F369320

General Info

Members Datasets Scaffolds Average Seq Length
260 159 256 128

Family's Representative Sequence

Representative Sequence 3300005337|Ga0070682_100169988|Ga0070682_1001699882
Length 127
Sequence VIPEDLRYSSDHEWLRTTGETTVQLGITDYAQDSLGDIVFVQMPEPGTTVSPGDAIGEVESTKSVSDIFAPVTGTVIRRNDALDAQPELINSDPYGDGWMIEIELADPAELEDLLDAAGYAEVAGES

Samples

Sample ID Description Type Environment
1 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
2 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
3 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
4 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
5 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
9 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
10 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
70 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
71 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
72 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
109 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
110 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
111 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
112 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
113 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
114 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
115 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
116 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
117 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
118 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
119 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
120 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
121 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
122 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
123 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
124 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
125 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
126 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
127 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
128 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
129 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
130 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
131 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
132 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
133 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
134 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
135 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
136 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
137 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
138 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
139 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
140 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
141 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
142 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
143 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
144 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
145 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
146 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
147 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
148 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
149 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
150 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
153 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
154 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
155 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
156 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
157 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
158 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
159 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.69
Metatranscriptomes 0.77
Isolates 1.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.15
Nodule 0
Rhizoplane 4.23
Rhizosphere 86.15
Stem 0
Stem Tuber 0
Unclassified 3.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1006662 3300001904 Bacteria 1945
2 JGI24740J21852_10007035 3300001979 Bacteria 4612
3 JGI24737J22298_10002762 3300001990 Bacteria 6208
4 JGI24743J22301_10002360 3300001991 Bacteria 2827
5 JGI24744J21845_10000632 3300002077 Bacteria 6424
6 JGI25157J39369_1024721 3300002741 Bacteria 703
7 JGI25165J46597_1008756 3300003214 Bacteria 1565
8 rootH1_10047048 3300003316 Bacteria 2968
9 rootH2_10004419 3300003320 Bacteria 46013
10 rootH2_10007681 3300003320 Bacteria 7340
11 rootH1_10126212 3300003323 Bacteria 7317
12 Ga0065714_10117956 3300005288 Bacteria 1372
13 Ga0065714_10410738 3300005288 Bacteria 555
14 Ga0070658_10000059 3300005327 Bacteria 112781
15 Ga0070658_10043465 3300005327 Bacteria 3629
16 Ga0070658_10440833 3300005327 Bacteria 1122
17 Ga0070676_10001447 3300005328 Bacteria 12016
18 Ga0070683_100111303 3300005329 Bacteria 2583
19 Ga0068869_100297423 3300005334 Bacteria 1302
20 Ga0070680_100584251 3300005336 Bacteria 958
21 Ga0070682_100169988 3300005337 Bacteria 1514
22 Ga0068868_100072997 3300005338 Bacteria 2739
23 Ga0070660_100010256 3300005339 Bacteria 6613
24 Ga0070660_100033637 3300005339 Bacteria 3865
25 Ga0070660_100520062 3300005339 Bacteria 991
26 Ga0070671_100005639 3300005355 Bacteria 9963
27 Ga0070674_100389189 3300005356 Bacteria 1136
28 Ga0070673_100006097 3300005364 Bacteria 7811
29 Ga0070673_100158984 3300005364 Bacteria 1920
30 Ga0070673_100200833 3300005364 Bacteria 1717
31 Ga0070688_100826137 3300005365 Bacteria 726
32 Ga0070659_100013256 3300005366 Bacteria 6131
33 Ga0070659_100060870 3300005366 Bacteria 2983
34 Ga0070714_101880044 3300005435 Bacteria 584
35 Ga0070663_100031338 3300005455 Bacteria 3654
36 Ga0070678_100004052 3300005456 Bacteria 8248
37 Ga0070662_100000043 3300005457 Bacteria 70660
38 Ga0068867_100000970 3300005459 Bacteria 19578
39 Ga0068853_100002294 3300005539 Bacteria 14298
40 Ga0068853_100012760 3300005539 Bacteria 6841
41 Ga0068853_100092702 3300005539 Bacteria 2658
42 Ga0070672_100845916 3300005543 Bacteria 806
43 Ga0070665_100000017 3300005548 Bacteria 448013
44 Ga0068855_100000958 3300005563 Bacteria 35849
45 Ga0068855_100011557 3300005563 Bacteria 10662
46 Ga0068855_100093308 3300005563 Bacteria 3471
47 Ga0068855_101465804 3300005563 Bacteria 702
48 Ga0068857_100025248 3300005577 Bacteria 5233
49 Ga0068854_101567865 3300005578 Bacteria 599
50 Ga0068856_100000650 3300005614 Bacteria 37676
51 Ga0068856_102096852 3300005614 Bacteria 575
52 Ga0068852_100000477 3300005616 Bacteria 26260
53 Ga0068852_100110895 3300005616 Bacteria 2494
54 Ga0068852_101134976 3300005616 Bacteria 802
55 Ga0068852_101408202 3300005616 Unclassified 719
56 Ga0068866_10313802 3300005718 Bacteria 984
57 Ga0068851_10449093 3300005834 Bacteria 766
58 Ga0075366_10004640 3300006195 Bacteria 7382
59 Ga0075366_10054891 3300006195 Bacteria 2366
60 Ga0075366_10410081 3300006195 Bacteria 834
61 Ga0097621_100001356 3300006237 Bacteria 16859
62 Ga0075370_10215461 3300006353 Bacteria 1134
63 Ga0075370_10405558 3300006353 Bacteria 818
64 Ga0068871_100000290 3300006358 Bacteria 35074
65 Ga0068871_100468283 3300006358 Bacteria 1132
66 Ga0068865_100000913 3300006881 Bacteria 16747
67 Ga0105240_10000321 3300009093 Bacteria 90931
68 Ga0105240_10004537 3300009093 Bacteria 21094
69 Ga0105240_10025194 3300009093 Bacteria 7823
70 Ga0105240_10391227 3300009093 Bacteria 1568
71 Ga0105240_12171252 3300009093 Bacteria 576
72 Ga0105243_10134273 3300009148 Bacteria 2103
73 Ga0105241_10001515 3300009174 Bacteria 17800
74 Ga0105241_10001722 3300009174 Bacteria 16636
75 Ga0105241_10010412 3300009174 Bacteria 6824
76 Ga0105241_10111859 3300009174 Bacteria 2187
77 Ga0105241_10279401 3300009174 Bacteria 1425
78 Ga0105242_10560128 3300009176 Bacteria 1097
79 Ga0105237_10000273 3300009545 Bacteria 72474
80 Ga0105237_10001937 3300009545 Bacteria 26385
81 Ga0105237_10088290 3300009545 Bacteria 3090
82 Ga0105237_10713161 3300009545 Bacteria 1010
83 Ga0105238_10014991 3300009551 Bacteria 7847
84 Ga0105238_10355885 3300009551 Bacteria 1453
85 Ga0105239_10000053 3300010375 Bacteria 163705
86 Ga0105239_10000813 3300010375 Bacteria 44289
87 Ga0105239_10012502 3300010375 Bacteria 9456
88 Ga0105239_10126483 3300010375 Bacteria 2841
89 Ga0105239_11962587 3300010375 Bacteria 679
90 Ga0105239_12273259 3300010375 Bacteria 631
91 Ga0157373_10000271 3300013100 Bacteria 41646
92 Ga0157373_10001175 3300013100 Bacteria 20027
93 Ga0157373_10035490 3300013100 Bacteria 3579
94 Ga0157371_10000476 3300013102 Bacteria 49123
95 Ga0157371_10002611 3300013102 Bacteria 17098
96 Ga0157371_10037650 3300013102 Bacteria 3461
97 Ga0157371_10102555 3300013102 Unclassified 2030
98 Ga0157370_10182850 3300013104 Bacteria 1947
99 Ga0157370_10269850 3300013104 Unclassified 1572
100 Ga0157370_10368157 3300013104 Bacteria 1324
101 Ga0157370_10400562 3300013104 Bacteria 1263
102 Ga0157369_10014407 3300013105 Bacteria 8928
103 Ga0157369_10052665 3300013105 Bacteria 4403
104 Ga0157369_10365634 3300013105 Bacteria 1497
105 Ga0157374_10001159 3300013296 Bacteria 22456
106 Ga0157374_10004630 3300013296 Bacteria 11541
107 Ga0157374_10013573 3300013296 Bacteria 7115
108 Ga0157374_10671257 3300013296 Unclassified 1049
109 Ga0157378_10016526 3300013297 Bacteria 6463
110 Ga0157378_10326573 3300013297 Bacteria 1492
111 Ga0163162_10000051 3300013306 Bacteria 117695
112 Ga0157372_10000009 3300013307 Bacteria 302051
113 Ga0157372_10000398 3300013307 Bacteria 47920
114 Ga0157372_10011124 3300013307 Bacteria 9571
115 Ga0157372_10015347 3300013307 Bacteria 8210
116 Ga0157375_10010938 3300013308 Bacteria 8003
117 Ga0157375_10041900 3300013308 Bacteria 4426
118 Ga0157377_10015062 3300014745 Bacteria 3946
119 Ga0157376_10329001 3300014969 Bacteria 1455
120 Ga0206354_10879820 3300020081 Bacteria 541
121 Ga0206353_10489638 3300020082 Bacteria 540
122 Ga0213872_10006142 3300021361 Bacteria 6068
123 Ga0209026_1002934 3300025250 Bacteria 5959
124 Ga0209026_1035060 3300025250 Bacteria 737
125 Ga0209233_1000511 3300025261 Bacteria 22998
126 Ga0207656_10306571 3300025321 Bacteria 787
127 Ga0207642_10026414 3300025899 Bacteria 2363
128 Ga0207647_10000036 3300025904 Bacteria 98204
129 Ga0207647_10000289 3300025904 Bacteria 41295
130 Ga0207645_10000312 3300025907 Bacteria 40968
131 Ga0207705_10000216 3300025909 Bacteria 57377
132 Ga0207705_10037215 3300025909 Bacteria 3482
133 Ga0207654_10008662 3300025911 Bacteria 5156
134 Ga0207654_10021594 3300025911 Bacteria 3425
135 Ga0207654_10062450 3300025911 Bacteria 2183
136 Ga0207695_10000197 3300025913 Bacteria 168837
137 Ga0207695_10024351 3300025913 Bacteria 6814
138 Ga0207695_10025919 3300025913 Bacteria 6552
139 Ga0207695_10085412 3300025913 Bacteria 3185
140 Ga0207695_10318982 3300025913 Bacteria 1443
141 Ga0207695_10516687 3300025913 Bacteria 1076
142 Ga0207671_10005219 3300025914 Bacteria 12076
143 Ga0207671_10008274 3300025914 Bacteria 8847
144 Ga0207671_10010853 3300025914 Bacteria 7473
145 Ga0207671_10070712 3300025914 Bacteria 2602
146 Ga0207671_10433715 3300025914 Bacteria 1046
147 Ga0207660_10150500 3300025917 Bacteria 1788
148 Ga0207657_10019212 3300025919 Bacteria 6496
149 Ga0207652_10164585 3300025921 Bacteria 1989
150 Ga0207694_10005784 3300025924 Bacteria 9471
151 Ga0207694_10416024 3300025924 Bacteria 1119
152 Ga0207694_10563599 3300025924 Bacteria 957
153 Ga0207659_10207312 3300025926 Bacteria 1569
154 Ga0207687_10199985 3300025927 Bacteria 1561
155 Ga0207644_10005093 3300025931 Bacteria 8584
156 Ga0207690_10041384 3300025932 Bacteria 3019
157 Ga0207706_10000125 3300025933 Bacteria 83075
158 Ga0207686_10953260 3300025934 Bacteria 694
159 Ga0207669_11312563 3300025937 Bacteria 615
160 Ga0207704_10000335 3300025938 Bacteria 21770
161 Ga0207691_10616073 3300025940 Bacteria 918
162 Ga0207689_10047810 3300025942 Bacteria 3530
163 Ga0207689_10564100 3300025942 Unclassified 957
164 Ga0207661_10126985 3300025944 Bacteria 2179
165 Ga0207667_10015754 3300025949 Bacteria 8573
166 Ga0207667_10016609 3300025949 Bacteria 8308
167 Ga0207667_10032797 3300025949 Bacteria 5591
168 Ga0207667_10286951 3300025949 Bacteria 1682
169 Ga0207651_10019493 3300025960 Bacteria 4067
170 Ga0207640_10444031 3300025981 Bacteria 1067
171 Ga0207677_10051251 3300026023 Bacteria 2797
172 Ga0207639_10013728 3300026041 Bacteria 5680
173 Ga0207639_10033747 3300026041 Bacteria 3778
174 Ga0207639_10805917 3300026041 Bacteria 875
175 Ga0207678_10546843 3300026067 Bacteria 1012
176 Ga0207702_10000689 3300026078 Bacteria 36498
177 Ga0207648_10000961 3300026089 Bacteria 32589
178 Ga0207676_11326531 3300026095 Bacteria 715
179 Ga0207674_10020634 3300026116 Bacteria 7115
180 Ga0207683_10003092 3300026121 Bacteria 14541
181 Ga0207683_10848535 3300026121 Bacteria 848
182 Ga0207698_10012213 3300026142 Bacteria 5610
183 Ga0207698_10584953 3300026142 Bacteria 1099
184 Ga0207698_10762749 3300026142 Bacteria 967
185 Ga0268266_10000037 3300028379 Bacteria 342368
186 Ga0265316_10804391 3300031344 Bacteria 659
187 Ga0307410_10794007 3300031852 Bacteria 805
188 Ga0307414_10052767 3300032004 Bacteria 2831
189 Ga0307414_10263873 3300032004 Bacteria 1439
190 Ga0307411_12151878 3300032005 Bacteria 522
191 Ga0307415_100700926 3300032126 Bacteria 914
192 Ga0373941_0017107 3300035115 Bacteria 1981
193 Ga0395899_0000327 3300037312 Bacteria 60343
194 Ga0395899_0000999 3300037312 Bacteria 25966
195 Ga0395900_0002624 3300037418 Bacteria 19622
196 Ga0395900_0011000 3300037418 Bacteria 9252
197 Ga0395900_0208101 3300037418 Bacteria 1976
198 Ga0395900_0566767 3300037418 Bacteria 1079
199 Ga0395898_0903480 3300037466 Bacteria 821
200 Ga0395905_0002075 3300037471 Bacteria 22818
201 Ga0395905_0003901 3300037471 Bacteria 15732
202 Ga0395905_1717432 3300037471 Bacteria 533
203 Ga0395901_0008093 3300038443 Bacteria 10618
204 Ga0395901_0020140 3300038443 Bacteria 6826
205 Ga0395901_0243437 3300038443 Bacteria 1875
206 Ga0436361_0504948 3300039447 Bacteria 6194
207 Ga0451795_1552686 3300041456 Bacteria 1655
208 Ga0451802_0013956 3300041460 Unclassified 511
209 Ga0451837_0228915 3300041494 Bacteria 739
210 Ga0439448_0005226 3300042005 Bacteria 3698
211 Ga0466969_0019343 3300044656 Bacteria 3542
212 Ga0466966_0024996 3300044684 Bacteria 3904
213 Ga0466961_0020228 3300044693 Bacteria 4283
214 Ga0453684_0043093 3300044712 Bacteria 6072
215 Ga0466959_0057120 3300045049 Bacteria 2846
216 Ga0451576_0047848 3300045051 Bacteria 4495
217 Ga0495650_0142545 3300046471 Bacteria 866
218 Ga0495650_0187702 3300046471 Bacteria 724
219 Ga0495605_0124943 3300046474 Bacteria 1164
220 Ga0495583_0082908 3300046506 Bacteria 1391
221 Ga0495606_0096258 3300046507 Bacteria 1811
222 Ga0495606_0130948 3300046507 Bacteria 1491
223 Ga0495606_0554310 3300046507 Bacteria 571
224 Ga0495610_0163015 3300046512 Unclassified 941
225 Ga0495642_0102710 3300046528 Bacteria 1218
226 Ga0495668_0125465 3300046616 Bacteria 1405
227 Ga0495625_0034241 3300046660 Bacteria 3750
228 Ga0495625_0365453 3300046660 Bacteria 909
229 Ga0495661_0002324 3300046665 Bacteria 14664
230 Ga0495661_0007355 3300046665 Bacteria 7674
231 Ga0495670_0091880 3300046691 Bacteria 1554
232 Ga0495687_002453 3300047443 Bacteria 14872
233 Ga0495677_0435262 3300047445 Bacteria 519
234 Ga0495686_0103728 3300047472 Bacteria 1713
235 Ga0496100_0201493 3300048903 Bacteria 1451
236 Ga0496101_0572742 3300048904 Bacteria 893
237 Ga0496105_0429075 3300048908 Bacteria 1046
238 Ga0496107_0939608 3300048910 Bacteria 629
239 Ga0496109_1684449 3300048912 Bacteria 568
240 Ga0496113_1572931 3300048916 Bacteria 506
241 Ga0496114_0001454 3300048917 Bacteria 17979
242 Ga0496114_0080554 3300048917 Bacteria 2750
243 Ga0496114_0270220 3300048917 Bacteria 1498
244 Ga0501034_0056019 3300049571 Bacteria 3968
245 Ga0501038_0214221 3300049574 Bacteria 1540
246 Ga0501253_042344 3300049683 Bacteria 923
247 Ga0501241_136855 3300049758 Bacteria 556
248 nmdc:mga0k408_12052_c1 3300050493 Bacteria 4720
249 nmdc:mga0k408_364347_c1 3300050493 Bacteria 861
250 nmdc:mga0k408_429_c1 3300050493 Bacteria 22975
251 nmdc:mga07m45_331920_c1 3300050496 Bacteria 884
252 nmdc:mga07m45_355732_c1 3300050496 Bacteria 851
253 Ga0500635_0009074 3300053080 Bacteria 2748
254 Ga0500643_000477 3300053087 Bacteria 29325
255 Ga0500642_0015275 3300053130 Bacteria 2882
256 Ga0500622_0000719 3300053156 Bacteria 28939

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2852623160 2852626700 122
2 iso_pu_bacteria 2884933994 2884935130 122
3 iso_pu_bacteria 2919437846 2919439530 122
4 iso_pu_bacteria 2977232053 2977234065 122
5 3300005614 Ga0068856_102096852 Ga0068856_1020968522 124
6 3300041460 Ga0451802_0013956 Ga0451802_0013956_126_500 124
7 3300048917 Ga0496114_0080554 Ga0496114_0080554_266_643 124
8 3300053087 Ga0500643_000477 Ga0500643_000477_20036_20425 124
9 3300003316 rootH1_10047048 rootH1_100470482 125
10 3300005337 Ga0070682_100169988 Ga0070682_1001699882 125
11 3300005578 Ga0068854_101567865 Ga0068854_1015678651 125
12 3300005616 Ga0068852_101134976 Ga0068852_1011349762 125
13 3300010375 Ga0105239_11962587 Ga0105239_119625871 125
14 3300026121 Ga0207683_10848535 Ga0207683_108485352 125
15 3300026142 Ga0207698_10584953 Ga0207698_105849531 125
16 3300041494 Ga0451837_0228915 Ga0451837_0228915_86_463 125
17 3300048903 Ga0496100_0201493 Ga0496100_0201493_593_976 125
18 3300048904 Ga0496101_0572742 Ga0496101_0572742_277_660 125
19 3300048908 Ga0496105_0429075 Ga0496105_0429075_346_729 125
20 3300048910 Ga0496107_0939608 Ga0496107_0939608_54_437 125
21 3300048912 Ga0496109_1684449 Ga0496109_1684449_158_541 125
22 3300048916 Ga0496113_1572931 Ga0496113_1572931_23_406 125
23 3300048917 Ga0496114_0001454 Ga0496114_0001454_2836_3219 125
24 3300048917 Ga0496114_0270220 Ga0496114_0270220_560_943 125
25 3300049571 Ga0501034_0056019 Ga0501034_0056019_2467_2844 125
26 3300049574 Ga0501038_0214221 Ga0501038_0214221_209_586 125
27 3300001904 JGI24736J21556_1006662 JGI24736J21556_10066622 126
28 3300001979 JGI24740J21852_10007035 JGI24740J21852_100070354 126
29 3300001990 JGI24737J22298_10002762 JGI24737J22298_100027625 126
30 3300001991 JGI24743J22301_10002360 JGI24743J22301_100023605 126
31 3300002077 JGI24744J21845_10000632 JGI24744J21845_100006322 126
32 3300002741 JGI25157J39369_1024721 JGI25157J39369_10247212 126
33 3300003214 JGI25165J46597_1008756 JGI25165J46597_10087561 126
34 3300003320 rootH2_10004419 rootH2_1000441920 126
35 3300003320 rootH2_10007681 rootH2_100076816 126
36 3300003323 rootH1_10126212 rootH1_101262126 126
37 3300005288 Ga0065714_10117956 Ga0065714_101179562 126
38 3300005288 Ga0065714_10410738 Ga0065714_104107381 126
39 3300005327 Ga0070658_10000059 Ga0070658_1000005925 126
40 3300005327 Ga0070658_10043465 Ga0070658_100434651 126
41 3300005327 Ga0070658_10440833 Ga0070658_104408332 126
42 3300005328 Ga0070676_10001447 Ga0070676_100014475 126
43 3300005329 Ga0070683_100111303 Ga0070683_1001113032 126
44 3300005334 Ga0068869_100297423 Ga0068869_1002974232 126
45 3300005336 Ga0070680_100584251 Ga0070680_1005842512 126
46 3300005338 Ga0068868_100072997 Ga0068868_1000729971 126
47 3300005339 Ga0070660_100010256 Ga0070660_1000102564 126
48 3300005339 Ga0070660_100033637 Ga0070660_1000336373 126
49 3300005339 Ga0070660_100520062 Ga0070660_1005200622 126
50 3300005355 Ga0070671_100005639 Ga0070671_1000056397 126
51 3300005356 Ga0070674_100389189 Ga0070674_1003891892 126
52 3300005364 Ga0070673_100006097 Ga0070673_1000060978 126
53 3300005364 Ga0070673_100158984 Ga0070673_1001589842 126
54 3300005364 Ga0070673_100200833 Ga0070673_1002008332 126
55 3300005365 Ga0070688_100826137 Ga0070688_1008261371 126
56 3300005366 Ga0070659_100013256 Ga0070659_1000132561 126
57 3300005366 Ga0070659_100060870 Ga0070659_1000608701 126
58 3300005435 Ga0070714_101880044 Ga0070714_1018800441 126
59 3300005455 Ga0070663_100031338 Ga0070663_1000313384 126
60 3300005456 Ga0070678_100004052 Ga0070678_1000040525 126
61 3300005457 Ga0070662_100000043 Ga0070662_10000004356 126
62 3300005459 Ga0068867_100000970 Ga0068867_1000009703 126
63 3300005539 Ga0068853_100002294 Ga0068853_10000229411 126
64 3300005539 Ga0068853_100012760 Ga0068853_1000127605 126
65 3300005539 Ga0068853_100092702 Ga0068853_1000927024 126
66 3300005543 Ga0070672_100845916 Ga0070672_1008459162 126
67 3300005548 Ga0070665_100000017 Ga0070665_100000017182 126
68 3300005563 Ga0068855_100000958 Ga0068855_10000095818 126
69 3300005563 Ga0068855_100011557 Ga0068855_1000115574 126
70 3300005563 Ga0068855_100093308 Ga0068855_1000933084 126
71 3300005563 Ga0068855_101465804 Ga0068855_1014658041 126
72 3300005577 Ga0068857_100025248 Ga0068857_1000252488 126
73 3300005614 Ga0068856_100000650 Ga0068856_1000006503 126
74 3300005616 Ga0068852_100000477 Ga0068852_1000004779 126
75 3300005616 Ga0068852_100110895 Ga0068852_1001108952 126
76 3300005616 Ga0068852_101408202 Ga0068852_1014082021 126
77 3300005718 Ga0068866_10313802 Ga0068866_103138022 126
78 3300005834 Ga0068851_10449093 Ga0068851_104490932 126
79 3300006195 Ga0075366_10004640 Ga0075366_1000464010 126
80 3300006195 Ga0075366_10054891 Ga0075366_100548913 126
81 3300006195 Ga0075366_10410081 Ga0075366_104100812 126
82 3300006237 Ga0097621_100001356 Ga0097621_1000013566 126
83 3300006353 Ga0075370_10215461 Ga0075370_102154612 126
84 3300006353 Ga0075370_10405558 Ga0075370_104055582 126
85 3300006358 Ga0068871_100000290 Ga0068871_10000029028 126
86 3300006358 Ga0068871_100468283 Ga0068871_1004682832 126
87 3300006881 Ga0068865_100000913 Ga0068865_1000009138 126
88 3300009093 Ga0105240_10000321 Ga0105240_1000032145 126
89 3300009093 Ga0105240_10004537 Ga0105240_1000453716 126
90 3300009093 Ga0105240_10025194 Ga0105240_100251942 126
91 3300009093 Ga0105240_10391227 Ga0105240_103912271 126
92 3300009093 Ga0105240_12171252 Ga0105240_121712521 126
93 3300009148 Ga0105243_10134273 Ga0105243_101342735 126
94 3300009174 Ga0105241_10001515 Ga0105241_100015154 126
95 3300009174 Ga0105241_10001722 Ga0105241_100017228 126
96 3300009174 Ga0105241_10010412 Ga0105241_100104127 126
97 3300009174 Ga0105241_10111859 Ga0105241_101118593 126
98 3300009174 Ga0105241_10279401 Ga0105241_102794013 126
99 3300009176 Ga0105242_10560128 Ga0105242_105601282 126
100 3300009545 Ga0105237_10000273 Ga0105237_1000027345 126
101 3300009545 Ga0105237_10001937 Ga0105237_1000193710 126
102 3300009545 Ga0105237_10088290 Ga0105237_100882902 126
103 3300009545 Ga0105237_10713161 Ga0105237_107131612 126
104 3300009551 Ga0105238_10014991 Ga0105238_100149915 126
105 3300009551 Ga0105238_10355885 Ga0105238_103558853 126
106 3300010375 Ga0105239_10000053 Ga0105239_1000005335 126
107 3300010375 Ga0105239_10000813 Ga0105239_1000081335 126
108 3300010375 Ga0105239_10012502 Ga0105239_100125022 126
109 3300010375 Ga0105239_10126483 Ga0105239_101264832 126
110 3300010375 Ga0105239_12273259 Ga0105239_122732591 126
111 3300013100 Ga0157373_10000271 Ga0157373_1000027110 126
112 3300013100 Ga0157373_10001175 Ga0157373_100011757 126
113 3300013100 Ga0157373_10035490 Ga0157373_100354902 126
114 3300013102 Ga0157371_10000476 Ga0157371_100004767 126
115 3300013102 Ga0157371_10002611 Ga0157371_1000261112 126
116 3300013102 Ga0157371_10037650 Ga0157371_100376502 126
117 3300013102 Ga0157371_10102555 Ga0157371_101025552 126
118 3300013104 Ga0157370_10182850 Ga0157370_101828503 126
119 3300013104 Ga0157370_10269850 Ga0157370_102698502 126
120 3300013104 Ga0157370_10368157 Ga0157370_103681571 126
121 3300013104 Ga0157370_10400562 Ga0157370_104005622 126
122 3300013105 Ga0157369_10014407 Ga0157369_100144074 126
123 3300013105 Ga0157369_10052665 Ga0157369_100526652 126
124 3300013105 Ga0157369_10365634 Ga0157369_103656343 126
125 3300013296 Ga0157374_10001159 Ga0157374_100011596 126
126 3300013296 Ga0157374_10004630 Ga0157374_100046309 126
127 3300013296 Ga0157374_10013573 Ga0157374_100135734 126
128 3300013296 Ga0157374_10671257 Ga0157374_106712572 126
129 3300013297 Ga0157378_10016526 Ga0157378_100165263 126
130 3300013297 Ga0157378_10326573 Ga0157378_103265732 126
131 3300013306 Ga0163162_10000051 Ga0163162_10000051107 126
132 3300013307 Ga0157372_10000009 Ga0157372_1000000948 126
133 3300013307 Ga0157372_10000398 Ga0157372_100003985 126
134 3300013307 Ga0157372_10011124 Ga0157372_100111242 126
135 3300013307 Ga0157372_10015347 Ga0157372_100153474 126
136 3300013308 Ga0157375_10010938 Ga0157375_100109387 126
137 3300013308 Ga0157375_10041900 Ga0157375_100419004 126
138 3300014745 Ga0157377_10015062 Ga0157377_100150623 126
139 3300014969 Ga0157376_10329001 Ga0157376_103290014 126
140 3300020081 Ga0206354_10879820 Ga0206354_108798201 126
141 3300020082 Ga0206353_10489638 Ga0206353_104896381 126
142 3300021361 Ga0213872_10006142 Ga0213872_100061424 126
143 3300025250 Ga0209026_1002934 Ga0209026_10029344 126
144 3300025250 Ga0209026_1035060 Ga0209026_10350602 126
145 3300025261 Ga0209233_1000511 Ga0209233_100051116 126
146 3300025321 Ga0207656_10306571 Ga0207656_103065711 126
147 3300025899 Ga0207642_10026414 Ga0207642_100264142 126
148 3300025904 Ga0207647_10000036 Ga0207647_1000003636 126
149 3300025904 Ga0207647_10000289 Ga0207647_1000028929 126
150 3300025907 Ga0207645_10000312 Ga0207645_1000031213 126
151 3300025909 Ga0207705_10000216 Ga0207705_1000021630 126
152 3300025909 Ga0207705_10037215 Ga0207705_100372151 126
153 3300025911 Ga0207654_10008662 Ga0207654_100086625 126
154 3300025911 Ga0207654_10021594 Ga0207654_100215941 126
155 3300025911 Ga0207654_10062450 Ga0207654_100624503 126
156 3300025913 Ga0207695_10000197 Ga0207695_10000197113 126
157 3300025913 Ga0207695_10024351 Ga0207695_100243512 126
158 3300025913 Ga0207695_10025919 Ga0207695_100259193 126
159 3300025913 Ga0207695_10085412 Ga0207695_100854124 126
160 3300025913 Ga0207695_10318982 Ga0207695_103189822 126
161 3300025913 Ga0207695_10516687 Ga0207695_105166871 126
162 3300025914 Ga0207671_10005219 Ga0207671_100052193 126
163 3300025914 Ga0207671_10008274 Ga0207671_100082747 126
164 3300025914 Ga0207671_10010853 Ga0207671_100108534 126
165 3300025914 Ga0207671_10070712 Ga0207671_100707125 126
166 3300025914 Ga0207671_10433715 Ga0207671_104337152 126
167 3300025917 Ga0207660_10150500 Ga0207660_101505001 126
168 3300025919 Ga0207657_10019212 Ga0207657_100192125 126
169 3300025921 Ga0207652_10164585 Ga0207652_101645853 126
170 3300025924 Ga0207694_10005784 Ga0207694_100057844 126
171 3300025924 Ga0207694_10416024 Ga0207694_104160242 126
172 3300025924 Ga0207694_10563599 Ga0207694_105635992 126
173 3300025926 Ga0207659_10207312 Ga0207659_102073123 126
174 3300025927 Ga0207687_10199985 Ga0207687_101999853 126
175 3300025931 Ga0207644_10005093 Ga0207644_100050936 126
176 3300025932 Ga0207690_10041384 Ga0207690_100413845 126
177 3300025933 Ga0207706_10000125 Ga0207706_1000012517 126
178 3300025934 Ga0207686_10953260 Ga0207686_109532602 126
179 3300025937 Ga0207669_11312563 Ga0207669_113125631 126
180 3300025938 Ga0207704_10000335 Ga0207704_1000033521 126
181 3300025940 Ga0207691_10616073 Ga0207691_106160732 126
182 3300025942 Ga0207689_10047810 Ga0207689_100478104 126
183 3300025942 Ga0207689_10564100 Ga0207689_105641002 126
184 3300025944 Ga0207661_10126985 Ga0207661_101269854 126
185 3300025949 Ga0207667_10015754 Ga0207667_100157544 126
186 3300025949 Ga0207667_10016609 Ga0207667_100166098 126
187 3300025949 Ga0207667_10032797 Ga0207667_100327977 126
188 3300025949 Ga0207667_10286951 Ga0207667_102869513 126
189 3300025960 Ga0207651_10019493 Ga0207651_100194934 126
190 3300025981 Ga0207640_10444031 Ga0207640_104440311 126
191 3300026023 Ga0207677_10051251 Ga0207677_100512514 126
192 3300026041 Ga0207639_10013728 Ga0207639_100137285 126
193 3300026041 Ga0207639_10033747 Ga0207639_100337475 126
194 3300026041 Ga0207639_10805917 Ga0207639_108059172 126
195 3300026067 Ga0207678_10546843 Ga0207678_105468432 126
196 3300026078 Ga0207702_10000689 Ga0207702_1000068934 126
197 3300026089 Ga0207648_10000961 Ga0207648_1000096113 126
198 3300026095 Ga0207676_11326531 Ga0207676_113265312 126
199 3300026116 Ga0207674_10020634 Ga0207674_100206344 126
200 3300026121 Ga0207683_10003092 Ga0207683_1000309210 126
201 3300026142 Ga0207698_10012213 Ga0207698_100122135 126
202 3300026142 Ga0207698_10762749 Ga0207698_107627492 126
203 3300028379 Ga0268266_10000037 Ga0268266_10000037135 126
204 3300031344 Ga0265316_10804391 Ga0265316_108043911 126
205 3300031852 Ga0307410_10794007 Ga0307410_107940071 126
206 3300032004 Ga0307414_10052767 Ga0307414_100527674 126
207 3300032004 Ga0307414_10263873 Ga0307414_102638732 126
208 3300032005 Ga0307411_12151878 Ga0307411_121518781 126
209 3300032126 Ga0307415_100700926 Ga0307415_1007009262 126
210 3300035115 Ga0373941_0017107 Ga0373941_0017107_1153_1533 126
211 3300037312 Ga0395899_0000327 Ga0395899_0000327_59593_59973 126
212 3300037312 Ga0395899_0000999 Ga0395899_0000999_23748_24128 126
213 3300037418 Ga0395900_0002624 Ga0395900_0002624_13574_13954 126
214 3300037418 Ga0395900_0011000 Ga0395900_0011000_2895_3275 126
215 3300037418 Ga0395900_0208101 Ga0395900_0208101_1304_1708 126
216 3300037418 Ga0395900_0566767 Ga0395900_0566767_401_823 126
217 3300037466 Ga0395898_0903480 Ga0395898_0903480_81_461 126
218 3300037471 Ga0395905_0002075 Ga0395905_0002075_14341_14745 126
219 3300037471 Ga0395905_0003901 Ga0395905_0003901_8015_8395 126
220 3300037471 Ga0395905_1717432 Ga0395905_1717432_132_512 126
221 3300038443 Ga0395901_0008093 Ga0395901_0008093_4079_4483 126
222 3300038443 Ga0395901_0020140 Ga0395901_0020140_705_1085 126
223 3300038443 Ga0395901_0243437 Ga0395901_0243437_582_1004 126
224 3300039447 Ga0436361_0504948 Ga0436361_0504948_4204_4584 126
225 3300041456 Ga0451795_1552686 Ga0451795_1552686_268_651 126
226 3300042005 Ga0439448_0005226 Ga0439448_0005226_2143_2589 126
227 3300044656 Ga0466969_0019343 Ga0466969_0019343_3145_3525 126
228 3300044684 Ga0466966_0024996 Ga0466966_0024996_229_609 126
229 3300044693 Ga0466961_0020228 Ga0466961_0020228_32_412 126
230 3300044712 Ga0453684_0043093 Ga0453684_0043093_1498_1878 126
231 3300045049 Ga0466959_0057120 Ga0466959_0057120_1705_2085 126
232 3300045051 Ga0451576_0047848 Ga0451576_0047848_4097_4477 126
233 3300046471 Ga0495650_0142545 Ga0495650_0142545_147_527 126
234 3300046471 Ga0495650_0187702 Ga0495650_0187702_39_419 126
235 3300046474 Ga0495605_0124943 Ga0495605_0124943_691_1071 126
236 3300046506 Ga0495583_0082908 Ga0495583_0082908_868_1248 126
237 3300046507 Ga0495606_0096258 Ga0495606_0096258_516_896 126
238 3300046507 Ga0495606_0130948 Ga0495606_0130948_565_945 126
239 3300046507 Ga0495606_0554310 Ga0495606_0554310_108_539 126
240 3300046512 Ga0495610_0163015 Ga0495610_0163015_239_619 126
241 3300046528 Ga0495642_0102710 Ga0495642_0102710_656_1087 126
242 3300046616 Ga0495668_0125465 Ga0495668_0125465_935_1366 126
243 3300046660 Ga0495625_0034241 Ga0495625_0034241_2219_2599 126
244 3300046660 Ga0495625_0365453 Ga0495625_0365453_297_725 126
245 3300046665 Ga0495661_0002324 Ga0495661_0002324_8177_8557 126
246 3300046665 Ga0495661_0007355 Ga0495661_0007355_1549_1929 126
247 3300046691 Ga0495670_0091880 Ga0495670_0091880_726_1157 126
248 3300047443 Ga0495687_002453 Ga0495687_002453_4129_4509 126
249 3300047445 Ga0495677_0435262 Ga0495677_0435262_18_398 126
250 3300047472 Ga0495686_0103728 Ga0495686_0103728_189_569 126
251 3300049683 Ga0501253_042344 Ga0501253_042344_471_851 126
252 3300049758 Ga0501241_136855 Ga0501241_136855_77_457 126
253 3300050493 nmdc:mga0k408_12052_c1 nmdc:mga0k408_12052_c1_1150_1578 126
254 3300050493 nmdc:mga0k408_364347_c1 nmdc:mga0k408_364347_c1_211_591 126
255 3300050493 nmdc:mga0k408_429_c1 nmdc:mga0k408_429_c1_14_394 126
256 3300050496 nmdc:mga07m45_331920_c1 nmdc:mga07m45_331920_c1_423_803 126
257 3300050496 nmdc:mga07m45_355732_c1 nmdc:mga07m45_355732_c1_255_635 126
258 3300053080 Ga0500635_0009074 Ga0500635_0009074_2185_2565 126
259 3300053130 Ga0500642_0015275 Ga0500642_0015275_1209_1589 126
260 3300053156 Ga0500622_0000719 Ga0500622_0000719_16848_17228 126

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01597

GCV_H

Glycine cleavage H-protein

6

127

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1onl-assembly3.cif.gz_C crystal structure of thermus thermophilus hb8 h-protein of the glycine cleavage system 0.9661 2 125
1htp-assembly1.cif.gz_A refined structures at 2 angstroms and 2.2 angstroms of the two forms of the h-protein, a lipoamide-containing protein of the glycine decarboxylase complex 0.9629 1 125
3wdn-assembly1.cif.gz_A high-resolution x-ray crystal structure of bovine h-protein using a high-pressure cryocooling method 0.9618 7 125
3a7a-assembly1.cif.gz_B crystal structure of e. coli lipoate-protein ligase a in complex with octyl-amp and apoh-protein 0.9531 2 125
3hgb-assembly1.cif.gz_A crystal structure of glycine cleavage system protein h from mycobacterium tuberculosis 0.9511 2 122
ID Description Score Start End Superfamily
3wdnA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9608 7 125 2.40.50.100
af_Q20634_6_139_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9503 7 122 2.40.50.100
3a8jE00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9264 1 126 2.40.50.100
af_Q4E4F5_6_138_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9249 5 124 2.40.50.100
af_Q54JV8_6_144_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9216 3 124 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A4Y1XKQ4-F1-model_v4 Glycine cleavage system H protein 0.9896 1 125 GO:0005829
GO:0005960
GO:0019464
AF-A0A1V5VJC2-F1-model_v4 Glycine cleavage system H protein 0.9891 1 126 GO:0005829
GO:0005960
GO:0019464
AF-A0A7D4ULF5-F1-model_v4 Glycine cleavage system H protein 0.9888 1 126 GO:0005829
GO:0005960
GO:0019464
AF-A0A1V6C3K6-F1-model_v4 Glycine cleavage system H protein 0.9885 1 124 GO:0005829
GO:0005960
GO:0019464
AF-A0A3E1Y9Y3-F1-model_v4 Glycine cleavage system H protein 0.9881 1 126 GO:0005829
GO:0005960
GO:0019464

Feature Viewer

pLDDT pTM Quality
97.41 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map