassified 2350
59 Ga0068867_100007590 3300005459 Bacteria 7674
60 Ga0070685_10021675 3300005466 Bacteria 3495
61 Ga0070685_10069290 3300005466 Unclassified 2086
62 Ga0070685_10245976 3300005466 Bacteria 1183
63 Ga0070706_101370724 3300005467 Bacteria 648
64 Ga0070707_100343287 3300005468 Bacteria 1450
65 Ga0070684_100010695 3300005535 Bacteria 7278
66 Ga0068853_100082401 3300005539 Bacteria 2818
67 Ga0068853_100543324 3300005539 Bacteria 1100
68 Ga0070672_100049782 3300005543 Unclassified 3261
69 Ga0070672_100737347 3300005543 Bacteria 864
70 Ga0070672_100761765 3300005543 Bacteria 850
71 Ga0070686_100031258 3300005544 Unclassified 3254
72 Ga0068855_100726013 3300005563 Unclassified 1061
73 Ga0070664_100352950 3300005564 Bacteria 1338
74 Ga0068856_100326442 3300005614 Bacteria 1552
75 Ga0070702_100904139 3300005615 Bacteria 691
76 Ga0068859_100135900 3300005617 Unclassified 2532
77 Ga0068864_100183769 3300005618 Bacteria 1913
78 Ga0068864_100664711 3300005618 Bacteria 1015
79 Ga0068866_10002829 3300005718 Bacteria 7153
80 Ga0068861_100016577 3300005719 Bacteria 5215
81 Ga0068858_100372917 3300005842 Unclassified 1369
82 Ga0068862_100480396 3300005844 Bacteria 1176
83 Ga0070717_10908623 3300006028 Unclassified 802
84 Ga0068871_100767618 3300006358 Bacteria 887
85 Ga0075428_101293680 3300006844 Bacteria 767
86 Ga0068865_100024414 3300006881 Bacteria 3966
87 Ga0097620_100135898 3300006931 Unclassified 2532
88 Ga0111539_10019153 3300009094 Bacteria 8456
89 Ga0105243_10085772 3300009148 Unclassified 2581
90 Ga0105249_10971409 3300009553 Bacteria 918
91 Ga0105246_11465650 3300011119 Bacteria 639
92 Ga0157369_10368226 3300013105 Bacteria 1492
93 Ga0157369_10720674 3300013105 Bacteria 1027
94 Ga0157374_10187900 3300013296 Unclassified 2020
95 Ga0157378_10018588 3300013297 Bacteria 6110
96 Ga0157378_10071133 3300013297 Bacteria 3124
97 Ga0163162_10474786 3300013306 Unclassified 1382
98 Ga0157372_10169241 3300013307 Bacteria 2528
99 Ga0157372_10237565 3300013307 Bacteria 2114
100 Ga0157372_10735741 3300013307 Bacteria 1147
101 Ga0157375_10003016 3300013308 Bacteria 14620
102 Ga0157376_10556206 3300014969 Bacteria 1136
103 Ga0197907_11139451 3300020069 Unclassified 561
104 Ga0206352_10238752 3300020078 Unclassified 583
105 Ga0206353_11805911 3300020082 Unclassified 563
106 Ga0224712_10546051 3300022467 Unclassified 563
107 Ga0207642_10086871 3300025899 Unclassified 1534
108 Ga0207680_10033505 3300025903 Bacteria 2931
109 Ga0207699_10387638 3300025906 Bacteria 993
110 Ga0207645_10010053 3300025907 Bacteria 6515
111 Ga0207645_10497525 3300025907 Bacteria 825
112 Ga0207684_11020245 3300025910 Bacteria 691
113 Ga0207663_10562632 3300025916 Bacteria 892
114 Ga0207662_10023068 3300025918 Bacteria 3573
115 Ga0207662_10074610 3300025918 Unclassified 2059
116 Ga0207649_10052017 3300025920 Bacteria 2539
117 Ga0207646_10534543 3300025922 Bacteria 1055
118 Ga0207681_10006508 3300025923 Bacteria 7170
119 Ga0207681_10401922 3300025923 Bacteria 1107
120 Ga0207694_11160233 3300025924 Bacteria 654
121 Ga0207650_11426948 3300025925 Bacteria 589
122 Ga0207659_10224919 3300025926 Bacteria 1511
123 Ga0207659_10258163 3300025926 Bacteria 1416
124 Ga0207659_10357662 3300025926 Bacteria 1213
125 Ga0207659_10792584 3300025926 Bacteria 814
126 Ga0207690_10039135 3300025932 Bacteria 3092
127 Ga0207706_10143413 3300025933 Bacteria 2101
128 Ga0207670_10204184 3300025936 Unclassified 1503
129 Ga0207670_10530657 3300025936 Unclassified 959
130 Ga0207669_10088000 3300025937 Bacteria 2013
131 Ga0207669_10359753 3300025937 Bacteria 1127
132 Ga0207704_10032422 3300025938 Unclassified 2957
133 Ga0207691_10029290 3300025940 Bacteria 5150
134 Ga0207691_10226370 3300025940 Bacteria 1620
135 Ga0207691_10818194 3300025940 Bacteria 782
136 Ga0207691_11113309 3300025940 Bacteria 657
137 Ga0207661_10003667 3300025944 Bacteria 10702
138 Ga0207661_10188842 3300025944 Unclassified 1805
139 Ga0207661_10254904 3300025944 Bacteria 1561
140 Ga0207661_10645485 3300025944 Bacteria 973
141 Ga0207651_10022310 3300025960 Bacteria 3868
142 Ga0207651_10170121 3300025960 Bacteria 1717
143 Ga0207651_10805203 3300025960 Bacteria 833
144 Ga0207658_10017766 3300025986 Bacteria 4901
145 Ga0207658_10147095 3300025986 Bacteria 1915
146 Ga0207677_10026773 3300026023 Bacteria 3622
147 Ga0207677_10173835 3300026023 Bacteria 1687
148 Ga0207703_10220681 3300026035 Bacteria 1695
149 Ga0207703_10464939 3300026035 Unclassified 1183
150 Ga0207708_10005864 3300026075 Bacteria 9086
151 Ga0207648_10069133 3300026089 Bacteria 3077
152 Ga0207676_10903960 3300026095 Bacteria 866
153 Ga0207675_100014703 3300026118 Bacteria 7300
154 Ga0207683_10026850 3300026121 Bacteria 4973
155 Ga0207683_10144633 3300026121 Unclassified 2144
156 Ga0207428_10013453 3300027907 Bacteria 7148
157 Ga0268266_11249792 3300028379 Bacteria 718
158 Ga0268265_10362727 3300028380 Bacteria 1327
159 Ga0265326_10129734 3300028558 Bacteria 718
160 Ga0265334_10047214 3300028573 Bacteria 1662
161 Ga0265318_10000042 3300028577 Bacteria 130384
162 Ga0265318_10231755 3300028577 Bacteria 674
163 Ga0265336_10005231 3300028666 Bacteria 4811
164 Ga0265338_10005733 3300028800 Bacteria 16059
165 Ga0265338_10095242 3300028800 Bacteria 2446
166 Ga0265330_10000026 3300031235 Bacteria 140332
167 Ga0265332_10000173 3300031238 Bacteria 52835
168 Ga0265328_10003847 3300031239 Bacteria 6599
169 Ga0265328_10011813 3300031239 Bacteria 3483
170 Ga0265320_10000489 3300031240 Bacteria 31041
171 Ga0265320_10018218 3300031240 Unclassified 3873
172 Ga0265325_10147274 3300031241 Bacteria 1116
173 Ga0265339_10007706 3300031249 Bacteria 6927
174 Ga0265339_10083698 3300031249 Bacteria 1682
175 Ga0265331_10000010 3300031250 Bacteria 312076
176 Ga0265316_10001532 3300031344 Bacteria 24744
177 Ga0265313_10000401 3300031595 Bacteria 46604
178 Ga0265313_10082735 3300031595 Bacteria 1454
179 Ga0316579_10000006 3300031691 Bacteria 56681
180 Ga0265314_10000035 3300031711 Bacteria 240629
181 Ga0265314_10000909 3300031711 Bacteria 34935
182 Ga0265342_10000458 3300031712 Bacteria 44443
183 Ga0265342_10001122 3300031712 Bacteria 25629
184 Ga0265342_10007588 3300031712 Bacteria 7920
185 Ga0316578_10085225 3300031728 Bacteria 1883
186 Ga0316583_10004291 3300032133 Bacteria 5083
187 Ga0316583_10004664 3300032133 Bacteria 4892
188 Ga0316583_10226252 3300032133 Bacteria 648
189 Ga0373954_0182103 3300035118 Bacteria 1030
190 Ga0373956_0051940 3300035119 Bacteria 1843
191 Ga0373957_0027462 3300035120 Bacteria 2068
192 Ga0373955_0413868 3300035172 Bacteria 820
193 Ga0373933_0009972 3300035724 Bacteria 5201
194 Ga0373937_0012944 3300036401 Bacteria 7347
195 Ga0373937_0554850 3300036401 Bacteria 1091
196 Ga0316582_0001387 3300036647 Bacteria 10551
197 Ga0316582_0038641 3300036647 Unclassified 2967
198 Ga0316584_0003047 3300036712 Bacteria 10795
199 Ga0395899_0363158 3300037312 Bacteria 966
200 Ga0395900_0210428 3300037418 Bacteria 1964
201 Ga0395900_0357018 3300037418 Bacteria 1434
202 Ga0395905_0005090 3300037471 Bacteria 13522
203 Ga0395905_0555364 3300037471 Bacteria 1049
204 Ga0436364_1159464 3300037853 Bacteria 760
205 Ga0395901_0112344 3300038443 Bacteria 2861
206 Ga0436365_1120500 3300039437 Bacteria 783
207 Ga0451853_1028628 3300041512 Bacteria 705
208 Ga0451577_0069797 3300042876 Bacteria 3134
209 Ga0451577_0295365 3300042876 Bacteria 1468
210 Ga0451577_0718525 3300042876 Bacteria 904
211 Ga0453683_0062824 3300044673 Bacteria 2322
212 Ga0453684_0000119 3300044712 Bacteria 345920
213 Ga0453684_0009300 3300044712 Bacteria 17248
214 Ga0451576_0037207 3300045051 Bacteria 5155
215 Ga0451576_0887920 3300045051 Bacteria 935
216 Ga0451576_2099339 3300045051 Bacteria 581
217 Ga0451576_2405346 3300045051 Bacteria 539
218 Ga0466967_2128382 3300045976 Bacteria 557
219 Ga0495630_0000884 3300046517 Bacteria 21006
220 Ga0495665_0178751 3300046531 Bacteria 1103
221 Ga0495667_0110496 3300046559 Bacteria 1776
222 Ga0495657_0336979 3300046675 Bacteria 894
223 Ga0495624_0025634 3300046690 Bacteria 3870
224 Ga0495581_0098186 3300047315 Bacteria 1701
225 Ga0495676_0218693 3300047321 Bacteria 1314
226 Ga0495680_0327485 3300047322 Bacteria 1071
227 Ga0496101_0480571 3300048904 Bacteria 981
228 Ga0496104_0239745 3300048907 Unclassified 1726
229 Ga0496108_0076411 3300048911 Bacteria 2831
230 Ga0496108_0154713 3300048911 Bacteria 1980
231 Ga0496109_0174206 3300048912 Bacteria 2019
232 Ga0496110_0113016 3300048913 Unclassified 2442
233 Ga0496112_0301106 3300048915 Unclassified 1549
234 Ga0501032_0000037 3300049569 Bacteria 116729
235 Ga0501033_0000009 3300049570 Bacteria 272351
236 Ga0501038_0003214 3300049574 Bacteria 15246
237 Ga0501067_0041887 3300049583 Bacteria 2543
238 Ga0501068_0085414 3300049584 Bacteria 1942
239 Ga0501069_0020067 3300049585 Bacteria 3618
240 Ga0501070_0001519 3300049586 Bacteria 20662
241 Ga0501070_0218057 3300049586 Bacteria 1565
242 Ga0501070_0305063 3300049586 Bacteria 1296
243 Ga0501070_1402453 3300049586 Bacteria 531
244 Ga0501071_0425482 3300049587 Bacteria 1015
245 Ga0501073_0000280 3300049589 Bacteria 33667
246 Ga0501073_0141276 3300049589 Bacteria 1668
247 Ga0501073_0236193 3300049589 Bacteria 1262
248 Ga0501074_0270416 3300049590 Bacteria 1208
249 Ga0501074_0437518 3300049590 Bacteria 927
250 Ga0501079_0366843 3300049741 Bacteria 1129
251 Ga0501080_0045721 3300049742 Bacteria 4075
252 Ga0501080_0094824 3300049742 Bacteria 2771
253 Ga0501080_0938238 3300049742 Bacteria 753
254 Ga0501081_0042163 3300049743 Bacteria 3127
255 Ga0501083_0016712 3300049744 Bacteria 5128
256 Ga0501083_0043662 3300049744 Unclassified 3036
257 nmdc:mga08y16_6478_c1 3300050511 Bacteria 12286
258 Ga0495601_0716628 3300053077 Bacteria 638
259 Ga0501082_0483933 3300060353 Bacteria 1082
260 2911142279 2911138879 Bacteria 5811561
261 Ga0495586_0060464
262 JGI24033J26618_1000084
263 rootH2_10076778
264 rootL2_10058638
265 Ga0065704_10003046
266 Ga0065715_10435633
267 Ga0070676_10008811
268 Ga0070683_100002357
269 Ga0070683_100098821
270 Ga0070683_100273759
271 Ga0070683_100354946
272 Ga0070690_100006835
273 Ga0070690_100008710
274 Ga0070670_100780863
275 Ga0070666_10022714
276 Ga0070666_10506688
277 Ga0070682_101154253
278 Ga0068868_100037049
279 Ga0068868_100196125
280 Ga0068868_100645993
281 Ga0070689_100019679
282 Ga0070689_100030209
283 Ga0070689_100092405
284 Ga0070691_10042555
285 Ga0070687_100087207
286 Ga0070687_100268686
287 Ga0070687_100662324
288 Ga0070687_100664631
289 Ga0070661_100014195
290 Ga0070692_10786292
291 Ga0070668_100008719
292 Ga0070669_100001756
293 Ga0070675_100052164
294 Ga0070675_100054665
295 Ga0070675_100070956
296 Ga0070675_100261318
297 Ga0070675_100430510
298 Ga0070671_100650852
299 Ga0070671_100773316
300 Ga0070674_100009252
301 Ga0070674_100410731
302 Ga0070673_100010017
303 Ga0070673_100045657
304 Ga0070673_100273164
305 Ga0070673_100536001
306 Ga0070688_100007395
307 Ga0070688_100075324
308 Ga0070659_100026364
309 Ga0070659_100100574
310 Ga0070667_100228086
311 Ga0070667_100238809
312 Ga0070701_10075729
313 Ga0070705_100514554
314 Ga0070700_100004122
315 Ga0070694_100031181
316 Ga0070678_100011089
317 Ga0070678_100120493
318 Ga0070662_100086093
319 Ga0068867_100007590
320 Ga0070685_10021675
321 Ga0070685_10069290
322 Ga0070685_10245976
323 Ga0070706_101370724
324 Ga0070707_100343287
325 Ga0070684_100010695
326 Ga0068853_100082401
327 Ga0068853_100543324
328 Ga0070672_100049782
329 Ga0070672_100737347
330 Ga0070672_100761765
331 Ga0070686_100031258
332 Ga0068855_100726013
333 Ga0070664_100352950
334 Ga0068856_100326442
335 Ga0070702_100904139
336 Ga0068859_100135900
337 Ga0068864_100183769
338 Ga0068864_100664711
339 Ga0068866_10002829
340 Ga0068861_100016577
341 Ga0068858_100372917
342 Ga0068862_100480396
343 Ga0070717_10908623
344 Ga0068871_100767618
345 Ga0075428_101293680
346 Ga0068865_100024414
347 Ga0097620_100135898
348 Ga0111539_10019153
349 Ga0105243_10085772
350 Ga0105249_10971409
351 Ga0105246_11465650
352 Ga0157369_10368226
353 Ga0157369_10720674
354 Ga0157374_10187900
355 Ga0157378_10018588
356 Ga0157378_10071133
357 Ga0163162_10474786
358 Ga0157372_10169241
359 Ga0157372_10237565
360 Ga0157372_10735741
361 Ga0157375_10003016
362 Ga0157376_10556206
363 Ga0197907_11139451
364 Ga0206352_10238752
365 Ga0206353_11805911
366 Ga0224712_10546051
367 Ga0207642_10086871
368 Ga0207680_10033505
369 Ga0207699_10387638
370 Ga0207645_10010053
371 Ga0207645_10497525
372 Ga0207684_11020245
373 Ga0207663_10562632
374 Ga0207662_10023068
375 Ga0207662_10074610
376 Ga0207649_10052017
377 Ga0207646_10534543
378 Ga0207681_10006508
379 Ga0207681_10401922
380 Ga0207694_11160233
381 Ga0207650_11426948
382 Ga0207659_10224919
383 Ga0207659_10258163
384 Ga0207659_10357662
385 Ga0207659_10792584
386 Ga0207690_10039135
387 Ga0207706_10143413
388 Ga0207670_10204184
389 Ga0207670_10530657
390 Ga0207669_10088000
391 Ga0207669_10359753
392 Ga0207704_10032422
393 Ga0207691_10029290
394 Ga0207691_10226370
395 Ga0207691_10818194
396 Ga0207691_11113309
397 Ga0207661_10003667
398 Ga0207661_10188842
399 Ga0207661_10254904
400 Ga0207661_10645485
401 Ga0207651_10022310
402 Ga0207651_10170121
403 Ga0207651_10805203
404 Ga0207658_10017766
405 Ga0207658_10147095
406 Ga0207677_10026773
407 Ga0207677_10173835
408 Ga0207703_10220681
409 Ga0207703_10464939
410 Ga0207708_10005864
411 Ga0207648_10069133
412 Ga0207676_10903960
413 Ga0207675_100014703
414 Ga0207683_10026850
415 Ga0207683_10144633
416 Ga0207428_10013453
417 Ga0268266_11249792
418 Ga0268265_10362727
419 Ga0265326_10129734
420 Ga0265334_10047214
421 Ga0265318_10000042
422 Ga0265318_10231755
423 Ga0265336_10005231
424 Ga0265338_10005733
425 Ga0265338_10095242
426 Ga0265330_10000026
427 Ga0265332_10000173
428 Ga0265328_10003847
429 Ga0265328_10011813
430 Ga0265320_10000489
431 Ga0265320_10018218
432 Ga0265325_10147274
433 Ga0265339_10007706
434 Ga0265339_10083698
435 Ga0265331_10000010
436 Ga0265316_10001532
437 Ga0265313_10000401
438 Ga0265313_10082735
439 Ga0316579_10000006
440 Ga0265314_10000035
441 Ga0265314_10000909
442 Ga0265342_10000458
443 Ga0265342_10001122
444 Ga0265342_10007588
445 Ga0316578_10085225
446 Ga0316583_10004291
447 Ga0316583_10004664
448 Ga0316583_10226252
449 Ga0373954_0182103
450 Ga0373956_0051940
451 Ga0373957_0027462
452 Ga0373955_0413868
453 Ga0373933_0009972
454 Ga0373937_0012944
455 Ga0373937_0554850
456 Ga0316582_0001387
457 Ga0316582_0038641
458 Ga0316584_0003047
459 Ga0395899_0363158
460 Ga0395900_0210428
461 Ga0395900_0357018
462 Ga0395905_0005090
463 Ga0395905_0555364
464 Ga0436364_1159464
465 Ga0395901_0112344
466 Ga0436365_1120500
467 Ga0451853_1028628
468 Ga0451577_0069797
469 Ga0451577_0295365
470 Ga0451577_0718525
471 Ga0453683_0062824
472 Ga0453684_0000119
473 Ga0453684_0009300
474 Ga0451576_0037207
475 Ga0451576_0887920
476 Ga0451576_2099339
477 Ga0451576_2405346
478 Ga0466967_2128382
479 Ga0495630_0000884
480 Ga0495665_0178751
481 Ga0495667_0110496
482 Ga0495657_0336979
483 Ga0495624_0025634
484 Ga0495581_0098186
485 Ga0495676_0218693
486 Ga0495680_0327485
487 Ga0496101_0480571
488 Ga0496104_0239745
489 Ga0496108_0076411
490 Ga0496108_0154713
491 Ga0496109_0174206
492 Ga0496110_0113016
493 Ga0496112_0301106
494 Ga0501032_0000037
495 Ga0501033_0000009
496 Ga0501038_0003214
497 Ga0501067_0041887
498 Ga0501068_0085414
499 Ga0501069_0020067
500 Ga0501070_0001519
501 Ga0501070_0218057
502 Ga0501070_0305063
503 Ga0501070_1402453
504 Ga0501071_0425482
505 Ga0501073_0000280
506 Ga0501073_0141276
507 Ga0501073_0236193
508 Ga0501074_0270416
509 Ga0501074_0437518
510 Ga0501079_0366843
511 Ga0501080_0045721
512 Ga0501080_0094824
513 Ga0501080_0938238
514 Ga0501081_0042163
515 Ga0501083_0016712
516 Ga0501083_0043662
517 nmdc:mga08y16_6478_c1
518 Ga0495601_0716628
519 Ga0501082_0483933
520 2911142279

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00254

FKBP_C

FKBP-type peptidyl-prolyl cis-trans isomerase

21

158

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4odk-assembly1.cif.gz_A structure of slyd from thermus thermophilus in complex with t1 peptide 0.9442 1 153
5i7p-assembly1.cif.gz_A crystal structure of fkbp12-if(slyd), a chimeric protein of human fkbp12 and the insert in flap domain of ecoli slyd 0.937 1 137
3luo-assembly1.cif.gz_A crystal structure and functional characterization of the thermophilic prolyl isomerase and chaperone slyd 0.9155 1 152
4odk-assembly1.cif.gz_A structure of slyd from thermus thermophilus in complex with t1 peptide 0.9145 1 153
3luo-assembly1.cif.gz_A crystal structure and functional characterization of the thermophilic prolyl isomerase and chaperone slyd 0.9095 1 152
ID Description Score Start End Superfamily
2k8iA01 Alpha Beta;Roll;Chitinase A; domain 3; 0.9216 1 152 3.10.50.40
4dt4A01 Alpha Beta;Roll;Chitinase A; domain 3; 0.9167 8 135 3.10.50.40
3luoA00 Alpha Beta;Roll;Chitinase A; domain 3; 0.9155 1 152 3.10.50.40
2k8iA01 Alpha Beta;Roll;Chitinase A; domain 3; 0.9128 1 152 3.10.50.40
3luoA00 Alpha Beta;Roll;Chitinase A; domain 3; 0.9095 1 152 3.10.50.40
ID Description Score Start End GO Terms
AF-B7S2H0-F1-model_v4 Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8) 0.9788 1 150 GO:0005737
GO:0042026
GO:0140839
GO:0140840
AF-D2EGF6-F1-model_v4 Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8) 0.9635 1 137 GO:0005737
GO:0016020
GO:0042026
GO:0140839
GO:0140840
AF-A0A1L5QXA4-F1-model_v4 deleted 0.9613 2 153
AF-A0A2F0AS46-F1-model_v4 Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8) 0.9587 1 154 GO:0005737
GO:0042026
GO:0140839
GO:0140840
AF-A0A1V5FLV8-F1-model_v4 Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8) 0.9578 1 137 GO:0005737
GO:0042026
GO:0140839
GO:0140840

Map