F369320
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 260 | 159 | 256 | 128 |
Family's Representative Sequence
| Representative Sequence | 3300005337|Ga0070682_100169988|Ga0070682_1001699882 |
| Length | 127 |
| Sequence | VIPEDLRYSSDHEWLRTTGETTVQLGITDYAQDSLGDIVFVQMPEPGTTVSPGDAIGEVESTKSVSDIFAPVTGTVIRRNDALDAQPELINSDPYGDGWMIEIELADPAELEDLLDAAGYAEVAGES |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 2 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 3 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 4 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
| 5 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 6 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 7 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 8 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 9 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 10 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 11 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 12 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 13 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 14 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 15 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 38 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 39 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 40 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 41 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 42 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 43 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 44 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 45 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 47 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 48 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 49 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 68 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 69 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 70 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 71 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 109 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 110 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 111 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 112 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 113 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 114 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 115 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 116 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 117 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 118 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 119 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 120 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 121 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 122 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 123 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 124 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 125 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 126 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 127 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 128 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 129 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 130 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 144 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 145 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 146 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 147 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 148 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 149 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 150 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 151 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 152 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 153 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 154 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 155 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 156 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 157 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 158 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 159 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.69 |
| Metatranscriptomes | 0.77 |
| Isolates | 1.54 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.15 |
| Nodule | 0 |
| Rhizoplane | 4.23 |
| Rhizosphere | 86.15 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.46 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1006662 | 3300001904 | Bacteria | 1945 |
| 2 | JGI24740J21852_10007035 | 3300001979 | Bacteria | 4612 |
| 3 | JGI24737J22298_10002762 | 3300001990 | Bacteria | 6208 |
| 4 | JGI24743J22301_10002360 | 3300001991 | Bacteria | 2827 |
| 5 | JGI24744J21845_10000632 | 3300002077 | Bacteria | 6424 |
| 6 | JGI25157J39369_1024721 | 3300002741 | Bacteria | 703 |
| 7 | JGI25165J46597_1008756 | 3300003214 | Bacteria | 1565 |
| 8 | rootH1_10047048 | 3300003316 | Bacteria | 2968 |
| 9 | rootH2_10004419 | 3300003320 | Bacteria | 46013 |
| 10 | rootH2_10007681 | 3300003320 | Bacteria | 7340 |
| 11 | rootH1_10126212 | 3300003323 | Bacteria | 7317 |
| 12 | Ga0065714_10117956 | 3300005288 | Bacteria | 1372 |
| 13 | Ga0065714_10410738 | 3300005288 | Bacteria | 555 |
| 14 | Ga0070658_10000059 | 3300005327 | Bacteria | 112781 |
| 15 | Ga0070658_10043465 | 3300005327 | Bacteria | 3629 |
| 16 | Ga0070658_10440833 | 3300005327 | Bacteria | 1122 |
| 17 | Ga0070676_10001447 | 3300005328 | Bacteria | 12016 |
| 18 | Ga0070683_100111303 | 3300005329 | Bacteria | 2583 |
| 19 | Ga0068869_100297423 | 3300005334 | Bacteria | 1302 |
| 20 | Ga0070680_100584251 | 3300005336 | Bacteria | 958 |
| 21 | Ga0070682_100169988 | 3300005337 | Bacteria | 1514 |
| 22 | Ga0068868_100072997 | 3300005338 | Bacteria | 2739 |
| 23 | Ga0070660_100010256 | 3300005339 | Bacteria | 6613 |
| 24 | Ga0070660_100033637 | 3300005339 | Bacteria | 3865 |
| 25 | Ga0070660_100520062 | 3300005339 | Bacteria | 991 |
| 26 | Ga0070671_100005639 | 3300005355 | Bacteria | 9963 |
| 27 | Ga0070674_100389189 | 3300005356 | Bacteria | 1136 |
| 28 | Ga0070673_100006097 | 3300005364 | Bacteria | 7811 |
| 29 | Ga0070673_100158984 | 3300005364 | Bacteria | 1920 |
| 30 | Ga0070673_100200833 | 3300005364 | Bacteria | 1717 |
| 31 | Ga0070688_100826137 | 3300005365 | Bacteria | 726 |
| 32 | Ga0070659_100013256 | 3300005366 | Bacteria | 6131 |
| 33 | Ga0070659_100060870 | 3300005366 | Bacteria | 2983 |
| 34 | Ga0070714_101880044 | 3300005435 | Bacteria | 584 |
| 35 | Ga0070663_100031338 | 3300005455 | Bacteria | 3654 |
| 36 | Ga0070678_100004052 | 3300005456 | Bacteria | 8248 |
| 37 | Ga0070662_100000043 | 3300005457 | Bacteria | 70660 |
| 38 | Ga0068867_100000970 | 3300005459 | Bacteria | 19578 |
| 39 | Ga0068853_100002294 | 3300005539 | Bacteria | 14298 |
| 40 | Ga0068853_100012760 | 3300005539 | Bacteria | 6841 |
| 41 | Ga0068853_100092702 | 3300005539 | Bacteria | 2658 |
| 42 | Ga0070672_100845916 | 3300005543 | Bacteria | 806 |
| 43 | Ga0070665_100000017 | 3300005548 | Bacteria | 448013 |
| 44 | Ga0068855_100000958 | 3300005563 | Bacteria | 35849 |
| 45 | Ga0068855_100011557 | 3300005563 | Bacteria | 10662 |
| 46 | Ga0068855_100093308 | 3300005563 | Bacteria | 3471 |
| 47 | Ga0068855_101465804 | 3300005563 | Bacteria | 702 |
| 48 | Ga0068857_100025248 | 3300005577 | Bacteria | 5233 |
| 49 | Ga0068854_101567865 | 3300005578 | Bacteria | 599 |
| 50 | Ga0068856_100000650 | 3300005614 | Bacteria | 37676 |
| 51 | Ga0068856_102096852 | 3300005614 | Bacteria | 575 |
| 52 | Ga0068852_100000477 | 3300005616 | Bacteria | 26260 |
| 53 | Ga0068852_100110895 | 3300005616 | Bacteria | 2494 |
| 54 | Ga0068852_101134976 | 3300005616 | Bacteria | 802 |
| 55 | Ga0068852_101408202 | 3300005616 | Unclassified | 719 |
| 56 | Ga0068866_10313802 | 3300005718 | Bacteria | 984 |
| 57 | Ga0068851_10449093 | 3300005834 | Bacteria | 766 |
| 58 | Ga0075366_10004640 | 3300006195 | Bacteria | 7382 |
| 59 | Ga0075366_10054891 | 3300006195 | Bacteria | 2366 |
| 60 | Ga0075366_10410081 | 3300006195 | Bacteria | 834 |
| 61 | Ga0097621_100001356 | 3300006237 | Bacteria | 16859 |
| 62 | Ga0075370_10215461 | 3300006353 | Bacteria | 1134 |
| 63 | Ga0075370_10405558 | 3300006353 | Bacteria | 818 |
| 64 | Ga0068871_100000290 | 3300006358 | Bacteria | 35074 |
| 65 | Ga0068871_100468283 | 3300006358 | Bacteria | 1132 |
| 66 | Ga0068865_100000913 | 3300006881 | Bacteria | 16747 |
| 67 | Ga0105240_10000321 | 3300009093 | Bacteria | 90931 |
| 68 | Ga0105240_10004537 | 3300009093 | Bacteria | 21094 |
| 69 | Ga0105240_10025194 | 3300009093 | Bacteria | 7823 |
| 70 | Ga0105240_10391227 | 3300009093 | Bacteria | 1568 |
| 71 | Ga0105240_12171252 | 3300009093 | Bacteria | 576 |
| 72 | Ga0105243_10134273 | 3300009148 | Bacteria | 2103 |
| 73 | Ga0105241_10001515 | 3300009174 | Bacteria | 17800 |
| 74 | Ga0105241_10001722 | 3300009174 | Bacteria | 16636 |
| 75 | Ga0105241_10010412 | 3300009174 | Bacteria | 6824 |
| 76 | Ga0105241_10111859 | 3300009174 | Bacteria | 2187 |
| 77 | Ga0105241_10279401 | 3300009174 | Bacteria | 1425 |
| 78 | Ga0105242_10560128 | 3300009176 | Bacteria | 1097 |
| 79 | Ga0105237_10000273 | 3300009545 | Bacteria | 72474 |
| 80 | Ga0105237_10001937 | 3300009545 | Bacteria | 26385 |
| 81 | Ga0105237_10088290 | 3300009545 | Bacteria | 3090 |
| 82 | Ga0105237_10713161 | 3300009545 | Bacteria | 1010 |
| 83 | Ga0105238_10014991 | 3300009551 | Bacteria | 7847 |
| 84 | Ga0105238_10355885 | 3300009551 | Bacteria | 1453 |
| 85 | Ga0105239_10000053 | 3300010375 | Bacteria | 163705 |
| 86 | Ga0105239_10000813 | 3300010375 | Bacteria | 44289 |
| 87 | Ga0105239_10012502 | 3300010375 | Bacteria | 9456 |
| 88 | Ga0105239_10126483 | 3300010375 | Bacteria | 2841 |
| 89 | Ga0105239_11962587 | 3300010375 | Bacteria | 679 |
| 90 | Ga0105239_12273259 | 3300010375 | Bacteria | 631 |
| 91 | Ga0157373_10000271 | 3300013100 | Bacteria | 41646 |
| 92 | Ga0157373_10001175 | 3300013100 | Bacteria | 20027 |
| 93 | Ga0157373_10035490 | 3300013100 | Bacteria | 3579 |
| 94 | Ga0157371_10000476 | 3300013102 | Bacteria | 49123 |
| 95 | Ga0157371_10002611 | 3300013102 | Bacteria | 17098 |
| 96 | Ga0157371_10037650 | 3300013102 | Bacteria | 3461 |
| 97 | Ga0157371_10102555 | 3300013102 | Unclassified | 2030 |
| 98 | Ga0157370_10182850 | 3300013104 | Bacteria | 1947 |
| 99 | Ga0157370_10269850 | 3300013104 | Unclassified | 1572 |
| 100 | Ga0157370_10368157 | 3300013104 | Bacteria | 1324 |
| 101 | Ga0157370_10400562 | 3300013104 | Bacteria | 1263 |
| 102 | Ga0157369_10014407 | 3300013105 | Bacteria | 8928 |
| 103 | Ga0157369_10052665 | 3300013105 | Bacteria | 4403 |
| 104 | Ga0157369_10365634 | 3300013105 | Bacteria | 1497 |
| 105 | Ga0157374_10001159 | 3300013296 | Bacteria | 22456 |
| 106 | Ga0157374_10004630 | 3300013296 | Bacteria | 11541 |
| 107 | Ga0157374_10013573 | 3300013296 | Bacteria | 7115 |
| 108 | Ga0157374_10671257 | 3300013296 | Unclassified | 1049 |
| 109 | Ga0157378_10016526 | 3300013297 | Bacteria | 6463 |
| 110 | Ga0157378_10326573 | 3300013297 | Bacteria | 1492 |
| 111 | Ga0163162_10000051 | 3300013306 | Bacteria | 117695 |
| 112 | Ga0157372_10000009 | 3300013307 | Bacteria | 302051 |
| 113 | Ga0157372_10000398 | 3300013307 | Bacteria | 47920 |
| 114 | Ga0157372_10011124 | 3300013307 | Bacteria | 9571 |
| 115 | Ga0157372_10015347 | 3300013307 | Bacteria | 8210 |
| 116 | Ga0157375_10010938 | 3300013308 | Bacteria | 8003 |
| 117 | Ga0157375_10041900 | 3300013308 | Bacteria | 4426 |
| 118 | Ga0157377_10015062 | 3300014745 | Bacteria | 3946 |
| 119 | Ga0157376_10329001 | 3300014969 | Bacteria | 1455 |
| 120 | Ga0206354_10879820 | 3300020081 | Bacteria | 541 |
| 121 | Ga0206353_10489638 | 3300020082 | Bacteria | 540 |
| 122 | Ga0213872_10006142 | 3300021361 | Bacteria | 6068 |
| 123 | Ga0209026_1002934 | 3300025250 | Bacteria | 5959 |
| 124 | Ga0209026_1035060 | 3300025250 | Bacteria | 737 |
| 125 | Ga0209233_1000511 | 3300025261 | Bacteria | 22998 |
| 126 | Ga0207656_10306571 | 3300025321 | Bacteria | 787 |
| 127 | Ga0207642_10026414 | 3300025899 | Bacteria | 2363 |
| 128 | Ga0207647_10000036 | 3300025904 | Bacteria | 98204 |
| 129 | Ga0207647_10000289 | 3300025904 | Bacteria | 41295 |
| 130 | Ga0207645_10000312 | 3300025907 | Bacteria | 40968 |
| 131 | Ga0207705_10000216 | 3300025909 | Bacteria | 57377 |
| 132 | Ga0207705_10037215 | 3300025909 | Bacteria | 3482 |
| 133 | Ga0207654_10008662 | 3300025911 | Bacteria | 5156 |
| 134 | Ga0207654_10021594 | 3300025911 | Bacteria | 3425 |
| 135 | Ga0207654_10062450 | 3300025911 | Bacteria | 2183 |
| 136 | Ga0207695_10000197 | 3300025913 | Bacteria | 168837 |
| 137 | Ga0207695_10024351 | 3300025913 | Bacteria | 6814 |
| 138 | Ga0207695_10025919 | 3300025913 | Bacteria | 6552 |
| 139 | Ga0207695_10085412 | 3300025913 | Bacteria | 3185 |
| 140 | Ga0207695_10318982 | 3300025913 | Bacteria | 1443 |
| 141 | Ga0207695_10516687 | 3300025913 | Bacteria | 1076 |
| 142 | Ga0207671_10005219 | 3300025914 | Bacteria | 12076 |
| 143 | Ga0207671_10008274 | 3300025914 | Bacteria | 8847 |
| 144 | Ga0207671_10010853 | 3300025914 | Bacteria | 7473 |
| 145 | Ga0207671_10070712 | 3300025914 | Bacteria | 2602 |
| 146 | Ga0207671_10433715 | 3300025914 | Bacteria | 1046 |
| 147 | Ga0207660_10150500 | 3300025917 | Bacteria | 1788 |
| 148 | Ga0207657_10019212 | 3300025919 | Bacteria | 6496 |
| 149 | Ga0207652_10164585 | 3300025921 | Bacteria | 1989 |
| 150 | Ga0207694_10005784 | 3300025924 | Bacteria | 9471 |
| 151 | Ga0207694_10416024 | 3300025924 | Bacteria | 1119 |
| 152 | Ga0207694_10563599 | 3300025924 | Bacteria | 957 |
| 153 | Ga0207659_10207312 | 3300025926 | Bacteria | 1569 |
| 154 | Ga0207687_10199985 | 3300025927 | Bacteria | 1561 |
| 155 | Ga0207644_10005093 | 3300025931 | Bacteria | 8584 |
| 156 | Ga0207690_10041384 | 3300025932 | Bacteria | 3019 |
| 157 | Ga0207706_10000125 | 3300025933 | Bacteria | 83075 |
| 158 | Ga0207686_10953260 | 3300025934 | Bacteria | 694 |
| 159 | Ga0207669_11312563 | 3300025937 | Bacteria | 615 |
| 160 | Ga0207704_10000335 | 3300025938 | Bacteria | 21770 |
| 161 | Ga0207691_10616073 | 3300025940 | Bacteria | 918 |
| 162 | Ga0207689_10047810 | 3300025942 | Bacteria | 3530 |
| 163 | Ga0207689_10564100 | 3300025942 | Unclassified | 957 |
| 164 | Ga0207661_10126985 | 3300025944 | Bacteria | 2179 |
| 165 | Ga0207667_10015754 | 3300025949 | Bacteria | 8573 |
| 166 | Ga0207667_10016609 | 3300025949 | Bacteria | 8308 |
| 167 | Ga0207667_10032797 | 3300025949 | Bacteria | 5591 |
| 168 | Ga0207667_10286951 | 3300025949 | Bacteria | 1682 |
| 169 | Ga0207651_10019493 | 3300025960 | Bacteria | 4067 |
| 170 | Ga0207640_10444031 | 3300025981 | Bacteria | 1067 |
| 171 | Ga0207677_10051251 | 3300026023 | Bacteria | 2797 |
| 172 | Ga0207639_10013728 | 3300026041 | Bacteria | 5680 |
| 173 | Ga0207639_10033747 | 3300026041 | Bacteria | 3778 |
| 174 | Ga0207639_10805917 | 3300026041 | Bacteria | 875 |
| 175 | Ga0207678_10546843 | 3300026067 | Bacteria | 1012 |
| 176 | Ga0207702_10000689 | 3300026078 | Bacteria | 36498 |
| 177 | Ga0207648_10000961 | 3300026089 | Bacteria | 32589 |
| 178 | Ga0207676_11326531 | 3300026095 | Bacteria | 715 |
| 179 | Ga0207674_10020634 | 3300026116 | Bacteria | 7115 |
| 180 | Ga0207683_10003092 | 3300026121 | Bacteria | 14541 |
| 181 | Ga0207683_10848535 | 3300026121 | Bacteria | 848 |
| 182 | Ga0207698_10012213 | 3300026142 | Bacteria | 5610 |
| 183 | Ga0207698_10584953 | 3300026142 | Bacteria | 1099 |
| 184 | Ga0207698_10762749 | 3300026142 | Bacteria | 967 |
| 185 | Ga0268266_10000037 | 3300028379 | Bacteria | 342368 |
| 186 | Ga0265316_10804391 | 3300031344 | Bacteria | 659 |
| 187 | Ga0307410_10794007 | 3300031852 | Bacteria | 805 |
| 188 | Ga0307414_10052767 | 3300032004 | Bacteria | 2831 |
| 189 | Ga0307414_10263873 | 3300032004 | Bacteria | 1439 |
| 190 | Ga0307411_12151878 | 3300032005 | Bacteria | 522 |
| 191 | Ga0307415_100700926 | 3300032126 | Bacteria | 914 |
| 192 | Ga0373941_0017107 | 3300035115 | Bacteria | 1981 |
| 193 | Ga0395899_0000327 | 3300037312 | Bacteria | 60343 |
| 194 | Ga0395899_0000999 | 3300037312 | Bacteria | 25966 |
| 195 | Ga0395900_0002624 | 3300037418 | Bacteria | 19622 |
| 196 | Ga0395900_0011000 | 3300037418 | Bacteria | 9252 |
| 197 | Ga0395900_0208101 | 3300037418 | Bacteria | 1976 |
| 198 | Ga0395900_0566767 | 3300037418 | Bacteria | 1079 |
| 199 | Ga0395898_0903480 | 3300037466 | Bacteria | 821 |
| 200 | Ga0395905_0002075 | 3300037471 | Bacteria | 22818 |
| 201 | Ga0395905_0003901 | 3300037471 | Bacteria | 15732 |
| 202 | Ga0395905_1717432 | 3300037471 | Bacteria | 533 |
| 203 | Ga0395901_0008093 | 3300038443 | Bacteria | 10618 |
| 204 | Ga0395901_0020140 | 3300038443 | Bacteria | 6826 |
| 205 | Ga0395901_0243437 | 3300038443 | Bacteria | 1875 |
| 206 | Ga0436361_0504948 | 3300039447 | Bacteria | 6194 |
| 207 | Ga0451795_1552686 | 3300041456 | Bacteria | 1655 |
| 208 | Ga0451802_0013956 | 3300041460 | Unclassified | 511 |
| 209 | Ga0451837_0228915 | 3300041494 | Bacteria | 739 |
| 210 | Ga0439448_0005226 | 3300042005 | Bacteria | 3698 |
| 211 | Ga0466969_0019343 | 3300044656 | Bacteria | 3542 |
| 212 | Ga0466966_0024996 | 3300044684 | Bacteria | 3904 |
| 213 | Ga0466961_0020228 | 3300044693 | Bacteria | 4283 |
| 214 | Ga0453684_0043093 | 3300044712 | Bacteria | 6072 |
| 215 | Ga0466959_0057120 | 3300045049 | Bacteria | 2846 |
| 216 | Ga0451576_0047848 | 3300045051 | Bacteria | 4495 |
| 217 | Ga0495650_0142545 | 3300046471 | Bacteria | 866 |
| 218 | Ga0495650_0187702 | 3300046471 | Bacteria | 724 |
| 219 | Ga0495605_0124943 | 3300046474 | Bacteria | 1164 |
| 220 | Ga0495583_0082908 | 3300046506 | Bacteria | 1391 |
| 221 | Ga0495606_0096258 | 3300046507 | Bacteria | 1811 |
| 222 | Ga0495606_0130948 | 3300046507 | Bacteria | 1491 |
| 223 | Ga0495606_0554310 | 3300046507 | Bacteria | 571 |
| 224 | Ga0495610_0163015 | 3300046512 | Unclassified | 941 |
| 225 | Ga0495642_0102710 | 3300046528 | Bacteria | 1218 |
| 226 | Ga0495668_0125465 | 3300046616 | Bacteria | 1405 |
| 227 | Ga0495625_0034241 | 3300046660 | Bacteria | 3750 |
| 228 | Ga0495625_0365453 | 3300046660 | Bacteria | 909 |
| 229 | Ga0495661_0002324 | 3300046665 | Bacteria | 14664 |
| 230 | Ga0495661_0007355 | 3300046665 | Bacteria | 7674 |
| 231 | Ga0495670_0091880 | 3300046691 | Bacteria | 1554 |
| 232 | Ga0495687_002453 | 3300047443 | Bacteria | 14872 |
| 233 | Ga0495677_0435262 | 3300047445 | Bacteria | 519 |
| 234 | Ga0495686_0103728 | 3300047472 | Bacteria | 1713 |
| 235 | Ga0496100_0201493 | 3300048903 | Bacteria | 1451 |
| 236 | Ga0496101_0572742 | 3300048904 | Bacteria | 893 |
| 237 | Ga0496105_0429075 | 3300048908 | Bacteria | 1046 |
| 238 | Ga0496107_0939608 | 3300048910 | Bacteria | 629 |
| 239 | Ga0496109_1684449 | 3300048912 | Bacteria | 568 |
| 240 | Ga0496113_1572931 | 3300048916 | Bacteria | 506 |
| 241 | Ga0496114_0001454 | 3300048917 | Bacteria | 17979 |
| 242 | Ga0496114_0080554 | 3300048917 | Bacteria | 2750 |
| 243 | Ga0496114_0270220 | 3300048917 | Bacteria | 1498 |
| 244 | Ga0501034_0056019 | 3300049571 | Bacteria | 3968 |
| 245 | Ga0501038_0214221 | 3300049574 | Bacteria | 1540 |
| 246 | Ga0501253_042344 | 3300049683 | Bacteria | 923 |
| 247 | Ga0501241_136855 | 3300049758 | Bacteria | 556 |
| 248 | nmdc:mga0k408_12052_c1 | 3300050493 | Bacteria | 4720 |
| 249 | nmdc:mga0k408_364347_c1 | 3300050493 | Bacteria | 861 |
| 250 | nmdc:mga0k408_429_c1 | 3300050493 | Bacteria | 22975 |
| 251 | nmdc:mga07m45_331920_c1 | 3300050496 | Bacteria | 884 |
| 252 | nmdc:mga07m45_355732_c1 | 3300050496 | Bacteria | 851 |
| 253 | Ga0500635_0009074 | 3300053080 | Bacteria | 2748 |
| 254 | Ga0500643_000477 | 3300053087 | Bacteria | 29325 |
| 255 | Ga0500642_0015275 | 3300053130 | Bacteria | 2882 |
| 256 | Ga0500622_0000719 | 3300053156 | Bacteria | 28939 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2852623160 | 2852626700 | 122 |
| 2 | iso_pu_bacteria | 2884933994 | 2884935130 | 122 |
| 3 | iso_pu_bacteria | 2919437846 | 2919439530 | 122 |
| 4 | iso_pu_bacteria | 2977232053 | 2977234065 | 122 |
| 5 | 3300005614 | Ga0068856_102096852 | Ga0068856_1020968522 | 124 |
| 6 | 3300041460 | Ga0451802_0013956 | Ga0451802_0013956_126_500 | 124 |
| 7 | 3300048917 | Ga0496114_0080554 | Ga0496114_0080554_266_643 | 124 |
| 8 | 3300053087 | Ga0500643_000477 | Ga0500643_000477_20036_20425 | 124 |
| 9 | 3300003316 | rootH1_10047048 | rootH1_100470482 | 125 |
| 10 | 3300005337 | Ga0070682_100169988 | Ga0070682_1001699882 | 125 |
| 11 | 3300005578 | Ga0068854_101567865 | Ga0068854_1015678651 | 125 |
| 12 | 3300005616 | Ga0068852_101134976 | Ga0068852_1011349762 | 125 |
| 13 | 3300010375 | Ga0105239_11962587 | Ga0105239_119625871 | 125 |
| 14 | 3300026121 | Ga0207683_10848535 | Ga0207683_108485352 | 125 |
| 15 | 3300026142 | Ga0207698_10584953 | Ga0207698_105849531 | 125 |
| 16 | 3300041494 | Ga0451837_0228915 | Ga0451837_0228915_86_463 | 125 |
| 17 | 3300048903 | Ga0496100_0201493 | Ga0496100_0201493_593_976 | 125 |
| 18 | 3300048904 | Ga0496101_0572742 | Ga0496101_0572742_277_660 | 125 |
| 19 | 3300048908 | Ga0496105_0429075 | Ga0496105_0429075_346_729 | 125 |
| 20 | 3300048910 | Ga0496107_0939608 | Ga0496107_0939608_54_437 | 125 |
| 21 | 3300048912 | Ga0496109_1684449 | Ga0496109_1684449_158_541 | 125 |
| 22 | 3300048916 | Ga0496113_1572931 | Ga0496113_1572931_23_406 | 125 |
| 23 | 3300048917 | Ga0496114_0001454 | Ga0496114_0001454_2836_3219 | 125 |
| 24 | 3300048917 | Ga0496114_0270220 | Ga0496114_0270220_560_943 | 125 |
| 25 | 3300049571 | Ga0501034_0056019 | Ga0501034_0056019_2467_2844 | 125 |
| 26 | 3300049574 | Ga0501038_0214221 | Ga0501038_0214221_209_586 | 125 |
| 27 | 3300001904 | JGI24736J21556_1006662 | JGI24736J21556_10066622 | 126 |
| 28 | 3300001979 | JGI24740J21852_10007035 | JGI24740J21852_100070354 | 126 |
| 29 | 3300001990 | JGI24737J22298_10002762 | JGI24737J22298_100027625 | 126 |
| 30 | 3300001991 | JGI24743J22301_10002360 | JGI24743J22301_100023605 | 126 |
| 31 | 3300002077 | JGI24744J21845_10000632 | JGI24744J21845_100006322 | 126 |
| 32 | 3300002741 | JGI25157J39369_1024721 | JGI25157J39369_10247212 | 126 |
| 33 | 3300003214 | JGI25165J46597_1008756 | JGI25165J46597_10087561 | 126 |
| 34 | 3300003320 | rootH2_10004419 | rootH2_1000441920 | 126 |
| 35 | 3300003320 | rootH2_10007681 | rootH2_100076816 | 126 |
| 36 | 3300003323 | rootH1_10126212 | rootH1_101262126 | 126 |
| 37 | 3300005288 | Ga0065714_10117956 | Ga0065714_101179562 | 126 |
| 38 | 3300005288 | Ga0065714_10410738 | Ga0065714_104107381 | 126 |
| 39 | 3300005327 | Ga0070658_10000059 | Ga0070658_1000005925 | 126 |
| 40 | 3300005327 | Ga0070658_10043465 | Ga0070658_100434651 | 126 |
| 41 | 3300005327 | Ga0070658_10440833 | Ga0070658_104408332 | 126 |
| 42 | 3300005328 | Ga0070676_10001447 | Ga0070676_100014475 | 126 |
| 43 | 3300005329 | Ga0070683_100111303 | Ga0070683_1001113032 | 126 |
| 44 | 3300005334 | Ga0068869_100297423 | Ga0068869_1002974232 | 126 |
| 45 | 3300005336 | Ga0070680_100584251 | Ga0070680_1005842512 | 126 |
| 46 | 3300005338 | Ga0068868_100072997 | Ga0068868_1000729971 | 126 |
| 47 | 3300005339 | Ga0070660_100010256 | Ga0070660_1000102564 | 126 |
| 48 | 3300005339 | Ga0070660_100033637 | Ga0070660_1000336373 | 126 |
| 49 | 3300005339 | Ga0070660_100520062 | Ga0070660_1005200622 | 126 |
| 50 | 3300005355 | Ga0070671_100005639 | Ga0070671_1000056397 | 126 |
| 51 | 3300005356 | Ga0070674_100389189 | Ga0070674_1003891892 | 126 |
| 52 | 3300005364 | Ga0070673_100006097 | Ga0070673_1000060978 | 126 |
| 53 | 3300005364 | Ga0070673_100158984 | Ga0070673_1001589842 | 126 |
| 54 | 3300005364 | Ga0070673_100200833 | Ga0070673_1002008332 | 126 |
| 55 | 3300005365 | Ga0070688_100826137 | Ga0070688_1008261371 | 126 |
| 56 | 3300005366 | Ga0070659_100013256 | Ga0070659_1000132561 | 126 |
| 57 | 3300005366 | Ga0070659_100060870 | Ga0070659_1000608701 | 126 |
| 58 | 3300005435 | Ga0070714_101880044 | Ga0070714_1018800441 | 126 |
| 59 | 3300005455 | Ga0070663_100031338 | Ga0070663_1000313384 | 126 |
| 60 | 3300005456 | Ga0070678_100004052 | Ga0070678_1000040525 | 126 |
| 61 | 3300005457 | Ga0070662_100000043 | Ga0070662_10000004356 | 126 |
| 62 | 3300005459 | Ga0068867_100000970 | Ga0068867_1000009703 | 126 |
| 63 | 3300005539 | Ga0068853_100002294 | Ga0068853_10000229411 | 126 |
| 64 | 3300005539 | Ga0068853_100012760 | Ga0068853_1000127605 | 126 |
| 65 | 3300005539 | Ga0068853_100092702 | Ga0068853_1000927024 | 126 |
| 66 | 3300005543 | Ga0070672_100845916 | Ga0070672_1008459162 | 126 |
| 67 | 3300005548 | Ga0070665_100000017 | Ga0070665_100000017182 | 126 |
| 68 | 3300005563 | Ga0068855_100000958 | Ga0068855_10000095818 | 126 |
| 69 | 3300005563 | Ga0068855_100011557 | Ga0068855_1000115574 | 126 |
| 70 | 3300005563 | Ga0068855_100093308 | Ga0068855_1000933084 | 126 |
| 71 | 3300005563 | Ga0068855_101465804 | Ga0068855_1014658041 | 126 |
| 72 | 3300005577 | Ga0068857_100025248 | Ga0068857_1000252488 | 126 |
| 73 | 3300005614 | Ga0068856_100000650 | Ga0068856_1000006503 | 126 |
| 74 | 3300005616 | Ga0068852_100000477 | Ga0068852_1000004779 | 126 |
| 75 | 3300005616 | Ga0068852_100110895 | Ga0068852_1001108952 | 126 |
| 76 | 3300005616 | Ga0068852_101408202 | Ga0068852_1014082021 | 126 |
| 77 | 3300005718 | Ga0068866_10313802 | Ga0068866_103138022 | 126 |
| 78 | 3300005834 | Ga0068851_10449093 | Ga0068851_104490932 | 126 |
| 79 | 3300006195 | Ga0075366_10004640 | Ga0075366_1000464010 | 126 |
| 80 | 3300006195 | Ga0075366_10054891 | Ga0075366_100548913 | 126 |
| 81 | 3300006195 | Ga0075366_10410081 | Ga0075366_104100812 | 126 |
| 82 | 3300006237 | Ga0097621_100001356 | Ga0097621_1000013566 | 126 |
| 83 | 3300006353 | Ga0075370_10215461 | Ga0075370_102154612 | 126 |
| 84 | 3300006353 | Ga0075370_10405558 | Ga0075370_104055582 | 126 |
| 85 | 3300006358 | Ga0068871_100000290 | Ga0068871_10000029028 | 126 |
| 86 | 3300006358 | Ga0068871_100468283 | Ga0068871_1004682832 | 126 |
| 87 | 3300006881 | Ga0068865_100000913 | Ga0068865_1000009138 | 126 |
| 88 | 3300009093 | Ga0105240_10000321 | Ga0105240_1000032145 | 126 |
| 89 | 3300009093 | Ga0105240_10004537 | Ga0105240_1000453716 | 126 |
| 90 | 3300009093 | Ga0105240_10025194 | Ga0105240_100251942 | 126 |
| 91 | 3300009093 | Ga0105240_10391227 | Ga0105240_103912271 | 126 |
| 92 | 3300009093 | Ga0105240_12171252 | Ga0105240_121712521 | 126 |
| 93 | 3300009148 | Ga0105243_10134273 | Ga0105243_101342735 | 126 |
| 94 | 3300009174 | Ga0105241_10001515 | Ga0105241_100015154 | 126 |
| 95 | 3300009174 | Ga0105241_10001722 | Ga0105241_100017228 | 126 |
| 96 | 3300009174 | Ga0105241_10010412 | Ga0105241_100104127 | 126 |
| 97 | 3300009174 | Ga0105241_10111859 | Ga0105241_101118593 | 126 |
| 98 | 3300009174 | Ga0105241_10279401 | Ga0105241_102794013 | 126 |
| 99 | 3300009176 | Ga0105242_10560128 | Ga0105242_105601282 | 126 |
| 100 | 3300009545 | Ga0105237_10000273 | Ga0105237_1000027345 | 126 |
| 101 | 3300009545 | Ga0105237_10001937 | Ga0105237_1000193710 | 126 |
| 102 | 3300009545 | Ga0105237_10088290 | Ga0105237_100882902 | 126 |
| 103 | 3300009545 | Ga0105237_10713161 | Ga0105237_107131612 | 126 |
| 104 | 3300009551 | Ga0105238_10014991 | Ga0105238_100149915 | 126 |
| 105 | 3300009551 | Ga0105238_10355885 | Ga0105238_103558853 | 126 |
| 106 | 3300010375 | Ga0105239_10000053 | Ga0105239_1000005335 | 126 |
| 107 | 3300010375 | Ga0105239_10000813 | Ga0105239_1000081335 | 126 |
| 108 | 3300010375 | Ga0105239_10012502 | Ga0105239_100125022 | 126 |
| 109 | 3300010375 | Ga0105239_10126483 | Ga0105239_101264832 | 126 |
| 110 | 3300010375 | Ga0105239_12273259 | Ga0105239_122732591 | 126 |
| 111 | 3300013100 | Ga0157373_10000271 | Ga0157373_1000027110 | 126 |
| 112 | 3300013100 | Ga0157373_10001175 | Ga0157373_100011757 | 126 |
| 113 | 3300013100 | Ga0157373_10035490 | Ga0157373_100354902 | 126 |
| 114 | 3300013102 | Ga0157371_10000476 | Ga0157371_100004767 | 126 |
| 115 | 3300013102 | Ga0157371_10002611 | Ga0157371_1000261112 | 126 |
| 116 | 3300013102 | Ga0157371_10037650 | Ga0157371_100376502 | 126 |
| 117 | 3300013102 | Ga0157371_10102555 | Ga0157371_101025552 | 126 |
| 118 | 3300013104 | Ga0157370_10182850 | Ga0157370_101828503 | 126 |
| 119 | 3300013104 | Ga0157370_10269850 | Ga0157370_102698502 | 126 |
| 120 | 3300013104 | Ga0157370_10368157 | Ga0157370_103681571 | 126 |
| 121 | 3300013104 | Ga0157370_10400562 | Ga0157370_104005622 | 126 |
| 122 | 3300013105 | Ga0157369_10014407 | Ga0157369_100144074 | 126 |
| 123 | 3300013105 | Ga0157369_10052665 | Ga0157369_100526652 | 126 |
| 124 | 3300013105 | Ga0157369_10365634 | Ga0157369_103656343 | 126 |
| 125 | 3300013296 | Ga0157374_10001159 | Ga0157374_100011596 | 126 |
| 126 | 3300013296 | Ga0157374_10004630 | Ga0157374_100046309 | 126 |
| 127 | 3300013296 | Ga0157374_10013573 | Ga0157374_100135734 | 126 |
| 128 | 3300013296 | Ga0157374_10671257 | Ga0157374_106712572 | 126 |
| 129 | 3300013297 | Ga0157378_10016526 | Ga0157378_100165263 | 126 |
| 130 | 3300013297 | Ga0157378_10326573 | Ga0157378_103265732 | 126 |
| 131 | 3300013306 | Ga0163162_10000051 | Ga0163162_10000051107 | 126 |
| 132 | 3300013307 | Ga0157372_10000009 | Ga0157372_1000000948 | 126 |
| 133 | 3300013307 | Ga0157372_10000398 | Ga0157372_100003985 | 126 |
| 134 | 3300013307 | Ga0157372_10011124 | Ga0157372_100111242 | 126 |
| 135 | 3300013307 | Ga0157372_10015347 | Ga0157372_100153474 | 126 |
| 136 | 3300013308 | Ga0157375_10010938 | Ga0157375_100109387 | 126 |
| 137 | 3300013308 | Ga0157375_10041900 | Ga0157375_100419004 | 126 |
| 138 | 3300014745 | Ga0157377_10015062 | Ga0157377_100150623 | 126 |
| 139 | 3300014969 | Ga0157376_10329001 | Ga0157376_103290014 | 126 |
| 140 | 3300020081 | Ga0206354_10879820 | Ga0206354_108798201 | 126 |
| 141 | 3300020082 | Ga0206353_10489638 | Ga0206353_104896381 | 126 |
| 142 | 3300021361 | Ga0213872_10006142 | Ga0213872_100061424 | 126 |
| 143 | 3300025250 | Ga0209026_1002934 | Ga0209026_10029344 | 126 |
| 144 | 3300025250 | Ga0209026_1035060 | Ga0209026_10350602 | 126 |
| 145 | 3300025261 | Ga0209233_1000511 | Ga0209233_100051116 | 126 |
| 146 | 3300025321 | Ga0207656_10306571 | Ga0207656_103065711 | 126 |
| 147 | 3300025899 | Ga0207642_10026414 | Ga0207642_100264142 | 126 |
| 148 | 3300025904 | Ga0207647_10000036 | Ga0207647_1000003636 | 126 |
| 149 | 3300025904 | Ga0207647_10000289 | Ga0207647_1000028929 | 126 |
| 150 | 3300025907 | Ga0207645_10000312 | Ga0207645_1000031213 | 126 |
| 151 | 3300025909 | Ga0207705_10000216 | Ga0207705_1000021630 | 126 |
| 152 | 3300025909 | Ga0207705_10037215 | Ga0207705_100372151 | 126 |
| 153 | 3300025911 | Ga0207654_10008662 | Ga0207654_100086625 | 126 |
| 154 | 3300025911 | Ga0207654_10021594 | Ga0207654_100215941 | 126 |
| 155 | 3300025911 | Ga0207654_10062450 | Ga0207654_100624503 | 126 |
| 156 | 3300025913 | Ga0207695_10000197 | Ga0207695_10000197113 | 126 |
| 157 | 3300025913 | Ga0207695_10024351 | Ga0207695_100243512 | 126 |
| 158 | 3300025913 | Ga0207695_10025919 | Ga0207695_100259193 | 126 |
| 159 | 3300025913 | Ga0207695_10085412 | Ga0207695_100854124 | 126 |
| 160 | 3300025913 | Ga0207695_10318982 | Ga0207695_103189822 | 126 |
| 161 | 3300025913 | Ga0207695_10516687 | Ga0207695_105166871 | 126 |
| 162 | 3300025914 | Ga0207671_10005219 | Ga0207671_100052193 | 126 |
| 163 | 3300025914 | Ga0207671_10008274 | Ga0207671_100082747 | 126 |
| 164 | 3300025914 | Ga0207671_10010853 | Ga0207671_100108534 | 126 |
| 165 | 3300025914 | Ga0207671_10070712 | Ga0207671_100707125 | 126 |
| 166 | 3300025914 | Ga0207671_10433715 | Ga0207671_104337152 | 126 |
| 167 | 3300025917 | Ga0207660_10150500 | Ga0207660_101505001 | 126 |
| 168 | 3300025919 | Ga0207657_10019212 | Ga0207657_100192125 | 126 |
| 169 | 3300025921 | Ga0207652_10164585 | Ga0207652_101645853 | 126 |
| 170 | 3300025924 | Ga0207694_10005784 | Ga0207694_100057844 | 126 |
| 171 | 3300025924 | Ga0207694_10416024 | Ga0207694_104160242 | 126 |
| 172 | 3300025924 | Ga0207694_10563599 | Ga0207694_105635992 | 126 |
| 173 | 3300025926 | Ga0207659_10207312 | Ga0207659_102073123 | 126 |
| 174 | 3300025927 | Ga0207687_10199985 | Ga0207687_101999853 | 126 |
| 175 | 3300025931 | Ga0207644_10005093 | Ga0207644_100050936 | 126 |
| 176 | 3300025932 | Ga0207690_10041384 | Ga0207690_100413845 | 126 |
| 177 | 3300025933 | Ga0207706_10000125 | Ga0207706_1000012517 | 126 |
| 178 | 3300025934 | Ga0207686_10953260 | Ga0207686_109532602 | 126 |
| 179 | 3300025937 | Ga0207669_11312563 | Ga0207669_113125631 | 126 |
| 180 | 3300025938 | Ga0207704_10000335 | Ga0207704_1000033521 | 126 |
| 181 | 3300025940 | Ga0207691_10616073 | Ga0207691_106160732 | 126 |
| 182 | 3300025942 | Ga0207689_10047810 | Ga0207689_100478104 | 126 |
| 183 | 3300025942 | Ga0207689_10564100 | Ga0207689_105641002 | 126 |
| 184 | 3300025944 | Ga0207661_10126985 | Ga0207661_101269854 | 126 |
| 185 | 3300025949 | Ga0207667_10015754 | Ga0207667_100157544 | 126 |
| 186 | 3300025949 | Ga0207667_10016609 | Ga0207667_100166098 | 126 |
| 187 | 3300025949 | Ga0207667_10032797 | Ga0207667_100327977 | 126 |
| 188 | 3300025949 | Ga0207667_10286951 | Ga0207667_102869513 | 126 |
| 189 | 3300025960 | Ga0207651_10019493 | Ga0207651_100194934 | 126 |
| 190 | 3300025981 | Ga0207640_10444031 | Ga0207640_104440311 | 126 |
| 191 | 3300026023 | Ga0207677_10051251 | Ga0207677_100512514 | 126 |
| 192 | 3300026041 | Ga0207639_10013728 | Ga0207639_100137285 | 126 |
| 193 | 3300026041 | Ga0207639_10033747 | Ga0207639_100337475 | 126 |
| 194 | 3300026041 | Ga0207639_10805917 | Ga0207639_108059172 | 126 |
| 195 | 3300026067 | Ga0207678_10546843 | Ga0207678_105468432 | 126 |
| 196 | 3300026078 | Ga0207702_10000689 | Ga0207702_1000068934 | 126 |
| 197 | 3300026089 | Ga0207648_10000961 | Ga0207648_1000096113 | 126 |
| 198 | 3300026095 | Ga0207676_11326531 | Ga0207676_113265312 | 126 |
| 199 | 3300026116 | Ga0207674_10020634 | Ga0207674_100206344 | 126 |
| 200 | 3300026121 | Ga0207683_10003092 | Ga0207683_1000309210 | 126 |
| 201 | 3300026142 | Ga0207698_10012213 | Ga0207698_100122135 | 126 |
| 202 | 3300026142 | Ga0207698_10762749 | Ga0207698_107627492 | 126 |
| 203 | 3300028379 | Ga0268266_10000037 | Ga0268266_10000037135 | 126 |
| 204 | 3300031344 | Ga0265316_10804391 | Ga0265316_108043911 | 126 |
| 205 | 3300031852 | Ga0307410_10794007 | Ga0307410_107940071 | 126 |
| 206 | 3300032004 | Ga0307414_10052767 | Ga0307414_100527674 | 126 |
| 207 | 3300032004 | Ga0307414_10263873 | Ga0307414_102638732 | 126 |
| 208 | 3300032005 | Ga0307411_12151878 | Ga0307411_121518781 | 126 |
| 209 | 3300032126 | Ga0307415_100700926 | Ga0307415_1007009262 | 126 |
| 210 | 3300035115 | Ga0373941_0017107 | Ga0373941_0017107_1153_1533 | 126 |
| 211 | 3300037312 | Ga0395899_0000327 | Ga0395899_0000327_59593_59973 | 126 |
| 212 | 3300037312 | Ga0395899_0000999 | Ga0395899_0000999_23748_24128 | 126 |
| 213 | 3300037418 | Ga0395900_0002624 | Ga0395900_0002624_13574_13954 | 126 |
| 214 | 3300037418 | Ga0395900_0011000 | Ga0395900_0011000_2895_3275 | 126 |
| 215 | 3300037418 | Ga0395900_0208101 | Ga0395900_0208101_1304_1708 | 126 |
| 216 | 3300037418 | Ga0395900_0566767 | Ga0395900_0566767_401_823 | 126 |
| 217 | 3300037466 | Ga0395898_0903480 | Ga0395898_0903480_81_461 | 126 |
| 218 | 3300037471 | Ga0395905_0002075 | Ga0395905_0002075_14341_14745 | 126 |
| 219 | 3300037471 | Ga0395905_0003901 | Ga0395905_0003901_8015_8395 | 126 |
| 220 | 3300037471 | Ga0395905_1717432 | Ga0395905_1717432_132_512 | 126 |
| 221 | 3300038443 | Ga0395901_0008093 | Ga0395901_0008093_4079_4483 | 126 |
| 222 | 3300038443 | Ga0395901_0020140 | Ga0395901_0020140_705_1085 | 126 |
| 223 | 3300038443 | Ga0395901_0243437 | Ga0395901_0243437_582_1004 | 126 |
| 224 | 3300039447 | Ga0436361_0504948 | Ga0436361_0504948_4204_4584 | 126 |
| 225 | 3300041456 | Ga0451795_1552686 | Ga0451795_1552686_268_651 | 126 |
| 226 | 3300042005 | Ga0439448_0005226 | Ga0439448_0005226_2143_2589 | 126 |
| 227 | 3300044656 | Ga0466969_0019343 | Ga0466969_0019343_3145_3525 | 126 |
| 228 | 3300044684 | Ga0466966_0024996 | Ga0466966_0024996_229_609 | 126 |
| 229 | 3300044693 | Ga0466961_0020228 | Ga0466961_0020228_32_412 | 126 |
| 230 | 3300044712 | Ga0453684_0043093 | Ga0453684_0043093_1498_1878 | 126 |
| 231 | 3300045049 | Ga0466959_0057120 | Ga0466959_0057120_1705_2085 | 126 |
| 232 | 3300045051 | Ga0451576_0047848 | Ga0451576_0047848_4097_4477 | 126 |
| 233 | 3300046471 | Ga0495650_0142545 | Ga0495650_0142545_147_527 | 126 |
| 234 | 3300046471 | Ga0495650_0187702 | Ga0495650_0187702_39_419 | 126 |
| 235 | 3300046474 | Ga0495605_0124943 | Ga0495605_0124943_691_1071 | 126 |
| 236 | 3300046506 | Ga0495583_0082908 | Ga0495583_0082908_868_1248 | 126 |
| 237 | 3300046507 | Ga0495606_0096258 | Ga0495606_0096258_516_896 | 126 |
| 238 | 3300046507 | Ga0495606_0130948 | Ga0495606_0130948_565_945 | 126 |
| 239 | 3300046507 | Ga0495606_0554310 | Ga0495606_0554310_108_539 | 126 |
| 240 | 3300046512 | Ga0495610_0163015 | Ga0495610_0163015_239_619 | 126 |
| 241 | 3300046528 | Ga0495642_0102710 | Ga0495642_0102710_656_1087 | 126 |
| 242 | 3300046616 | Ga0495668_0125465 | Ga0495668_0125465_935_1366 | 126 |
| 243 | 3300046660 | Ga0495625_0034241 | Ga0495625_0034241_2219_2599 | 126 |
| 244 | 3300046660 | Ga0495625_0365453 | Ga0495625_0365453_297_725 | 126 |
| 245 | 3300046665 | Ga0495661_0002324 | Ga0495661_0002324_8177_8557 | 126 |
| 246 | 3300046665 | Ga0495661_0007355 | Ga0495661_0007355_1549_1929 | 126 |
| 247 | 3300046691 | Ga0495670_0091880 | Ga0495670_0091880_726_1157 | 126 |
| 248 | 3300047443 | Ga0495687_002453 | Ga0495687_002453_4129_4509 | 126 |
| 249 | 3300047445 | Ga0495677_0435262 | Ga0495677_0435262_18_398 | 126 |
| 250 | 3300047472 | Ga0495686_0103728 | Ga0495686_0103728_189_569 | 126 |
| 251 | 3300049683 | Ga0501253_042344 | Ga0501253_042344_471_851 | 126 |
| 252 | 3300049758 | Ga0501241_136855 | Ga0501241_136855_77_457 | 126 |
| 253 | 3300050493 | nmdc:mga0k408_12052_c1 | nmdc:mga0k408_12052_c1_1150_1578 | 126 |
| 254 | 3300050493 | nmdc:mga0k408_364347_c1 | nmdc:mga0k408_364347_c1_211_591 | 126 |
| 255 | 3300050493 | nmdc:mga0k408_429_c1 | nmdc:mga0k408_429_c1_14_394 | 126 |
| 256 | 3300050496 | nmdc:mga07m45_331920_c1 | nmdc:mga07m45_331920_c1_423_803 | 126 |
| 257 | 3300050496 | nmdc:mga07m45_355732_c1 | nmdc:mga07m45_355732_c1_255_635 | 126 |
| 258 | 3300053080 | Ga0500635_0009074 | Ga0500635_0009074_2185_2565 | 126 |
| 259 | 3300053130 | Ga0500642_0015275 | Ga0500642_0015275_1209_1589 | 126 |
| 260 | 3300053156 | Ga0500622_0000719 | Ga0500622_0000719_16848_17228 | 126 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1onl-assembly3.cif.gz_C | crystal structure of thermus thermophilus hb8 h-protein of the glycine cleavage system | 0.9661 | 2 | 125 |
| 1htp-assembly1.cif.gz_A | refined structures at 2 angstroms and 2.2 angstroms of the two forms of the h-protein, a lipoamide-containing protein of the glycine decarboxylase complex | 0.9629 | 1 | 125 |
| 3wdn-assembly1.cif.gz_A | high-resolution x-ray crystal structure of bovine h-protein using a high-pressure cryocooling method | 0.9618 | 7 | 125 |
| 3a7a-assembly1.cif.gz_B | crystal structure of e. coli lipoate-protein ligase a in complex with octyl-amp and apoh-protein | 0.9531 | 2 | 125 |
| 3hgb-assembly1.cif.gz_A | crystal structure of glycine cleavage system protein h from mycobacterium tuberculosis | 0.9511 | 2 | 122 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3wdnA00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9608 | 7 | 125 | 2.40.50.100 |
| af_Q20634_6_139_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9503 | 7 | 122 | 2.40.50.100 |
| 3a8jE00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9264 | 1 | 126 | 2.40.50.100 |
| af_Q4E4F5_6_138_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9249 | 5 | 124 | 2.40.50.100 |
| af_Q54JV8_6_144_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9216 | 3 | 124 | 2.40.50.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Y1XKQ4-F1-model_v4 | Glycine cleavage system H protein | 0.9896 | 1 | 125 |
GO:0005829
GO:0005960 GO:0019464 |
| AF-A0A1V5VJC2-F1-model_v4 | Glycine cleavage system H protein | 0.9891 | 1 | 126 |
GO:0005829
GO:0005960 GO:0019464 |
| AF-A0A7D4ULF5-F1-model_v4 | Glycine cleavage system H protein | 0.9888 | 1 | 126 |
GO:0005829
GO:0005960 GO:0019464 |
| AF-A0A1V6C3K6-F1-model_v4 | Glycine cleavage system H protein | 0.9885 | 1 | 124 |
GO:0005829
GO:0005960 GO:0019464 |
| AF-A0A3E1Y9Y3-F1-model_v4 | Glycine cleavage system H protein | 0.9881 | 1 | 126 |
GO:0005829
GO:0005960 GO:0019464 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar