F369649

General Info

Members Datasets Scaffolds Average Seq Length
260 186 242 285

Family's Representative Sequence

Representative Sequence 3300031456|Ga0307513_10054344|Ga0307513_100543443
Length 301
Sequence MADIPRLNGIIGAWEQGKAAFAAFATPDKPMAIAFSTTNYDGLVFEMEHNPWDITGLQDALQYLLNRQQIVQSGSLAPAVTPLVRIPANGEEKNQWLAKQALDRGAYGIIWPHVTSVEQAMNAVSSSRYPRPKMAPLYEPAGCRGDAPTAACRYWGISQQDYYRKADVWPHNPNGEILTMLMIESVAGIANLRDILQNVPGIGAILIGEGDLSQDLGVPRQYDHPLVREAMAEIVACCKAFNVHVGHPHVTGSNVERVLSEGFSFLMVAPVRSYADLDKGRKLNGRDGTATTAPKGPQASY

Samples

Sample ID Description Type Environment
1 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
2 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
4 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
5 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
6 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
7 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
8 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
9 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
10 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
11 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
12 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
13 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
14 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
15 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
16 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
17 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
18 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
19 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
20 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
23 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
26 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
29 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
40 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
63 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
65 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
79 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
80 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
81 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
82 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
83 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
84 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
85 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
86 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
87 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
88 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
89 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
90 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
91 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
92 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
93 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
94 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
95 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
96 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
97 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
98 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
99 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
100 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
101 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
102 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
103 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
104 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
105 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
106 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
107 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
108 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
109 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
110 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
111 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
112 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
113 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
114 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
115 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
116 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
117 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
118 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
119 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
120 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
121 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
122 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
123 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
124 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
125 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
126 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
127 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
128 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
129 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
130 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
131 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
132 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
133 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
134 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
135 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
136 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
137 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
138 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
139 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
140 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
141 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
142 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
143 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
144 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
145 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
146 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
147 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
148 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
149 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
150 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
151 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
152 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
153 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
154 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
155 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
156 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
164 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
165 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
166 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
167 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
168 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
169 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
170 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
171 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
172 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
173 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
174 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
175 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
176 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
177 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
178 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
179 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
180 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
181 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
182 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
183 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
184 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
185 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
186 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane

Type Distribution

Type Percentage (%)
Metagenomes 93.46
Metatranscriptomes 0
Isolates 6.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.77
Nodule 0.38
Rhizoplane 2.69
Rhizosphere 77.69
Stem 0
Stem Tuber 0
Unclassified 8.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10001009 3300001979 Bacteria 12587
2 JGI24740J21852_10025193 3300001979 Bacteria 2009
3 JGI24739J22299_10004313 3300001989 Bacteria 5452
4 JGI24735J21928_10013247 3300002067 Bacteria 2595
5 JGI24738J21930_10001937 3300002075 Bacteria 5577
6 JGI25160J50197_1000017 3300003354 Bacteria 246175
7 Ga0055530_10000139 3300003791 Bacteria 64639
8 Ga0055540_1000013 3300003792 Bacteria 262274
9 Ga0055531_10004230 3300003794 Bacteria 8832
10 Ga0065165_1000975 3300005262 Bacteria 35655
11 Ga0065704_10084288 3300005289 Bacteria 3354
12 Ga0065707_10104646 3300005295 Bacteria 2684
13 Ga0070658_10545863 3300005327 Bacteria 1003
14 Ga0070690_100020042 3300005330 Bacteria 4070
15 Ga0070680_100053707 3300005336 Bacteria 3289
16 Ga0070675_100328505 3300005354 Bacteria 1352
17 Ga0070714_100435498 3300005435 Bacteria 1244
18 Ga0070681_10001094 3300005458 Bacteria 23147
19 Ga0070698_100283884 3300005471 Unclassified 1587
20 Ga0070699_100006356 3300005518 Bacteria 10301
21 Ga0070699_100075809 3300005518 Bacteria 2927
22 Ga0070679_100015424 3300005530 Bacteria 7344
23 Ga0070697_100338083 3300005536 Bacteria 1299
24 Ga0070695_100394415 3300005545 Bacteria 1048
25 Ga0070664_100047966 3300005564 Bacteria 3610
26 Ga0075362_10088642 3300006177 Unclassified 1433
27 Ga0075369_10034115 3300006186 Bacteria 2159
28 Ga0075366_10039036 3300006195 Bacteria 2805
29 Ga0097621_100367268 3300006237 Bacteria 1283
30 Ga0075370_10163049 3300006353 Bacteria 1309
31 Ga0068871_100099252 3300006358 Bacteria 2437
32 Ga0075430_100170198 3300006846 Unclassified 1812
33 Ga0075433_10013690 3300006852 Bacteria 6605
34 Ga0075433_10023871 3300006852 Bacteria 5153
35 Ga0075433_10033203 3300006852 Bacteria 4423
36 Ga0075434_100001205 3300006871 Bacteria 21511
37 Ga0075434_100032197 3300006871 Bacteria 5169
38 Ga0075434_100428640 3300006871 Bacteria 1344
39 Ga0075436_100049360 3300006914 Bacteria 2904
40 Ga0075436_100095815 3300006914 Bacteria 2064
41 Ga0075436_100099062 3300006914 Bacteria 2029
42 Ga0075435_100036313 3300007076 Bacteria 3915
43 Ga0075435_100101687 3300007076 Bacteria 2382
44 Ga0075435_100149794 3300007076 Unclassified 1961
45 Ga0075435_100251814 3300007076 Bacteria 1503
46 Ga0099794_10151802 3300007265 Bacteria 1176
47 Ga0105240_10652607 3300009093 Bacteria 1153
48 Ga0105245_10019302 3300009098 Bacteria 5968
49 Ga0105245_10684863 3300009098 Bacteria 1057
50 Ga0114129_10061432 3300009147 Bacteria 5250
51 Ga0114129_10102792 3300009147 Bacteria 3952
52 Ga0105243_10503515 3300009148 Bacteria 1148
53 Ga0105248_10248095 3300009177 Bacteria 2004
54 Ga0099796_10005750 3300010159 Bacteria 3117
55 Ga0105239_10409117 3300010375 Bacteria 1536
56 Ga0157370_10013159 3300013104 Bacteria 8533
57 Ga0157369_10026172 3300013105 Bacteria 6473
58 Ga0157378_10377024 3300013297 Unclassified 1392
59 Ga0163162_10576302 3300013306 Bacteria 1253
60 Ga0182008_10027438 3300014497 Bacteria 2884
61 Ga0182008_10046539 3300014497 Bacteria 2156
62 Ga0209050_1000340 3300025298 Bacteria 92794
63 Ga0207426_1000107 3300025302 Bacteria 242623
64 Ga0209051_1000022 3300025303 Bacteria 474879
65 Ga0209257_1000030 3300025304 Bacteria 689812
66 Ga0207647_10041029 3300025904 Bacteria 2912
67 Ga0207707_10028353 3300025912 Bacteria 4894
68 Ga0207660_10082209 3300025917 Bacteria 2369
69 Ga0207660_10461638 3300025917 Bacteria 1028
70 Ga0207652_10050751 3300025921 Bacteria 3555
71 Ga0207659_10495807 3300025926 Bacteria 1033
72 Ga0207687_10122517 3300025927 Bacteria 1947
73 Ga0207687_10289986 3300025927 Bacteria 1315
74 Ga0207711_10120827 3300025941 Bacteria 2338
75 Ga0207661_10225375 3300025944 Bacteria 1658
76 Ga0207661_10388052 3300025944 Bacteria 1265
77 Ga0207679_10033037 3300025945 Bacteria 3638
78 Ga0207651_10283817 3300025960 Bacteria 1370
79 Ga0207703_10120377 3300026035 Bacteria 2253
80 Ga0307515_10011366 3300028794 Bacteria 16899
81 Ga0307513_10022996 3300031456 Bacteria 7300
82 Ga0307513_10054344 3300031456 Bacteria 4295
83 Ga0307513_10232798 3300031456 Bacteria 1654
84 Ga0265313_10000072 3300031595 Bacteria 98635
85 Ga0307412_10000066 3300031911 Bacteria 119317
86 Ga0307510_10000012 3300033180 Bacteria 345634
87 Ga0307510_10003470 3300033180 Bacteria 18348
88 Ga0307510_10008774 3300033180 Bacteria 12048
89 Ga0307510_10135389 3300033180 Bacteria 2123
90 Ga0307510_10291283 3300033180 Bacteria 1098
91 Ga0373944_0001779 3300035089 Bacteria 5443
92 Ga0373945_0007284 3300035116 Bacteria 3582
93 Ga0373943_0001656 3300035170 Bacteria 10116
94 Ga0373946_0002058 3300035171 Bacteria 7058
95 Ga0373935_0002491 3300035692 Bacteria 10542
96 Ga0373927_0002947 3300035695 Bacteria 12362
97 Ga0373927_0027087 3300035695 Bacteria 3745
98 Ga0373947_0006903 3300035725 Bacteria 6582
99 Ga0373937_0007404 3300036401 Bacteria 9499
100 Ga0373925_0004363 3300037068 Bacteria 10699
101 Ga0373925_0083573 3300037068 Bacteria 2432
102 Ga0242420_038084 3300038996 Bacteria 912
103 Ga0495592_0006264 3300046454 Bacteria 8853
104 Ga0495592_0023763 3300046454 Bacteria 4662
105 Ga0495591_001345 3300046458 Bacteria 15434
106 Ga0495591_009337 3300046458 Bacteria 3908
107 Ga0495629_0001087 3300046459 Bacteria 21570
108 Ga0495638_0103838 3300046460 Bacteria 1696
109 Ga0495651_0003170 3300046462 Bacteria 12641
110 Ga0495653_0003432 3300046463 Bacteria 12743
111 Ga0495653_0024889 3300046463 Bacteria 4817
112 Ga0495650_0008401 3300046471 Bacteria 6033
113 Ga0495580_0000450 3300046472 Bacteria 34026
114 Ga0495580_0031540 3300046472 Bacteria 3829
115 Ga0495582_0027287 3300046473 Bacteria 3129
116 Ga0495582_0058068 3300046473 Bacteria 2134
117 Ga0495664_0062188 3300046477 Bacteria 2223
118 Ga0495594_0117793 3300046499 Bacteria 1500
119 Ga0495596_0000684 3300046500 Bacteria 21087
120 Ga0495596_0003466 3300046500 Bacteria 7969
121 Ga0495596_0087330 3300046500 Bacteria 1210
122 Ga0495608_0004424 3300046511 Bacteria 10063
123 Ga0495608_0037280 3300046511 Bacteria 3269
124 Ga0495610_0000246 3300046512 Bacteria 56850
125 Ga0495618_0002216 3300046514 Bacteria 12676
126 Ga0495620_0073008 3300046515 Bacteria 1400
127 Ga0495628_0005712 3300046516 Bacteria 10896
128 Ga0495628_0041228 3300046516 Bacteria 3685
129 Ga0495630_0002971 3300046517 Bacteria 11770
130 Ga0495630_0003920 3300046517 Bacteria 10407
131 Ga0495648_0062419 3300046524 Bacteria 2206
132 Ga0495648_0163144 3300046524 Bacteria 1149
133 Ga0495666_0003186 3300046526 Bacteria 8253
134 Ga0495666_0006342 3300046526 Bacteria 5953
135 Ga0495666_0148630 3300046526 Bacteria 1090
136 Ga0495642_0004832 3300046528 Bacteria 5206
137 Ga0495652_0012531 3300046529 Bacteria 7645
138 Ga0495665_0002542 3300046531 Bacteria 9837
139 Ga0495665_0010181 3300046531 Bacteria 5096
140 Ga0495640_0001067 3300046533 Bacteria 21313
141 Ga0495640_0081316 3300046533 Bacteria 2153
142 Ga0495587_0003099 3300046536 Bacteria 11110
143 Ga0495587_0020825 3300046536 Bacteria 4045
144 Ga0495667_0057806 3300046559 Bacteria 2549
145 Ga0495634_0020097 3300046642 Bacteria 4737
146 Ga0495634_0020799 3300046642 Bacteria 4648
147 Ga0495635_0000798 3300046663 Bacteria 20551
148 Ga0495635_0008221 3300046663 Bacteria 7285
149 Ga0495659_0007256 3300046664 Bacteria 3513
150 Ga0495661_0007136 3300046665 Bacteria 7800
151 Ga0495599_0106134 3300046678 Bacteria 1750
152 Ga0495623_0004964 3300046679 Bacteria 8728
153 Ga0495623_0032767 3300046679 Bacteria 3338
154 Ga0495646_0006016 3300046680 Bacteria 7692
155 Ga0495646_0046045 3300046680 Bacteria 2662
156 Ga0495613_0004193 3300046689 Bacteria 10787
157 Ga0495613_0005899 3300046689 Bacteria 9169
158 Ga0495624_0002785 3300046690 Bacteria 13124
159 Ga0495624_0006661 3300046690 Bacteria 8169
160 Ga0495671_0054358 3300046692 Bacteria 1985
161 Ga0495649_0000641 3300046694 Bacteria 28449
162 Ga0495589_0001337 3300046794 Bacteria 14446
163 Ga0495589_0002731 3300046794 Bacteria 9765
164 Ga0495600_0016457 3300046809 Bacteria 4693
165 Ga0495600_0044667 3300046809 Bacteria 2890
166 Ga0495581_0040466 3300047315 Bacteria 2697
167 Ga0495581_0075999 3300047315 Bacteria 1943
168 Ga0495581_0201125 3300047315 Bacteria 1165
169 Ga0495604_0002234 3300047317 Bacteria 15512
170 Ga0495674_0033143 3300047319 Bacteria 4681
171 Ga0495676_0042249 3300047321 Bacteria 3744
172 Ga0495683_0002124 3300047323 Bacteria 12234
173 Ga0495683_0009759 3300047323 Bacteria 5102
174 Ga0495687_027482 3300047443 Bacteria 2661
175 Ga0495675_0001360 3300047444 Bacteria 14807
176 Ga0495675_0006254 3300047444 Bacteria 7285
177 Ga0495679_001620 3300047446 Bacteria 12548
178 Ga0495673_0004136 3300047469 Bacteria 9181
179 Ga0495684_0031406 3300047471 Bacteria 4078
180 Ga0495686_0006476 3300047472 Bacteria 8953
181 Ga0495593_0000697 3300047673 Bacteria 19383
182 Ga0495593_0003728 3300047673 Bacteria 9095
183 Ga0495593_0012698 3300047673 Bacteria 4809
184 Ga0495602_0050888 3300048088 Bacteria 3696
185 Ga0495602_0089940 3300048088 Bacteria 2551
186 Ga0495614_0013117 3300048089 Bacteria 3635
187 Ga0495614_0014568 3300048089 Bacteria 3439
188 Ga0496100_0068526 3300048903 Bacteria 2360
189 Ga0496103_0043146 3300048906 Bacteria 2776
190 Ga0496104_0063859 3300048907 Bacteria 3493
191 Ga0496105_0093408 3300048908 Bacteria 2484
192 Ga0496110_0256973 3300048913 Bacteria 1590
193 Ga0496115_0083409 3300048918 Bacteria 2605
194 Ga0496117_0003493 3300048920 Bacteria 18230
195 Ga0496117_0021582 3300048920 Bacteria 5202
196 Ga0496118_0000583 3300048921 Bacteria 60281
197 Ga0496118_0030416 3300048921 Bacteria 4506
198 Ga0496126_0244662 3300048929 Bacteria 1497
199 Ga0495682_0031446 3300049460 Bacteria 1961
200 Ga0501032_0014537 3300049569 Bacteria 5573
201 Ga0501033_0005549 3300049570 Bacteria 9976
202 Ga0501034_0003088 3300049571 Bacteria 19208
203 Ga0501037_0012685 3300049573 Bacteria 6208
204 Ga0501038_0001944 3300049574 Bacteria 19054
205 Ga0501043_0002765 3300049579 Bacteria 14676
206 Ga0501047_0006609 3300049581 Bacteria 10909
207 Ga0501047_0036669 3300049581 Bacteria 4740
208 Ga0501047_0526316 3300049581 Unclassified 1008
209 Ga0501068_0225218 3300049584 Bacteria 1192
210 Ga0501070_0001522 3300049586 Bacteria 20652
211 Ga0501070_0080952 3300049586 Bacteria 2687
212 Ga0501070_0370429 3300049586 Unclassified 1161
213 Ga0501074_0131951 3300049590 Bacteria 1787
214 Ga0501044_0011624 3300049823 Bacteria 9539
215 Ga0501044_0100448 3300049823 Bacteria 2911
216 nmdc:mga03683_83378_c1 3300050489 Unclassified 1384
217 nmdc:mga03n38_123579_c1 3300050490 Unclassified 1275
218 nmdc:mga0yw44_132212_c1 3300050492 Bacteria 1616
219 nmdc:mga0k408_31136_c1 3300050493 Bacteria 3044
220 nmdc:mga07m45_55752_c1 3300050496 Bacteria 2234
221 nmdc:mga05p37_56985_c1 3300050507 Bacteria 4812
222 nmdc:mga0n895_13566_c1 3300050512 Bacteria 7360
223 nmdc:mga0n895_286335_c1 3300050512 Bacteria 1671
224 nmdc:mga0rr50_28845_c1 3300050513 Bacteria 3906
225 nmdc:mga0rr50_350228_c1 3300050513 Bacteria 1242
226 nmdc:mga0rr50_63921_c1 3300050513 Bacteria 2781
227 nmdc:mga0rr50_751076_c1 3300050513 Unclassified 832
228 nmdc:mga08x19_9200_c1 3300050514 Bacteria 5898
229 nmdc:mga0a205_100696_c1 3300050515 Bacteria 2788
230 nmdc:mga0a205_41308_c1 3300050515 Bacteria 4441
231 nmdc:mga0a205_4242_c2 3300050515 Bacteria 9230
232 nmdc:mga0a205_453714_c1 3300050515 Bacteria 1142
233 nmdc:mga0sz30_7366_c1 3300050516 Bacteria 4122
234 Ga0500583_0096096 3300053092 Unclassified 1446
235 Ga0500651_0096193 3300053093 Bacteria 1820
236 Ga0500641_0007750 3300053096 Bacteria 3829
237 Ga0500595_000505 3300053119 Bacteria 23570
238 Ga0500616_0000185 3300053153 Bacteria 102736
239 Ga0500616_0000301 3300053153 Bacteria 71758
240 Ga0500622_0003024 3300053156 Bacteria 11617
241 Ga0500634_0000044 3300053161 Bacteria 56580
242 Ga0590071_012144 3300059421 Bacteria 2019

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035089 Ga0373944_0001779 Ga0373944_0001779_87_812 240
2 3300050513 nmdc:mga0rr50_751076_c1 nmdc:mga0rr50_751076_c1_19_747 240
3 3300038996 Ga0242420_038084 Ga0242420_038084_136_897 252
4 3300050513 nmdc:mga0rr50_350228_c1 nmdc:mga0rr50_350228_c1_466_1227 252
5 3300049586 Ga0501070_0370429 Ga0501070_0370429_40_819 258
6 3300053153 Ga0500616_0000301 Ga0500616_0000301_5071_5850 258
7 3300006914 Ga0075436_100049360 Ga0075436_1000493603 266
8 3300050514 nmdc:mga08x19_9200_c1 nmdc:mga08x19_9200_c1_2638_3498 266
9 3300046664 Ga0495659_0007256 Ga0495659_0007256_2176_2988 269
10 3300053161 Ga0500634_0000044 Ga0500634_0000044_17956_18813 270
11 3300046499 Ga0495594_0117793 Ga0495594_0117793_11_868 277
12 3300053153 Ga0500616_0000185 Ga0500616_0000185_21386_22258 277
13 3300007265 Ga0099794_10151802 Ga0099794_101518022 280
14 iso_pu_bacteria 2501025502 2501084275 281
15 iso_pu_bacteria 2510917013 2511088641 281
16 iso_pu_bacteria 2515154189 2516018145 281
17 iso_pu_bacteria 2738541296 2738821173 281
18 iso_pu_bacteria 2738541298 2738833656 281
19 iso_pu_bacteria 2738541306 2738877062 281
20 iso_pu_bacteria 2738543002 2739186812 281
21 iso_pu_bacteria 2738543008 2739223656 281
22 iso_pu_bacteria 2751185846 2753569350 281
23 iso_pu_bacteria 2857357740 2857357878 281
24 iso_pu_bacteria 2857357740 2857357890 281
25 iso_pu_bacteria 2883087390 2883090450 281
26 iso_pu_bacteria 2921643360 2921646748 281
27 iso_pu_bacteria 2945934425 2945939468 281
28 iso_pu_bacteria 2990703756 2990706811 281
29 iso_pu_bacteria 641736151 642424732 281
30 3300005289 Ga0065704_10084288 Ga0065704_100842884 282
31 3300005295 Ga0065707_10104646 Ga0065707_101046463 282
32 3300006871 Ga0075434_100001205 Ga0075434_10000120514 282
33 3300006914 Ga0075436_100099062 Ga0075436_1000990622 282
34 3300007076 Ga0075435_100101687 Ga0075435_1001016873 282
35 3300013297 Ga0157378_10377024 Ga0157378_103770241 282
36 3300049569 Ga0501032_0014537 Ga0501032_0014537_60_911 282
37 3300049570 Ga0501033_0005549 Ga0501033_0005549_6991_7842 282
38 3300049571 Ga0501034_0003088 Ga0501034_0003088_4585_5436 282
39 3300049573 Ga0501037_0012685 Ga0501037_0012685_3451_4302 282
40 3300049574 Ga0501038_0001944 Ga0501038_0001944_13757_14608 282
41 3300049579 Ga0501043_0002765 Ga0501043_0002765_11854_12705 282
42 3300049581 Ga0501047_0036669 Ga0501047_0036669_1883_2734 282
43 3300049584 Ga0501068_0225218 Ga0501068_0225218_249_1100 282
44 3300049586 Ga0501070_0001522 Ga0501070_0001522_6065_6916 282
45 3300049823 Ga0501044_0011624 Ga0501044_0011624_8342_9193 282
46 3300050512 nmdc:mga0n895_286335_c1 nmdc:mga0n895_286335_c1_306_1157 282
47 3300050513 nmdc:mga0rr50_28845_c1 nmdc:mga0rr50_28845_c1_2108_2959 282
48 3300050515 nmdc:mga0a205_100696_c1 nmdc:mga0a205_100696_c1_960_1811 282
49 3300053119 Ga0500595_000505 Ga0500595_000505_18230_19117 282
50 iso_pu_bacteria 2510917026 2511169016 282
51 3300049581 Ga0501047_0006609 Ga0501047_0006609_888_1745 283
52 3300059421 Ga0590071_012144 Ga0590071_012144_645_1517 283
53 3300006195 Ga0075366_10039036 Ga0075366_100390363 284
54 3300025944 Ga0207661_10388052 Ga0207661_103880522 284
55 3300033180 Ga0307510_10000012 Ga0307510_1000001293 284
56 3300033180 Ga0307510_10003470 Ga0307510_1000347015 284
57 3300033180 Ga0307510_10008774 Ga0307510_1000877410 284
58 3300048903 Ga0496100_0068526 Ga0496100_0068526_135_989 284
59 3300048907 Ga0496104_0063859 Ga0496104_0063859_343_1197 284
60 3300048908 Ga0496105_0093408 Ga0496105_0093408_1061_1915 284
61 3300048913 Ga0496110_0256973 Ga0496110_0256973_97_951 284
62 3300048918 Ga0496115_0083409 Ga0496115_0083409_1093_1947 284
63 3300049823 Ga0501044_0100448 Ga0501044_0100448_1838_2698 284
64 3300050493 nmdc:mga0k408_31136_c1 nmdc:mga0k408_31136_c1_1976_2833 284
65 3300050496 nmdc:mga07m45_55752_c1 nmdc:mga07m45_55752_c1_1244_2101 284
66 3300050515 nmdc:mga0a205_453714_c1 nmdc:mga0a205_453714_c1_237_1100 284
67 3300053092 Ga0500583_0096096 Ga0500583_0096096_48_905 284
68 3300053096 Ga0500641_0007750 Ga0500641_0007750_2173_3030 284
69 3300001979 JGI24740J21852_10001009 JGI24740J21852_100010091 285
70 3300001979 JGI24740J21852_10025193 JGI24740J21852_100251932 285
71 3300001989 JGI24739J22299_10004313 JGI24739J22299_100043132 285
72 3300002067 JGI24735J21928_10013247 JGI24735J21928_100132473 285
73 3300002075 JGI24738J21930_10001937 JGI24738J21930_100019376 285
74 3300003354 JGI25160J50197_1000017 JGI25160J50197_100001785 285
75 3300003791 Ga0055530_10000139 Ga0055530_1000013948 285
76 3300003792 Ga0055540_1000013 Ga0055540_100001348 285
77 3300003794 Ga0055531_10004230 Ga0055531_100042304 285
78 3300005262 Ga0065165_1000975 Ga0065165_100097516 285
79 3300005327 Ga0070658_10545863 Ga0070658_105458631 285
80 3300005330 Ga0070690_100020042 Ga0070690_1000200424 285
81 3300005336 Ga0070680_100053707 Ga0070680_1000537071 285
82 3300005354 Ga0070675_100328505 Ga0070675_1003285051 285
83 3300005435 Ga0070714_100435498 Ga0070714_1004354981 285
84 3300005458 Ga0070681_10001094 Ga0070681_1000109420 285
85 3300005471 Ga0070698_100283884 Ga0070698_1002838842 285
86 3300005518 Ga0070699_100006356 Ga0070699_1000063562 285
87 3300005518 Ga0070699_100075809 Ga0070699_1000758093 285
88 3300005530 Ga0070679_100015424 Ga0070679_1000154245 285
89 3300005536 Ga0070697_100338083 Ga0070697_1003380831 285
90 3300005545 Ga0070695_100394415 Ga0070695_1003944151 285
91 3300005564 Ga0070664_100047966 Ga0070664_1000479664 285
92 3300006177 Ga0075362_10088642 Ga0075362_100886421 285
93 3300006186 Ga0075369_10034115 Ga0075369_100341152 285
94 3300006237 Ga0097621_100367268 Ga0097621_1003672681 285
95 3300006353 Ga0075370_10163049 Ga0075370_101630491 285
96 3300006358 Ga0068871_100099252 Ga0068871_1000992522 285
97 3300006846 Ga0075430_100170198 Ga0075430_1001701982 285
98 3300006852 Ga0075433_10013690 Ga0075433_100136902 285
99 3300006852 Ga0075433_10023871 Ga0075433_100238712 285
100 3300006852 Ga0075433_10033203 Ga0075433_100332035 285
101 3300006871 Ga0075434_100032197 Ga0075434_1000321975 285
102 3300006871 Ga0075434_100428640 Ga0075434_1004286401 285
103 3300006914 Ga0075436_100095815 Ga0075436_1000958151 285
104 3300007076 Ga0075435_100036313 Ga0075435_1000363134 285
105 3300007076 Ga0075435_100149794 Ga0075435_1001497942 285
106 3300007076 Ga0075435_100251814 Ga0075435_1002518142 285
107 3300009093 Ga0105240_10652607 Ga0105240_106526072 285
108 3300009098 Ga0105245_10019302 Ga0105245_100193025 285
109 3300009098 Ga0105245_10684863 Ga0105245_106848631 285
110 3300009147 Ga0114129_10061432 Ga0114129_100614325 285
111 3300009147 Ga0114129_10102792 Ga0114129_101027922 285
112 3300009148 Ga0105243_10503515 Ga0105243_105035151 285
113 3300009177 Ga0105248_10248095 Ga0105248_102480952 285
114 3300010159 Ga0099796_10005750 Ga0099796_100057502 285
115 3300010375 Ga0105239_10409117 Ga0105239_104091172 285
116 3300013104 Ga0157370_10013159 Ga0157370_100131597 285
117 3300013105 Ga0157369_10026172 Ga0157369_100261722 285
118 3300013306 Ga0163162_10576302 Ga0163162_105763022 285
119 3300014497 Ga0182008_10027438 Ga0182008_100274382 285
120 3300014497 Ga0182008_10046539 Ga0182008_100465392 285
121 3300025298 Ga0209050_1000340 Ga0209050_100034035 285
122 3300025302 Ga0207426_1000107 Ga0207426_100010792 285
123 3300025303 Ga0209051_1000022 Ga0209051_1000022219 285
124 3300025304 Ga0209257_1000030 Ga0209257_1000030417 285
125 3300025904 Ga0207647_10041029 Ga0207647_100410292 285
126 3300025912 Ga0207707_10028353 Ga0207707_100283534 285
127 3300025917 Ga0207660_10082209 Ga0207660_100822091 285
128 3300025917 Ga0207660_10461638 Ga0207660_104616381 285
129 3300025921 Ga0207652_10050751 Ga0207652_100507514 285
130 3300025926 Ga0207659_10495807 Ga0207659_104958072 285
131 3300025927 Ga0207687_10122517 Ga0207687_101225172 285
132 3300025927 Ga0207687_10289986 Ga0207687_102899861 285
133 3300025941 Ga0207711_10120827 Ga0207711_101208272 285
134 3300025944 Ga0207661_10225375 Ga0207661_102253752 285
135 3300025945 Ga0207679_10033037 Ga0207679_100330372 285
136 3300025960 Ga0207651_10283817 Ga0207651_102838172 285
137 3300026035 Ga0207703_10120377 Ga0207703_101203772 285
138 3300028794 Ga0307515_10011366 Ga0307515_1001136611 285
139 3300031456 Ga0307513_10022996 Ga0307513_100229966 285
140 3300031456 Ga0307513_10054344 Ga0307513_100543443 285
141 3300031456 Ga0307513_10232798 Ga0307513_102327982 285
142 3300031595 Ga0265313_10000072 Ga0265313_1000007256 285
143 3300031911 Ga0307412_10000066 Ga0307412_100000664 285
144 3300033180 Ga0307510_10135389 Ga0307510_101353893 285
145 3300033180 Ga0307510_10291283 Ga0307510_102912831 285
146 3300035116 Ga0373945_0007284 Ga0373945_0007284_2237_3100 285
147 3300035170 Ga0373943_0001656 Ga0373943_0001656_4439_5302 285
148 3300035171 Ga0373946_0002058 Ga0373946_0002058_4383_5246 285
149 3300035692 Ga0373935_0002491 Ga0373935_0002491_9572_10435 285
150 3300035695 Ga0373927_0002947 Ga0373927_0002947_6883_7746 285
151 3300035695 Ga0373927_0027087 Ga0373927_0027087_1397_2257 285
152 3300035725 Ga0373947_0006903 Ga0373947_0006903_142_1005 285
153 3300036401 Ga0373937_0007404 Ga0373937_0007404_2384_3244 285
154 3300037068 Ga0373925_0004363 Ga0373925_0004363_2642_3505 285
155 3300037068 Ga0373925_0083573 Ga0373925_0083573_77_937 285
156 3300046454 Ga0495592_0006264 Ga0495592_0006264_1317_2174 285
157 3300046454 Ga0495592_0023763 Ga0495592_0023763_3678_4535 285
158 3300046458 Ga0495591_001345 Ga0495591_001345_6871_7728 285
159 3300046458 Ga0495591_009337 Ga0495591_009337_619_1476 285
160 3300046459 Ga0495629_0001087 Ga0495629_0001087_9012_9869 285
161 3300046460 Ga0495638_0103838 Ga0495638_0103838_374_1231 285
162 3300046462 Ga0495651_0003170 Ga0495651_0003170_5640_6497 285
163 3300046463 Ga0495653_0003432 Ga0495653_0003432_6971_7828 285
164 3300046463 Ga0495653_0024889 Ga0495653_0024889_1557_2414 285
165 3300046471 Ga0495650_0008401 Ga0495650_0008401_2790_3647 285
166 3300046472 Ga0495580_0000450 Ga0495580_0000450_25160_26017 285
167 3300046472 Ga0495580_0031540 Ga0495580_0031540_910_1773 285
168 3300046473 Ga0495582_0027287 Ga0495582_0027287_584_1441 285
169 3300046473 Ga0495582_0058068 Ga0495582_0058068_797_1654 285
170 3300046477 Ga0495664_0062188 Ga0495664_0062188_655_1512 285
171 3300046500 Ga0495596_0000684 Ga0495596_0000684_8178_9035 285
172 3300046500 Ga0495596_0003466 Ga0495596_0003466_1391_2248 285
173 3300046500 Ga0495596_0087330 Ga0495596_0087330_111_968 285
174 3300046511 Ga0495608_0004424 Ga0495608_0004424_2826_3683 285
175 3300046511 Ga0495608_0037280 Ga0495608_0037280_521_1378 285
176 3300046512 Ga0495610_0000246 Ga0495610_0000246_41095_41952 285
177 3300046514 Ga0495618_0002216 Ga0495618_0002216_5780_6637 285
178 3300046515 Ga0495620_0073008 Ga0495620_0073008_53_910 285
179 3300046516 Ga0495628_0005712 Ga0495628_0005712_2586_3443 285
180 3300046516 Ga0495628_0041228 Ga0495628_0041228_19_876 285
181 3300046517 Ga0495630_0002971 Ga0495630_0002971_8205_9062 285
182 3300046517 Ga0495630_0003920 Ga0495630_0003920_5539_6402 285
183 3300046524 Ga0495648_0062419 Ga0495648_0062419_1095_1952 285
184 3300046524 Ga0495648_0163144 Ga0495648_0163144_186_1043 285
185 3300046526 Ga0495666_0003186 Ga0495666_0003186_1437_2294 285
186 3300046526 Ga0495666_0006342 Ga0495666_0006342_1932_2789 285
187 3300046526 Ga0495666_0148630 Ga0495666_0148630_73_936 285
188 3300046528 Ga0495642_0004832 Ga0495642_0004832_262_1119 285
189 3300046529 Ga0495652_0012531 Ga0495652_0012531_707_1564 285
190 3300046531 Ga0495665_0002542 Ga0495665_0002542_213_1070 285
191 3300046531 Ga0495665_0010181 Ga0495665_0010181_4139_4996 285
192 3300046533 Ga0495640_0001067 Ga0495640_0001067_4838_5695 285
193 3300046533 Ga0495640_0081316 Ga0495640_0081316_979_1836 285
194 3300046536 Ga0495587_0003099 Ga0495587_0003099_2298_3155 285
195 3300046536 Ga0495587_0020825 Ga0495587_0020825_3003_3860 285
196 3300046559 Ga0495667_0057806 Ga0495667_0057806_879_1736 285
197 3300046642 Ga0495634_0020097 Ga0495634_0020097_3134_3997 285
198 3300046642 Ga0495634_0020799 Ga0495634_0020799_2627_3484 285
199 3300046663 Ga0495635_0000798 Ga0495635_0000798_17233_18090 285
200 3300046663 Ga0495635_0008221 Ga0495635_0008221_361_1218 285
201 3300046665 Ga0495661_0007136 Ga0495661_0007136_5220_6077 285
202 3300046678 Ga0495599_0106134 Ga0495599_0106134_526_1383 285
203 3300046679 Ga0495623_0004964 Ga0495623_0004964_7450_8307 285
204 3300046679 Ga0495623_0032767 Ga0495623_0032767_277_1134 285
205 3300046680 Ga0495646_0006016 Ga0495646_0006016_6107_6964 285
206 3300046680 Ga0495646_0046045 Ga0495646_0046045_259_1122 285
207 3300046689 Ga0495613_0004193 Ga0495613_0004193_8998_9855 285
208 3300046689 Ga0495613_0005899 Ga0495613_0005899_6487_7344 285
209 3300046690 Ga0495624_0002785 Ga0495624_0002785_9122_9985 285
210 3300046690 Ga0495624_0006661 Ga0495624_0006661_1318_2175 285
211 3300046692 Ga0495671_0054358 Ga0495671_0054358_318_1175 285
212 3300046694 Ga0495649_0000641 Ga0495649_0000641_15536_16393 285
213 3300046794 Ga0495589_0001337 Ga0495589_0001337_4606_5463 285
214 3300046794 Ga0495589_0002731 Ga0495589_0002731_3185_4042 285
215 3300046809 Ga0495600_0016457 Ga0495600_0016457_275_1132 285
216 3300046809 Ga0495600_0044667 Ga0495600_0044667_216_1073 285
217 3300047315 Ga0495581_0040466 Ga0495581_0040466_920_1783 285
218 3300047315 Ga0495581_0075999 Ga0495581_0075999_1014_1871 285
219 3300047315 Ga0495581_0201125 Ga0495581_0201125_271_1128 285
220 3300047317 Ga0495604_0002234 Ga0495604_0002234_2379_3236 285
221 3300047319 Ga0495674_0033143 Ga0495674_0033143_2268_3125 285
222 3300047321 Ga0495676_0042249 Ga0495676_0042249_981_1838 285
223 3300047323 Ga0495683_0002124 Ga0495683_0002124_2200_3057 285
224 3300047323 Ga0495683_0009759 Ga0495683_0009759_135_992 285
225 3300047443 Ga0495687_027482 Ga0495687_027482_715_1572 285
226 3300047444 Ga0495675_0001360 Ga0495675_0001360_7353_8210 285
227 3300047444 Ga0495675_0006254 Ga0495675_0006254_6068_6925 285
228 3300047446 Ga0495679_001620 Ga0495679_001620_3335_4192 285
229 3300047469 Ga0495673_0004136 Ga0495673_0004136_1543_2400 285
230 3300047471 Ga0495684_0031406 Ga0495684_0031406_1913_2776 285
231 3300047472 Ga0495686_0006476 Ga0495686_0006476_121_978 285
232 3300047673 Ga0495593_0000697 Ga0495593_0000697_4182_5039 285
233 3300047673 Ga0495593_0003728 Ga0495593_0003728_6347_7204 285
234 3300047673 Ga0495593_0012698 Ga0495593_0012698_2107_2970 285
235 3300048088 Ga0495602_0050888 Ga0495602_0050888_2251_3108 285
236 3300048088 Ga0495602_0089940 Ga0495602_0089940_530_1387 285
237 3300048089 Ga0495614_0013117 Ga0495614_0013117_2188_3045 285
238 3300048089 Ga0495614_0014568 Ga0495614_0014568_2229_3086 285
239 3300048906 Ga0496103_0043146 Ga0496103_0043146_565_1422 285
240 3300048920 Ga0496117_0003493 Ga0496117_0003493_11987_12844 285
241 3300048920 Ga0496117_0021582 Ga0496117_0021582_427_1284 285
242 3300048921 Ga0496118_0000583 Ga0496118_0000583_33899_34756 285
243 3300048921 Ga0496118_0030416 Ga0496118_0030416_480_1337 285
244 3300048929 Ga0496126_0244662 Ga0496126_0244662_384_1244 285
245 3300049460 Ga0495682_0031446 Ga0495682_0031446_42_899 285
246 3300049581 Ga0501047_0526316 Ga0501047_0526316_86_946 285
247 3300049586 Ga0501070_0080952 Ga0501070_0080952_437_1297 285
248 3300049590 Ga0501074_0131951 Ga0501074_0131951_570_1430 285
249 3300050489 nmdc:mga03683_83378_c1 nmdc:mga03683_83378_c1_475_1341 285
250 3300050490 nmdc:mga03n38_123579_c1 nmdc:mga03n38_123579_c1_268_1134 285
251 3300050492 nmdc:mga0yw44_132212_c1 nmdc:mga0yw44_132212_c1_246_1109 285
252 3300050507 nmdc:mga05p37_56985_c1 nmdc:mga05p37_56985_c1_839_1711 285
253 3300050512 nmdc:mga0n895_13566_c1 nmdc:mga0n895_13566_c1_4352_5218 285
254 3300050513 nmdc:mga0rr50_63921_c1 nmdc:mga0rr50_63921_c1_511_1374 285
255 3300050515 nmdc:mga0a205_41308_c1 nmdc:mga0a205_41308_c1_2450_3313 285
256 3300050515 nmdc:mga0a205_4242_c2 nmdc:mga0a205_4242_c2_1185_2051 285
257 3300050516 nmdc:mga0sz30_7366_c1 nmdc:mga0sz30_7366_c1_2624_3490 285
258 3300053093 Ga0500651_0096193 Ga0500651_0096193_89_994 285
259 3300053153 Ga0500616_0000301 Ga0500616_0000301_25236_26096 285
260 3300053156 Ga0500622_0003024 Ga0500622_0003024_5740_6606 285

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03328

HpcH_HpaI

HpcH/HpaI aldolase/citrate lyase family

21

270

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1dxe-assembly1.cif.gz_A 2-dehydro-3-deoxy-galactarate aldolase from escherichia coli 0.8658 7 285
4mf4-assembly1.cif.gz_E crystal structure of a hpch/hpal aldolase/citrate lyase family protein from burkholderia cenocepacia j2315 0.8563 7 284
7v8t-assembly1.cif.gz_F crystal structure of class ii pyruvate aldolase from pseudomonas aeruginosa. 0.8537 7 284
4b5w-assembly1.cif.gz_C crystal structures of divalent metal dependent pyruvate aldolase r70a mutant, hpai, in complex with pyruvate 0.8501 7 284
7et9-assembly1.cif.gz_A crystal structure of abhpai-zn-pyruvate complex, class ii aldolase, hpai from acinetobacter baumannii 0.8497 1 285
ID Description Score Start End Superfamily
4mf4F00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.8608 7 284 3.20.20.60
1dxfA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.8573 7 284 3.20.20.60
4mf4F00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.8451 7 284 3.20.20.60
3qz6A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.8361 9 284 3.20.20.60
6r62A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.8354 7 283 3.20.20.60
ID Description Score Start End GO Terms
AF-A0A6I1QSJ3-F1-model_v4 Aldolase 0.993 4 202 GO:0005737
GO:0016832
AF-A0A519YD42-F1-model_v4 Aldolase 0.988 5 226 GO:0005737
GO:0016832
AF-A0A535XEZ1-F1-model_v4 Aldolase 0.9813 4 124 GO:0005737
GO:0016832
AF-W4L220-F1-model_v4 HpcH/HpaI aldolase/citrate lyase domain-containing protein 0.9768 4 248 GO:0005737
GO:0016832
AF-A0A7C7CRH0-F1-model_v4 Aldolase 0.976 1 178 GO:0005737
GO:0016832

Feature Viewer

pLDDT pTM Quality
91.44 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map