F369110

General Info

Members Datasets Scaffolds Average Seq Length
259 165 518 191

Family's Representative Sequence

Representative Sequence 3300049575|Ga0501039_0235900|Ga0501039_0235900_736_1338
Length 179
Sequence MVNLTRIYTRTGDAGQLRLEAYACVDEGNAHIGVALAHSALDGSLEEDVVTVLTRIQNDLFDVGADLSTPVVAEPKYPPLRVEQDYIDRLEEWCDHYNEALPALRSFILNGGTVAAAHLHVARTVVRRAEEHEATMNPLAITYLNRLSDLLFILARHANRENGDVLWVPGGERDASRRT

Samples

Sample ID Description Type Environment
1 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
12 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
13 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
14 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
15 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
16 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
17 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
18 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
19 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
20 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
21 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
22 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
23 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
24 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
25 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
26 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
27 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
28 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
29 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
30 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
31 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
32 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
33 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
34 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
44 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
46 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
47 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
48 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
49 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
50 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
51 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
52 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
53 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
54 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
55 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
56 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
57 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
58 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
59 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
60 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
61 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
62 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
63 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
64 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
65 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
66 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
67 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
68 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
69 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
70 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
71 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
72 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
73 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
74 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
75 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
76 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
77 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
78 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
79 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
80 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
81 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
82 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
83 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
84 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
85 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
86 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
87 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
88 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
89 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
90 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
91 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
92 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
93 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
94 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
95 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
96 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
97 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
98 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
99 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
100 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
101 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
102 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
103 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
104 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
105 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
106 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
107 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
108 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
109 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
110 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
111 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
112 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
113 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
114 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
126 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
127 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
128 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
129 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
130 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
131 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
132 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
133 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
134 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
137 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
138 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
139 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
140 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
141 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
142 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
143 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
144 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
145 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
146 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
147 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
148 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
149 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
150 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
151 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
152 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
153 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
154 2558860280 Kutzneria sp. 744 Isolate Unclassified
155 2643221576 Nocardioides sp. Root614 Isolate Unclassified
156 2643221590 Nocardioides sp. Root682 Isolate Unclassified
157 2643221604 Nocardioides sp. Root190 Isolate Unclassified
158 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
159 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
160 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
161 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
162 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
163 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
164 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
165 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.37
Metatranscriptomes 0
Isolates 4.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.15
Nodule 0
Rhizoplane 7.34
Rhizosphere 68.73
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501039_0235900 3300049575 Bacteria 1438
2 LJQas_1002062 3300000549 Bacteria 2864
3 rootH1_10004935 3300003316 Bacteria 7531
4 Ga0070683_100085255 3300005329 Bacteria 2961
5 Ga0070683_100271310 3300005329 Bacteria 1614
6 Ga0070682_100194287 3300005337 Bacteria 1427
7 Ga0070682_100489138 3300005337 Bacteria 951
8 Ga0070674_100523477 3300005356 Bacteria 991
9 Ga0070673_100387179 3300005364 Bacteria 1248
10 Ga0070708_100167127 3300005445 Bacteria 2052
11 Ga0070678_100357775 3300005456 Bacteria 1257
12 Ga0070698_100001703 3300005471 Bacteria 24516
13 Ga0070684_100190772 3300005535 Bacteria 1865
14 Ga0070684_100209804 3300005535 Bacteria 1775
15 Ga0070672_100810365 3300005543 Bacteria 824
16 Ga0070686_100043790 3300005544 Bacteria 2810
17 Ga0068860_100006256 3300005843 Bacteria 11957
18 Ga0081455_10012204 3300005937 Bacteria 8578
19 Ga0081538_10001676 3300005981 Bacteria 22565
20 Ga0075365_10010045 3300006038 Bacteria 5487
21 Ga0075365_10023075 3300006038 Bacteria 3908
22 Ga0075365_10035534 3300006038 Bacteria 3224
23 Ga0075365_10058825 3300006038 Bacteria 2560
24 Ga0075365_10060953 3300006038 Bacteria 2518
25 Ga0075365_10072049 3300006038 Bacteria 2327
26 Ga0075368_10003405 3300006042 Bacteria 5307
27 Ga0075368_10017453 3300006042 Bacteria 2686
28 Ga0075363_100015900 3300006048 Bacteria 3707
29 Ga0075363_100021424 3300006048 Bacteria 3255
30 Ga0075363_100203177 3300006048 Bacteria 1133
31 Ga0075363_100229054 3300006048 Bacteria 1066
32 Ga0075364_10013175 3300006051 Bacteria 5075
33 Ga0075364_10018239 3300006051 Bacteria 4392
34 Ga0075364_10023021 3300006051 Bacteria 3941
35 Ga0075364_10050968 3300006051 Bacteria 2702
36 Ga0075364_10310394 3300006051 Bacteria 1074
37 Ga0075362_10029682 3300006177 Bacteria 2358
38 Ga0075367_10121863 3300006178 Bacteria 1607
39 Ga0075370_10104901 3300006353 Bacteria 1638
40 Ga0075370_10167063 3300006353 Bacteria 1293
41 Ga0105245_10008603 3300009098 Bacteria 8904
42 Ga0105245_10485156 3300009098 Bacteria 1250
43 Ga0105242_10628530 3300009176 Bacteria 1041
44 Ga0105242_10960851 3300009176 Bacteria 859
45 Ga0105248_10017329 3300009177 Bacteria 7938
46 Ga0105239_10756568 3300010375 Bacteria 1112
47 Ga0157374_11233951 3300013296 Bacteria 769
48 Ga0157372_10085732 3300013307 Bacteria 3573
49 Ga0157372_10340195 3300013307 Bacteria 1748
50 Ga0157375_10479051 3300013308 Bacteria 1409
51 Ga0157375_10932908 3300013308 Bacteria 1011
52 Ga0182008_10207772 3300014497 Bacteria 998
53 Ga0157377_10199943 3300014745 Bacteria 1268
54 Ga0157376_10481360 3300014969 Bacteria 1216
55 Ga0207705_10319420 3300025909 Bacteria 1193
56 Ga0207660_10382799 3300025917 Bacteria 1131
57 Ga0207649_10884045 3300025920 Bacteria 700
58 Ga0207687_10104104 3300025927 Bacteria 2094
59 Ga0207690_10748652 3300025932 Bacteria 805
60 Ga0207704_10235452 3300025938 Bacteria 1365
61 Ga0207711_10030308 3300025941 Bacteria 4562
62 Ga0207661_10041312 3300025944 Bacteria 3630
63 Ga0207648_10239833 3300026089 Bacteria 1614
64 Ga0209813_10014570 3300027866 Bacteria 2119
65 Ga0209813_10044522 3300027866 Bacteria 1364
66 Ga0209813_10111244 3300027866 Bacteria 944
67 Ga0268264_10000238 3300028381 Bacteria 105229
68 Ga0307408_100490100 3300031548 Bacteria 1074
69 Ga0307405_10662171 3300031731 Bacteria 860
70 Ga0307413_10323591 3300031824 Bacteria 1179
71 Ga0307413_10566756 3300031824 Bacteria 924
72 Ga0307410_10599896 3300031852 Bacteria 918
73 Ga0307410_10753220 3300031852 Bacteria 825
74 Ga0307407_10173078 3300031903 Bacteria 1424
75 Ga0307407_10476918 3300031903 Bacteria 910
76 Ga0307412_10148725 3300031911 Bacteria 1725
77 Ga0307409_100067586 3300031995 Bacteria 2823
78 Ga0307409_100070976 3300031995 Bacteria 2767
79 Ga0307409_100226102 3300031995 Bacteria 1693
80 Ga0307409_100481370 3300031995 Bacteria 1204
81 Ga0307416_100023720 3300032002 Bacteria 4460
82 Ga0307416_100214598 3300032002 Bacteria 1839
83 Ga0307414_10410855 3300032004 Bacteria 1178
84 Ga0307411_10169937 3300032005 Bacteria 1643
85 Ga0307415_100002477 3300032126 Bacteria 9219
86 Ga0307415_100024657 3300032126 Bacteria 3761
87 Ga0373941_0073445 3300035115 Bacteria 1141
88 Ga0395900_0027470 3300037418 Bacteria 5830
89 Ga0395900_0242365 3300037418 Bacteria 1808
90 Ga0395900_1198253 3300037418 Bacteria 675
91 Ga0395898_0091614 3300037466 Bacteria 2924
92 Ga0395898_0110947 3300037466 Bacteria 2629
93 Ga0395898_0623939 3300037466 Bacteria 1021
94 Ga0395905_1012813 3300037471 Bacteria 734
95 Ga0395901_0083153 3300038443 Bacteria 3346
96 Ga0395901_0174244 3300038443 Bacteria 2256
97 Ga0439438_018196 3300041405 Bacteria 2006
98 Ga0439465_0060450 3300041413 Bacteria 1255
99 Ga0451795_1046045 3300041456 Bacteria 761
100 Ga0451833_1091179 3300041491 Bacteria 1909
101 Ga0451837_0265062 3300041494 Bacteria 1369
102 Ga0451839_0340298 3300041496 Bacteria 913
103 Ga0439445_0083913 3300042004 Bacteria 892
104 Ga0439445_0105151 3300042004 Bacteria 803
105 Ga0439446_0063634 3300042156 Bacteria 1118
106 Ga0439434_0013015 3300042435 Bacteria 2467
107 Ga0466969_0006733 3300044656 Bacteria 6111
108 Ga0466972_0106288 3300044658 Bacteria 1327
109 Ga0466965_0375091 3300044683 Bacteria 782
110 Ga0466966_0021583 3300044684 Bacteria 4229
111 Ga0466966_0032735 3300044684 Bacteria 3366
112 Ga0466961_0003526 3300044693 Bacteria 9757
113 Ga0466961_0046416 3300044693 Bacteria 2778
114 Ga0466963_0023429 3300044694 Bacteria 3921
115 Ga0466971_0001159 3300044719 Bacteria 10958
116 Ga0466971_0416669 3300044719 Bacteria 656
117 Ga0466968_0115652 3300044735 Bacteria 1210
118 Ga0466970_0005995 3300044765 Bacteria 6057
119 Ga0466957_0158406 3300044842 Bacteria 1469
120 Ga0466957_0334875 3300044842 Bacteria 1024
121 Ga0466960_0083152 3300044901 Bacteria 1617
122 Ga0466959_0001856 3300045049 Bacteria 13277
123 Ga0466959_0027904 3300045049 Bacteria 4187
124 Ga0466958_0051854 3300045836 Bacteria 2485
125 Ga0466958_0094595 3300045836 Bacteria 1852
126 Ga0466958_0436840 3300045836 Bacteria 847
127 Ga0466967_0025380 3300045976 Bacteria 4886
128 Ga0466967_0036380 3300045976 Bacteria 4203
129 Ga0466967_0288755 3300045976 Bacteria 1575
130 Ga0495592_0051069 3300046454 Bacteria 3071
131 Ga0495592_0265186 3300046454 Bacteria 1129
132 Ga0495594_0091615 3300046499 Bacteria 1704
133 Ga0495618_0042993 3300046514 Bacteria 2850
134 Ga0495620_0152573 3300046515 Bacteria 900
135 Ga0495652_0013192 3300046529 Bacteria 7438
136 Ga0495652_0040202 3300046529 Bacteria 4041
137 Ga0495640_0032922 3300046533 Bacteria 3687
138 Ga0495645_0035045 3300046543 Bacteria 3659
139 Ga0495667_0031045 3300046559 Bacteria 3588
140 Ga0495634_0011049 3300046642 Bacteria 6587
141 Ga0495635_0001181 3300046663 Bacteria 17399
142 Ga0495657_0012322 3300046675 Bacteria 6354
143 Ga0495623_0012260 3300046679 Bacteria 5552
144 Ga0495613_0011989 3300046689 Bacteria 6442
145 Ga0495613_0305296 3300046689 Bacteria 1101
146 Ga0495624_0031210 3300046690 Bacteria 3467
147 Ga0495600_0021888 3300046809 Bacteria 4099
148 Ga0495600_0030343 3300046809 Bacteria 3502
149 Ga0495604_0005801 3300047317 Bacteria 9796
150 Ga0495676_0017148 3300047321 Bacteria 6408
151 Ga0495675_0116593 3300047444 Bacteria 1665
152 Ga0496100_0052991 3300048903 Bacteria 2640
153 Ga0496100_0233667 3300048903 Bacteria 1354
154 Ga0496100_0341699 3300048903 Bacteria 1129
155 Ga0496101_0494890 3300048904 Bacteria 966
156 Ga0496102_0150084 3300048905 Bacteria 2189
157 Ga0496102_0223804 3300048905 Bacteria 1774
158 Ga0496102_0935428 3300048905 Bacteria 788
159 Ga0496103_0125406 3300048906 Bacteria 1637
160 Ga0496104_1147048 3300048907 Bacteria 681
161 Ga0496106_0005062 3300048909 Bacteria 9758
162 Ga0496107_0005377 3300048910 Bacteria 8762
163 Ga0496109_0467821 3300048912 Bacteria 1191
164 Ga0496110_0334802 3300048913 Bacteria 1379
165 Ga0496110_0364904 3300048913 Bacteria 1316
166 Ga0496110_0653106 3300048913 Bacteria 952
167 Ga0496114_0004517 3300048917 Bacteria 10799
168 Ga0496114_0022576 3300048917 Bacteria 5129
169 Ga0496114_0702212 3300048917 Bacteria 887
170 Ga0496124_0144226 3300048927 Bacteria 1875
171 Ga0496126_0439490 3300048929 Bacteria 1052
172 Ga0501031_0141384 3300049568 Bacteria 1573
173 Ga0501031_0374117 3300049568 Bacteria 922
174 Ga0501031_0565741 3300049568 Bacteria 732
175 Ga0501032_0073603 3300049569 Bacteria 2276
176 Ga0501033_0402133 3300049570 Bacteria 955
177 Ga0501034_0052653 3300049571 Bacteria 4100
178 Ga0501036_0189714 3300049572 Bacteria 1730
179 Ga0501037_0344280 3300049573 Bacteria 1029
180 Ga0501038_0002198 3300049574 Bacteria 18132
181 Ga0501038_0329559 3300049574 Bacteria 1193
182 Ga0501038_0434945 3300049574 Bacteria 1011
183 Ga0501038_0939892 3300049574 Bacteria 637
184 Ga0501039_0037730 3300049575 Bacteria 3731
185 Ga0501039_0039083 3300049575 Bacteria 3665
186 Ga0501039_0130468 3300049575 Bacteria 1972
187 Ga0501039_0738989 3300049575 Bacteria 769
188 Ga0501040_0016275 3300049576 Bacteria 4920
189 Ga0501040_0161643 3300049576 Bacteria 1583
190 Ga0501040_0232795 3300049576 Bacteria 1312
191 Ga0501040_0393267 3300049576 Bacteria 995
192 Ga0501041_0097885 3300049577 Bacteria 1814
193 Ga0501041_0189458 3300049577 Bacteria 1288
194 Ga0501042_0030732 3300049578 Bacteria 3797
195 Ga0501042_0294048 3300049578 Bacteria 1173
196 Ga0501046_0086544 3300049580 Bacteria 2416
197 Ga0501046_0154362 3300049580 Bacteria 1731
198 Ga0501046_0423910 3300049580 Bacteria 959
199 Ga0501046_0592741 3300049580 Bacteria 787
200 Ga0501067_0061375 3300049583 Bacteria 2081
201 Ga0501069_0138361 3300049585 Bacteria 1396
202 Ga0501071_0044626 3300049587 Bacteria 3180
203 Ga0501071_0522062 3300049587 Bacteria 911
204 Ga0501072_0070742 3300049588 Bacteria 2756
205 Ga0501072_0098124 3300049588 Bacteria 2329
206 Ga0501074_0167852 3300049590 Bacteria 1567
207 Ga0501075_0364023 3300049591 Bacteria 1102
208 Ga0501075_0780164 3300049591 Bacteria 727
209 Ga0501076_0935539 3300049592 Bacteria 714
210 Ga0501079_0130075 3300049741 Bacteria 1959
211 Ga0501079_0931093 3300049741 Bacteria 684
212 Ga0501081_0468575 3300049743 Bacteria 937
213 Ga0501035_0012162 3300049822 Bacteria 7959
214 Ga0501035_0846094 3300049822 Bacteria 728
215 Ga0501044_0014483 3300049823 Bacteria 8510
216 Ga0501045_0209454 3300049824 Bacteria 1452
217 Ga0501045_0411468 3300049824 Bacteria 1006
218 nmdc:mga03n38_162278_c1 3300050490 Bacteria 1132
219 nmdc:mga03n38_302583_c1 3300050490 Bacteria 859
220 nmdc:mga03n38_53385_c1 3300050490 Bacteria 1812
221 nmdc:mga03n38_72183_c1 3300050490 Bacteria 1600
222 nmdc:mga00v17_189329_c1 3300050491 Bacteria 1329
223 nmdc:mga00v17_49365_c1 3300050491 Bacteria 2553
224 nmdc:mga00v17_68362_c1 3300050491 Bacteria 2196
225 nmdc:mga00v17_9820_c1 3300050491 Bacteria 5199
226 nmdc:mga0yw44_100657_c1 3300050492 Bacteria 1841
227 nmdc:mga0yw44_130821_c1 3300050492 Bacteria 1624
228 nmdc:mga0yw44_291566_c1 3300050492 Bacteria 1092
229 nmdc:mga0yw44_38516_c1 3300050492 Bacteria 2830
230 nmdc:mga0yw44_71832_c1 3300050492 Bacteria 2150
231 nmdc:mga06z11_36718_c1 3300050494 Bacteria 2421
232 nmdc:mga06z11_373447_c1 3300050494 Bacteria 856
233 nmdc:mga06z11_49855_c1 3300050494 Bacteria 2138
234 nmdc:mga04h51_11577_c1 3300050495 Bacteria 2453
235 nmdc:mga04h51_53373_c1 3300050495 Bacteria 1363
236 nmdc:mga07m45_299190_c1 3300050496 Bacteria 936
237 nmdc:mga06r32_99042_c1 3300050510 Bacteria 2859
238 nmdc:mga08y16_1290371_c1 3300050511 Bacteria 697
239 Ga0495612_0024615 3300053078 Bacteria 2416
240 Ga0500641_0056841 3300053096 Bacteria 1622
241 Ga0500554_014435 3300053102 Bacteria 2038
242 Ga0500556_0003832 3300053104 Bacteria 4361
243 Ga0500593_006419 3300053117 Bacteria 4702
244 Ga0501084_0774618 3300054114 Bacteria 808
245 Ga0501082_0867491 3300060353 Bacteria 790
246 Ga0466962_0000236 3300061719 Bacteria 23080
247 Ga0530510_0521726 3300061734 Bacteria 901
248 2559429336 2558860280 Bacteria 11429938
249 2643889141 2643221576 Bacteria 5214352
250 2643958196 2643221590 Bacteria 5214697
251 2644036507 2643221604 Bacteria 5014917
252 2739367158 2738543034 Bacteria 6084756
253 2774396848 2773857762 Bacteria 5971770
254 2809198488 2808606439 Bacteria 5952208
255 2855390655 2855386786 Bacteria 4752232
256 2891969550 2891968417 Bacteria 5821697
257 2904776220 2904770941 Bacteria 5580202
258 2919425200 2919420072 Bacteria 5390363
259 2919437691 2919432681 Bacteria 5390474
260 Ga0501039_0235900
261 LJQas_1002062
262 rootH1_10004935
263 Ga0070683_100085255
264 Ga0070683_100271310
265 Ga0070682_100194287
266 Ga0070682_100489138
267 Ga0070674_100523477
268 Ga0070673_100387179
269 Ga0070708_100167127
270 Ga0070678_100357775
271 Ga0070698_100001703
272 Ga0070684_100190772
273 Ga0070684_100209804
274 Ga0070672_100810365
275 Ga0070686_100043790
276 Ga0068860_100006256
277 Ga0081455_10012204
278 Ga0081538_10001676
279 Ga0075365_10010045
280 Ga0075365_10023075
281 Ga0075365_10035534
282 Ga0075365_10058825
283 Ga0075365_10060953
284 Ga0075365_10072049
285 Ga0075368_10003405
286 Ga0075368_10017453
287 Ga0075363_100015900
288 Ga0075363_100021424
289 Ga0075363_100203177
290 Ga0075363_100229054
291 Ga0075364_10013175
292 Ga0075364_10018239
293 Ga0075364_10023021
294 Ga0075364_10050968
295 Ga0075364_10310394
296 Ga0075362_10029682
297 Ga0075367_10121863
298 Ga0075370_10104901
299 Ga0075370_10167063
300 Ga0105245_10008603
301 Ga0105245_10485156
302 Ga0105242_10628530
303 Ga0105242_10960851
304 Ga0105248_10017329
305 Ga0105239_10756568
306 Ga0157374_11233951
307 Ga0157372_10085732
308 Ga0157372_10340195
309 Ga0157375_10479051
310 Ga0157375_10932908
311 Ga0182008_10207772
312 Ga0157377_10199943
313 Ga0157376_10481360
314 Ga0207705_10319420
315 Ga0207660_10382799
316 Ga0207649_10884045
317 Ga0207687_10104104
318 Ga0207690_10748652
319 Ga0207704_10235452
320 Ga0207711_10030308
321 Ga0207661_10041312
322 Ga0207648_10239833
323 Ga0209813_10014570
324 Ga0209813_10044522
325 Ga0209813_10111244
326 Ga0268264_10000238
327 Ga0307408_100490100
328 Ga0307405_10662171
329 Ga0307413_10323591
330 Ga0307413_10566756
331 Ga0307410_10599896
332 Ga0307410_10753220
333 Ga0307407_10173078
334 Ga0307407_10476918
335 Ga0307412_10148725
336 Ga0307409_100067586
337 Ga0307409_100070976
338 Ga0307409_100226102
339 Ga0307409_100481370
340 Ga0307416_100023720
341 Ga0307416_100214598
342 Ga0307414_10410855
343 Ga0307411_10169937
344 Ga0307415_100002477
345 Ga0307415_100024657
346 Ga0373941_0073445
347 Ga0395900_0027470
348 Ga0395900_0242365
349 Ga0395900_1198253
350 Ga0395898_0091614
351 Ga0395898_0110947
352 Ga0395898_0623939
353 Ga0395905_1012813
354 Ga0395901_0083153
355 Ga0395901_0174244
356 Ga0439438_018196
357 Ga0439465_0060450
358 Ga0451795_1046045
359 Ga0451833_1091179
360 Ga0451837_0265062
361 Ga0451839_0340298
362 Ga0439445_0083913
363 Ga0439445_0105151
364 Ga0439446_0063634
365 Ga0439434_0013015
366 Ga0466969_0006733
367 Ga0466972_0106288
368 Ga0466965_0375091
369 Ga0466966_0021583
370 Ga0466966_0032735
371 Ga0466961_0003526
372 Ga0466961_0046416
373 Ga0466963_0023429
374 Ga0466971_0001159
375 Ga0466971_0416669
376 Ga0466968_0115652
377 Ga0466970_0005995
378 Ga0466957_0158406
379 Ga0466957_0334875
380 Ga0466960_0083152
381 Ga0466959_0001856
382 Ga0466959_0027904
383 Ga0466958_0051854
384 Ga0466958_0094595
385 Ga0466958_0436840
386 Ga0466967_0025380
387 Ga0466967_0036380
388 Ga0466967_0288755
389 Ga0495592_0051069
390 Ga0495592_0265186
391 Ga0495594_0091615
392 Ga0495618_0042993
393 Ga0495620_0152573
394 Ga0495652_0013192
395 Ga0495652_0040202
396 Ga0495640_0032922
397 Ga0495645_0035045
398 Ga0495667_0031045
399 Ga0495634_0011049
400 Ga0495635_0001181
401 Ga0495657_0012322
402 Ga0495623_0012260
403 Ga0495613_0011989
404 Ga0495613_0305296
405 Ga0495624_0031210
406 Ga0495600_0021888
407 Ga0495600_0030343
408 Ga0495604_0005801
409 Ga0495676_0017148
410 Ga0495675_0116593
411 Ga0496100_0052991
412 Ga0496100_0233667
413 Ga0496100_0341699
414 Ga0496101_0494890
415 Ga0496102_0150084
416 Ga0496102_0223804
417 Ga0496102_0935428
418 Ga0496103_0125406
419 Ga0496104_1147048
420 Ga0496106_0005062
421 Ga0496107_0005377
422 Ga0496109_0467821
423 Ga0496110_0334802
424 Ga0496110_0364904
425 Ga0496110_0653106
426 Ga0496114_0004517
427 Ga0496114_0022576
428 Ga0496114_0702212
429 Ga0496124_0144226
430 Ga0496126_0439490
431 Ga0501031_0141384
432 Ga0501031_0374117
433 Ga0501031_0565741
434 Ga0501032_0073603
435 Ga0501033_0402133
436 Ga0501034_0052653
437 Ga0501036_0189714
438 Ga0501037_0344280
439 Ga0501038_0002198
440 Ga0501038_0329559
441 Ga0501038_0434945
442 Ga0501038_0939892
443 Ga0501039_0037730
444 Ga0501039_0039083
445 Ga0501039_0130468
446 Ga0501039_0738989
447 Ga0501040_0016275
448 Ga0501040_0161643
449 Ga0501040_0232795
450 Ga0501040_0393267
451 Ga0501041_0097885
452 Ga0501041_0189458
453 Ga0501042_0030732
454 Ga0501042_0294048
455 Ga0501046_0086544
456 Ga0501046_0154362
457 Ga0501046_0423910
458 Ga0501046_0592741
459 Ga0501067_0061375
460 Ga0501069_0138361
461 Ga0501071_0044626
462 Ga0501071_0522062
463 Ga0501072_0070742
464 Ga0501072_0098124
465 Ga0501074_0167852
466 Ga0501075_0364023
467 Ga0501075_0780164
468 Ga0501076_0935539
469 Ga0501079_0130075
470 Ga0501079_0931093
471 Ga0501081_0468575
472 Ga0501035_0012162
473 Ga0501035_0846094
474 Ga0501044_0014483
475 Ga0501045_0209454
476 Ga0501045_0411468
477 nmdc:mga03n38_162278_c1
478 nmdc:mga03n38_302583_c1
479 nmdc:mga03n38_53385_c1
480 nmdc:mga03n38_72183_c1
481 nmdc:mga00v17_189329_c1
482 nmdc:mga00v17_49365_c1
483 nmdc:mga00v17_68362_c1
484 nmdc:mga00v17_9820_c1
485 nmdc:mga0yw44_100657_c1
486 nmdc:mga0yw44_130821_c1
487 nmdc:mga0yw44_291566_c1
488 nmdc:mga0yw44_38516_c1
489 nmdc:mga0yw44_71832_c1
490 nmdc:mga06z11_36718_c1
491 nmdc:mga06z11_373447_c1
492 nmdc:mga06z11_49855_c1
493 nmdc:mga04h51_11577_c1
494 nmdc:mga04h51_53373_c1
495 nmdc:mga07m45_299190_c1
496 nmdc:mga06r32_99042_c1
497 nmdc:mga08y16_1290371_c1
498 Ga0495612_0024615
499 Ga0500641_0056841
500 Ga0500554_014435
501 Ga0500556_0003832
502 Ga0500593_006419
503 Ga0501084_0774618
504 Ga0501082_0867491
505 Ga0466962_0000236
506 Ga0530510_0521726
507 2559429336
508 2643889141
509 2643958196
510 2644036507
511 2739367158
512 2774396848
513 2809198488
514 2855390655
515 2891969550
516 2904776220
517 2919425200
518 2919437691

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01923

Cob_adeno_trans

Cobalamin adenosyltransferase

7

158

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2g2d-assembly1.cif.gz_A crystal structure of a putative pduo-type atp:cobalamin adenosyltransferase from mycobacterium tuberculosis 0.985 17 176
2g2d-assembly1.cif.gz_A crystal structure of a putative pduo-type atp:cobalamin adenosyltransferase from mycobacterium tuberculosis 0.9729 17 176
6wgs-assembly1.cif.gz_A mycobacterium tuberculosis pduo-type atp:cobalamin adenosyltransferase bound to adenosylcobalamin 0.9648 16 176
2zhy-assembly1.cif.gz_A crystal structure of a pduo-type atp:cobalamin adenosyltransferase from burkholderia thailandensis 0.94 17 171
7ruu-assembly2.cif.gz_D structure of human atp:cobalamin adenosyltransferase r190c bound to adenosylcobalamin 0.9363 17 174
ID Description Score Start End Superfamily
2g2dA00 Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like 0.985 17 176 1.20.1200.10
2g2dA00 Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like 0.9729 17 176 1.20.1200.10
2zhzB01 Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like 0.9315 17 173 1.20.1200.10
4nwpB00 Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like 0.927 18 168 1.20.1200.10
5cy5B00 Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like 0.916 21 172 1.20.1200.10
ID Description Score Start End GO Terms
AF-A0A560AM68-F1-model_v4 deleted 0.9789 16 178
AF-A0A1C4UT39-F1-model_v4 Corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) 0.9766 16 178 GO:0005524
GO:0008817
GO:0009236
AF-A0A1J5PK13-F1-model_v4 Cob(I)yrinic acid a,c-diamide adenosyltransferase (EC 2.5.1.17) 0.9745 16 178 GO:0005524
GO:0008817
AF-A0A2S9FIJ8-F1-model_v4 Corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) 0.9718 50 175 GO:0005524
GO:0008817
GO:0009236
AF-A0A3C1P4J2-F1-model_v4 Corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) 0.9717 63 178 GO:0005524
GO:0008817
GO:0009236

Map