F368997

General Info

Members Datasets Scaffolds Average Seq Length
259 158 518 303

Family's Representative Sequence

Representative Sequence 3300042439|Ga0439464_0095688|Ga0439464_0095688_79_885
Length 268
Sequence VRLKGLMRELRLNTVCEEARCPNIGECWHHGTATFMILGDVCTRACGYCAVPHGKPTELDTAEPSRVADAVASLDLSYVVITSVDRDDLDDDGGAGIFAETIRQIRARSSSCRVEVLIPDFQGHEHPLHTVLDAGPDVLNHNTETVPSLYRLARAGGRYSRTLELLDRARKYAPSIPTKSGLMVGLGEGWDELVSTLRDLRAVGVSIVTIGQYLRPTEFHLRMERYYTPAEFAELKRIALSLGFGHVESGPLVRSSYHAHEQADALGH

Samples

Sample ID Description Type Environment
1 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
35 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
36 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
86 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
89 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
90 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
91 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
92 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
93 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
94 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
95 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
96 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
97 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
98 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
99 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
100 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
101 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
102 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
103 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
104 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
105 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
106 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
107 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
108 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
109 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
110 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
111 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
112 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
113 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
114 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
115 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
124 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
125 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
126 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
127 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
128 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
129 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
130 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
131 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
132 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
133 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
134 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
135 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
138 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
139 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
140 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
141 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
142 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
143 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
144 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
145 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
146 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
147 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
148 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
149 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
150 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
151 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
152 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
153 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
154 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
155 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
156 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
157 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
158 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.18
Nodule 0
Rhizoplane 4.63
Rhizosphere 89.19
Stem 0
Stem Tuber 0
Unclassified 1.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439464_0095688 3300042439 Bacteria 899
2 Ga0065712_10073860 3300005290 Bacteria 4259
3 Ga0065715_10104659 3300005293 Bacteria 2945
4 Ga0065715_10118845 3300005293 Bacteria 2283
5 Ga0065715_10159092 3300005293 Bacteria 1647
6 Ga0070683_100000459 3300005329 Bacteria 28517
7 Ga0070683_100240043 3300005329 Bacteria 1723
8 Ga0068869_100052432 3300005334 Bacteria 2962
9 Ga0068869_100064480 3300005334 Bacteria 2695
10 Ga0068869_100093908 3300005334 Bacteria 2260
11 Ga0070680_100094635 3300005336 Bacteria 2476
12 Ga0070680_100343288 3300005336 Bacteria 1269
13 Ga0070687_100174796 3300005343 Bacteria 1281
14 Ga0070661_100057808 3300005344 Bacteria 2842
15 Ga0070669_100044716 3300005353 Bacteria 3226
16 Ga0070669_100089168 3300005353 Bacteria 2310
17 Ga0070675_100340087 3300005354 Bacteria 1329
18 Ga0070671_100036525 3300005355 Bacteria 4074
19 Ga0070688_100347719 3300005365 Bacteria 1085
20 Ga0070659_100023126 3300005366 Bacteria 4752
21 Ga0070659_100176252 3300005366 Bacteria 1753
22 Ga0070713_100101507 3300005436 Bacteria 2493
23 Ga0070711_100246873 3300005439 Bacteria 1398
24 Ga0070705_100284778 3300005440 Bacteria 1177
25 Ga0070663_100055461 3300005455 Bacteria 2837
26 Ga0070678_100270079 3300005456 Bacteria 1434
27 Ga0070678_100321125 3300005456 Bacteria 1322
28 Ga0070662_100026381 3300005457 Bacteria 4024
29 Ga0068867_100348650 3300005459 Bacteria 1235
30 Ga0070706_100467775 3300005467 Bacteria 1173
31 Ga0070698_100589302 3300005471 Bacteria 1052
32 Ga0070699_100006866 3300005518 Bacteria 9906
33 Ga0070684_100000152 3300005535 Bacteria 47168
34 Ga0070684_100370761 3300005535 Bacteria 1318
35 Ga0070672_100061619 3300005543 Bacteria 2958
36 Ga0070695_100227104 3300005545 Bacteria 1348
37 Ga0070693_100005004 3300005547 Bacteria 6331
38 Ga0070693_100107229 3300005547 Bacteria 1712
39 Ga0068855_100121164 3300005563 Bacteria 2994
40 Ga0068852_100425341 3300005616 Bacteria 1311
41 Ga0068858_100016586 3300005842 Bacteria 6918
42 Ga0068860_100162620 3300005843 Bacteria 2153
43 Ga0075365_10016577 3300006038 Bacteria 4486
44 Ga0075364_10005990 3300006051 Bacteria 7105
45 Ga0075364_10008916 3300006051 Bacteria 6008
46 Ga0075362_10000698 3300006177 Bacteria 9911
47 Ga0075367_10003372 3300006178 Bacteria 7599
48 Ga0075367_10009494 3300006178 Bacteria 5088
49 Ga0075366_10006429 3300006195 Bacteria 6439
50 Ga0075366_10016052 3300006195 Bacteria 4300
51 Ga0097621_100000758 3300006237 Bacteria 22671
52 Ga0097621_100026808 3300006237 Bacteria 4525
53 Ga0097621_100111788 3300006237 Bacteria 2309
54 Ga0068871_100001407 3300006358 Bacteria 16107
55 Ga0068871_100045675 3300006358 Bacteria 3526
56 Ga0075428_100008001 3300006844 Bacteria 11726
57 Ga0075428_100014971 3300006844 Bacteria 8621
58 Ga0075428_100018867 3300006844 Bacteria 7628
59 Ga0075428_100204934 3300006844 Bacteria 2132
60 Ga0075430_100001260 3300006846 Bacteria 20404
61 Ga0075430_100004965 3300006846 Bacteria 11196
62 Ga0075430_100075676 3300006846 Bacteria 2822
63 Ga0075431_100042522 3300006847 Bacteria 4687
64 Ga0075431_100126177 3300006847 Bacteria 2640
65 Ga0075431_100155376 3300006847 Bacteria 2354
66 Ga0075431_100223176 3300006847 Bacteria 1922
67 Ga0075431_100335493 3300006847 Bacteria 1522
68 Ga0075433_10005213 3300006852 Bacteria 10181
69 Ga0075433_10008520 3300006852 Bacteria 8179
70 Ga0075433_10100437 3300006852 Bacteria 2562
71 Ga0075434_100001915 3300006871 Bacteria 18037
72 Ga0075434_100072227 3300006871 Bacteria 3443
73 Ga0075434_100109012 3300006871 Unclassified 2779
74 Ga0075434_100767329 3300006871 Bacteria 981
75 Ga0075429_100077012 3300006880 Bacteria 2905
76 Ga0075429_100095216 3300006880 Bacteria 2597
77 Ga0068865_100295430 3300006881 Bacteria 1295
78 Ga0075436_100120157 3300006914 Bacteria 1838
79 Ga0105240_10186181 3300009093 Bacteria 2445
80 Ga0111539_10001556 3300009094 Bacteria 30545
81 Ga0111539_10032311 3300009094 Bacteria 6356
82 Ga0111539_10083962 3300009094 Bacteria 3745
83 Ga0111539_10087913 3300009094 Bacteria 3651
84 Ga0114129_10003239 3300009147 Bacteria 22852
85 Ga0114129_10011908 3300009147 Bacteria 12370
86 Ga0114129_10035875 3300009147 Bacteria 7003
87 Ga0114129_10126715 3300009147 Bacteria 3510
88 Ga0114129_10428263 3300009147 Bacteria 1739
89 Ga0105243_10091813 3300009148 Bacteria 2501
90 Ga0105243_10479957 3300009148 Bacteria 1173
91 Ga0105248_10067140 3300009177 Bacteria 4026
92 Ga0105248_10344097 3300009177 Bacteria 1679
93 Ga0105249_10001269 3300009553 Bacteria 22136
94 Ga0105249_10039170 3300009553 Bacteria 4303
95 Ga0105249_10240362 3300009553 Bacteria 1790
96 Ga0105249_10465338 3300009553 Bacteria 1305
97 Ga0157374_10226875 3300013296 Bacteria 1834
98 Ga0157372_10212149 3300013307 Bacteria 2244
99 Ga0157372_10355925 3300013307 Bacteria 1706
100 Ga0163163_10648681 3300014325 Bacteria 1119
101 Ga0157380_10098519 3300014326 Bacteria 2429
102 Ga0157379_10039737 3300014968 Bacteria 4197
103 Ga0157379_10154822 3300014968 Bacteria 2067
104 Ga0157376_10315958 3300014969 Bacteria 1483
105 Ga0157376_10415385 3300014969 Bacteria 1304
106 Ga0207697_10012545 3300025315 Bacteria 3551
107 Ga0207710_10116836 3300025900 Bacteria 1271
108 Ga0207680_10016057 3300025903 Bacteria 3922
109 Ga0207695_10177973 3300025913 Bacteria 2049
110 Ga0207695_10205934 3300025913 Bacteria 1880
111 Ga0207649_10012453 3300025920 Bacteria 4721
112 Ga0207652_10439186 3300025921 Bacteria 1177
113 Ga0207681_10005806 3300025923 Bacteria 7572
114 Ga0207650_10082938 3300025925 Bacteria 2434
115 Ga0207650_10090779 3300025925 Bacteria 2333
116 Ga0207700_10081396 3300025928 Bacteria 2528
117 Ga0207644_10071586 3300025931 Bacteria 2537
118 Ga0207690_10392281 3300025932 Bacteria 1105
119 Ga0207706_10047250 3300025933 Bacteria 3809
120 Ga0207709_10346394 3300025935 Bacteria 1120
121 Ga0207691_10059681 3300025940 Bacteria 3468
122 Ga0207691_10173377 3300025940 Bacteria 1888
123 Ga0207711_10065506 3300025941 Bacteria 3141
124 Ga0207711_10076839 3300025941 Bacteria 2909
125 Ga0207711_10343956 3300025941 Bacteria 1381
126 Ga0207689_10026153 3300025942 Bacteria 4887
127 Ga0207689_10229940 3300025942 Bacteria 1533
128 Ga0207689_10339990 3300025942 Bacteria 1247
129 Ga0207661_10054947 3300025944 Bacteria 3192
130 Ga0207661_10059061 3300025944 Bacteria 3089
131 Ga0207661_10415140 3300025944 Bacteria 1222
132 Ga0207679_10009448 3300025945 Bacteria 6248
133 Ga0207667_10126519 3300025949 Bacteria 2632
134 Ga0207712_10001984 3300025961 Bacteria 13414
135 Ga0207677_10047641 3300026023 Bacteria 2879
136 Ga0207639_10194181 3300026041 Bacteria 1736
137 Ga0207678_10073334 3300026067 Bacteria 2934
138 Ga0207648_10153770 3300026089 Bacteria 2030
139 Ga0207676_10032781 3300026095 Bacteria 3919
140 Ga0207683_10128094 3300026121 Bacteria 2282
141 Ga0207683_10133464 3300026121 Bacteria 2234
142 Ga0207428_10215103 3300027907 Bacteria 1443
143 Ga0268265_10123111 3300028380 Bacteria 2141
144 Ga0268264_10139128 3300028381 Bacteria 2163
145 Ga0307408_100109361 3300031548 Bacteria 2120
146 Ga0316576_10097856 3300031727 Bacteria 2191
147 Ga0307413_10015830 3300031824 Bacteria 3876
148 Ga0307410_10130832 3300031852 Bacteria 1843
149 Ga0307406_10026638 3300031901 Bacteria 3475
150 Ga0307412_10094542 3300031911 Bacteria 2099
151 Ga0307409_100017911 3300031995 Bacteria 4739
152 Ga0307416_100029178 3300032002 Bacteria 4117
153 Ga0307416_100214001 3300032002 Bacteria 1841
154 Ga0307416_100357192 3300032002 Bacteria 1481
155 Ga0307411_10058995 3300032005 Bacteria 2542
156 Ga0307411_10071991 3300032005 Bacteria 2346
157 Ga0373937_0207164 3300036401 Bacteria 1844
158 Ga0373937_0235046 3300036401 Bacteria 1726
159 Ga0373925_0258363 3300037068 Bacteria 1399
160 Ga0439433_0010287 3300041999 Bacteria 2041
161 Ga0439433_0040114 3300041999 Bacteria 1088
162 Ga0450908_028558 3300042184 Bacteria 971
163 Ga0439434_0028492 3300042435 Bacteria 1691
164 Ga0453684_0019501 3300044712 Bacteria 10318
165 Ga0451576_0295757 3300045051 Bacteria 1693
166 Ga0495580_0031673 3300046472 Bacteria 3820
167 Ga0495647_0052248 3300046681 Bacteria 1591
168 Ga0496101_0033074 3300048904 Bacteria 3645
169 Ga0496102_0106281 3300048905 Bacteria 2612
170 Ga0496104_0002269 3300048907 Bacteria 16575
171 Ga0496104_0158711 3300048907 Bacteria 2170
172 Ga0496108_0009395 3300048911 Bacteria 7917
173 Ga0496109_0004515 3300048912 Bacteria 11633
174 Ga0496109_0112735 3300048912 Bacteria 2529
175 Ga0496109_0211529 3300048912 Bacteria 1824
176 Ga0496110_0016745 3300048913 Bacteria 6124
177 Ga0496111_0037723 3300048914 Bacteria 3460
178 Ga0496112_0003604 3300048915 Bacteria 12885
179 Ga0496114_0080967 3300048917 Bacteria 2743
180 Ga0501031_0272703 3300049568 Bacteria 1098
181 Ga0501034_0060346 3300049571 Bacteria 3809
182 Ga0501036_0065893 3300049572 Bacteria 3065
183 Ga0501039_0322527 3300049575 Bacteria 1214
184 Ga0501041_0056782 3300049577 Bacteria 2393
185 Ga0501041_0073043 3300049577 Bacteria 2108
186 Ga0501042_0061162 3300049578 Unclassified 2691
187 Ga0501042_0525375 3300049578 Bacteria 860
188 Ga0501047_0034025 3300049581 Bacteria 4920
189 Ga0501048_0283579 3300049582 Bacteria 1178
190 Ga0501048_0311487 3300049582 Bacteria 1121
191 Ga0501069_0042543 3300049585 Bacteria 2513
192 Ga0501069_0273679 3300049585 Bacteria 987
193 Ga0501070_0649964 3300049586 Bacteria 837
194 Ga0501072_0061207 3300049588 Bacteria 2968
195 Ga0501072_0154350 3300049588 Bacteria 1831
196 Ga0501072_0234598 3300049588 Bacteria 1461
197 Ga0501073_0022815 3300049589 Bacteria 4502
198 Ga0501073_0023380 3300049589 Bacteria 4437
199 Ga0501073_0077578 3300049589 Bacteria 2312
200 Ga0501075_0006335 3300049591 Bacteria 8134
201 Ga0501075_0016586 3300049591 Bacteria 5309
202 Ga0501076_0013691 3300049592 Bacteria 6085
203 Ga0501076_0046952 3300049592 Bacteria 3413
204 Ga0501077_0096282 3300049593 Bacteria 1876
205 Ga0501225_0038054 3300049705 Bacteria 1326
206 Ga0501079_0060634 3300049741 Bacteria 2918
207 Ga0501079_0114805 3300049741 Bacteria 2093
208 Ga0501080_0061736 3300049742 Bacteria 3489
209 Ga0501080_0108179 3300049742 Bacteria 2577
210 Ga0501080_0425424 3300049742 Bacteria 1193
211 Ga0501080_0479438 3300049742 Bacteria 1113
212 Ga0501081_0020178 3300049743 Bacteria 4442
213 Ga0501081_0055889 3300049743 Bacteria 2727
214 Ga0501081_0448645 3300049743 Bacteria 958
215 Ga0501265_015865 3300049762 Bacteria 971
216 Ga0501035_0115916 3300049822 Bacteria 2345
217 Ga0501045_0155164 3300049824 Bacteria 1703
218 Ga0501212_025656 3300049851 Bacteria 931
219 nmdc:mga03683_7605_c1 3300050489 Bacteria 3770
220 nmdc:mga00v17_64198_c1 3300050491 Bacteria 2263
221 nmdc:mga0yw44_107865_c1 3300050492 Bacteria 1781
222 nmdc:mga0yw44_65460_c1 3300050492 Bacteria 2240
223 nmdc:mga0k408_19219_c1 3300050493 Bacteria 3816
224 nmdc:mga0k408_69262_c1 3300050493 Bacteria 2059
225 nmdc:mga04h51_99925_c1 3300050495 Bacteria 1056
226 nmdc:mga07m45_4728_c1 3300050496 Bacteria 6686
227 nmdc:mga05p37_240668_c1 3300050507 Bacteria 2176
228 nmdc:mga05p37_251882_c1 3300050507 Bacteria 2118
229 nmdc:mga05p37_258224_c1 3300050507 Bacteria 2087
230 nmdc:mga05p37_41115_c1 3300050507 Bacteria 5677
231 nmdc:mga05p37_597317_c1 3300050507 Bacteria 1247
232 nmdc:mga05p37_6063_c1 3300050507 Bacteria 14228
233 nmdc:mga05p37_9250_c1 3300050507 Bacteria 11643
234 nmdc:mga09592_126889_c1 3300050508 Bacteria 2193
235 nmdc:mga09592_135200_c1 3300050508 Bacteria 2123
236 nmdc:mga0qj67_30743_c1 3300050509 Bacteria 4182
237 nmdc:mga0qj67_63692_c1 3300050509 Bacteria 2932
238 nmdc:mga0qj67_73449_c1 3300050509 Bacteria 2732
239 nmdc:mga06r32_143880_c1 3300050510 Bacteria 2361
240 nmdc:mga06r32_24566_c1 3300050510 Bacteria 5596
241 nmdc:mga06r32_3475_c1 3300050510 Bacteria 14069
242 nmdc:mga08y16_12467_c1 3300050511 Bacteria 8943
243 nmdc:mga08y16_382594_c1 3300050511 Bacteria 1442
244 nmdc:mga0n895_173841_c1 3300050512 Unclassified 2185
245 nmdc:mga08x19_182748_c1 3300050514 Bacteria 1432
246 nmdc:mga0a205_11086_c1 3300050515 Bacteria 8294
247 nmdc:mga0a205_136711_c1 3300050515 Bacteria 2351
248 nmdc:mga0a205_64016_c2 3300050515 Bacteria 2130
249 Ga0495601_0043306 3300053077 Bacteria 2827
250 Ga0501084_0034909 3300054114 Bacteria 4206
251 Ga0501084_0035445 3300054114 Bacteria 4171
252 Ga0501084_0140533 3300054114 Bacteria 2033
253 Ga0590074_000599 3300059423 Bacteria 5436
254 Ga0590075_000156 3300059424 Bacteria 18521
255 Ga0590077_000183 3300059426 Bacteria 17882
256 Ga0501082_0086792 3300060353 Bacteria 2699
257 Ga0501082_0101367 3300060353 Bacteria 2490
258 Ga0530510_0158521 3300061734 Bacteria 1673
259 Ga0530510_0461272 3300061734 Bacteria 961
260 Ga0439464_0095688
261 Ga0065712_10073860
262 Ga0065715_10104659
263 Ga0065715_10118845
264 Ga0065715_10159092
265 Ga0070683_100000459
266 Ga0070683_100240043
267 Ga0068869_100052432
268 Ga0068869_100064480
269 Ga0068869_100093908
270 Ga0070680_100094635
271 Ga0070680_100343288
272 Ga0070687_100174796
273 Ga0070661_100057808
274 Ga0070669_100044716
275 Ga0070669_100089168
276 Ga0070675_100340087
277 Ga0070671_100036525
278 Ga0070688_100347719
279 Ga0070659_100023126
280 Ga0070659_100176252
281 Ga0070713_100101507
282 Ga0070711_100246873
283 Ga0070705_100284778
284 Ga0070663_100055461
285 Ga0070678_100270079
286 Ga0070678_100321125
287 Ga0070662_100026381
288 Ga0068867_100348650
289 Ga0070706_100467775
290 Ga0070698_100589302
291 Ga0070699_100006866
292 Ga0070684_100000152
293 Ga0070684_100370761
294 Ga0070672_100061619
295 Ga0070695_100227104
296 Ga0070693_100005004
297 Ga0070693_100107229
298 Ga0068855_100121164
299 Ga0068852_100425341
300 Ga0068858_100016586
301 Ga0068860_100162620
302 Ga0075365_10016577
303 Ga0075364_10005990
304 Ga0075364_10008916
305 Ga0075362_10000698
306 Ga0075367_10003372
307 Ga0075367_10009494
308 Ga0075366_10006429
309 Ga0075366_10016052
310 Ga0097621_100000758
311 Ga0097621_100026808
312 Ga0097621_100111788
313 Ga0068871_100001407
314 Ga0068871_100045675
315 Ga0075428_100008001
316 Ga0075428_100014971
317 Ga0075428_100018867
318 Ga0075428_100204934
319 Ga0075430_100001260
320 Ga0075430_100004965
321 Ga0075430_100075676
322 Ga0075431_100042522
323 Ga0075431_100126177
324 Ga0075431_100155376
325 Ga0075431_100223176
326 Ga0075431_100335493
327 Ga0075433_10005213
328 Ga0075433_10008520
329 Ga0075433_10100437
330 Ga0075434_100001915
331 Ga0075434_100072227
332 Ga0075434_100109012
333 Ga0075434_100767329
334 Ga0075429_100077012
335 Ga0075429_100095216
336 Ga0068865_100295430
337 Ga0075436_100120157
338 Ga0105240_10186181
339 Ga0111539_10001556
340 Ga0111539_10032311
341 Ga0111539_10083962
342 Ga0111539_10087913
343 Ga0114129_10003239
344 Ga0114129_10011908
345 Ga0114129_10035875
346 Ga0114129_10126715
347 Ga0114129_10428263
348 Ga0105243_10091813
349 Ga0105243_10479957
350 Ga0105248_10067140
351 Ga0105248_10344097
352 Ga0105249_10001269
353 Ga0105249_10039170
354 Ga0105249_10240362
355 Ga0105249_10465338
356 Ga0157374_10226875
357 Ga0157372_10212149
358 Ga0157372_10355925
359 Ga0163163_10648681
360 Ga0157380_10098519
361 Ga0157379_10039737
362 Ga0157379_10154822
363 Ga0157376_10315958
364 Ga0157376_10415385
365 Ga0207697_10012545
366 Ga0207710_10116836
367 Ga0207680_10016057
368 Ga0207695_10177973
369 Ga0207695_10205934
370 Ga0207649_10012453
371 Ga0207652_10439186
372 Ga0207681_10005806
373 Ga0207650_10082938
374 Ga0207650_10090779
375 Ga0207700_10081396
376 Ga0207644_10071586
377 Ga0207690_10392281
378 Ga0207706_10047250
379 Ga0207709_10346394
380 Ga0207691_10059681
381 Ga0207691_10173377
382 Ga0207711_10065506
383 Ga0207711_10076839
384 Ga0207711_10343956
385 Ga0207689_10026153
386 Ga0207689_10229940
387 Ga0207689_10339990
388 Ga0207661_10054947
389 Ga0207661_10059061
390 Ga0207661_10415140
391 Ga0207679_10009448
392 Ga0207667_10126519
393 Ga0207712_10001984
394 Ga0207677_10047641
395 Ga0207639_10194181
396 Ga0207678_10073334
397 Ga0207648_10153770
398 Ga0207676_10032781
399 Ga0207683_10128094
400 Ga0207683_10133464
401 Ga0207428_10215103
402 Ga0268265_10123111
403 Ga0268264_10139128
404 Ga0307408_100109361
405 Ga0316576_10097856
406 Ga0307413_10015830
407 Ga0307410_10130832
408 Ga0307406_10026638
409 Ga0307412_10094542
410 Ga0307409_100017911
411 Ga0307416_100029178
412 Ga0307416_100214001
413 Ga0307416_100357192
414 Ga0307411_10058995
415 Ga0307411_10071991
416 Ga0373937_0207164
417 Ga0373937_0235046
418 Ga0373925_0258363
419 Ga0439433_0010287
420 Ga0439433_0040114
421 Ga0450908_028558
422 Ga0439434_0028492
423 Ga0453684_0019501
424 Ga0451576_0295757
425 Ga0495580_0031673
426 Ga0495647_0052248
427 Ga0496101_0033074
428 Ga0496102_0106281
429 Ga0496104_0002269
430 Ga0496104_0158711
431 Ga0496108_0009395
432 Ga0496109_0004515
433 Ga0496109_0112735
434 Ga0496109_0211529
435 Ga0496110_0016745
436 Ga0496111_0037723
437 Ga0496112_0003604
438 Ga0496114_0080967
439 Ga0501031_0272703
440 Ga0501034_0060346
441 Ga0501036_0065893
442 Ga0501039_0322527
443 Ga0501041_0056782
444 Ga0501041_0073043
445 Ga0501042_0061162
446 Ga0501042_0525375
447 Ga0501047_0034025
448 Ga0501048_0283579
449 Ga0501048_0311487
450 Ga0501069_0042543
451 Ga0501069_0273679
452 Ga0501070_0649964
453 Ga0501072_0061207
454 Ga0501072_0154350
455 Ga0501072_0234598
456 Ga0501073_0022815
457 Ga0501073_0023380
458 Ga0501073_0077578
459 Ga0501075_0006335
460 Ga0501075_0016586
461 Ga0501076_0013691
462 Ga0501076_0046952
463 Ga0501077_0096282
464 Ga0501225_0038054
465 Ga0501079_0060634
466 Ga0501079_0114805
467 Ga0501080_0061736
468 Ga0501080_0108179
469 Ga0501080_0425424
470 Ga0501080_0479438
471 Ga0501081_0020178
472 Ga0501081_0055889
473 Ga0501081_0448645
474 Ga0501265_015865
475 Ga0501035_0115916
476 Ga0501045_0155164
477 Ga0501212_025656
478 nmdc:mga03683_7605_c1
479 nmdc:mga00v17_64198_c1
480 nmdc:mga0yw44_107865_c1
481 nmdc:mga0yw44_65460_c1
482 nmdc:mga0k408_19219_c1
483 nmdc:mga0k408_69262_c1
484 nmdc:mga04h51_99925_c1
485 nmdc:mga07m45_4728_c1
486 nmdc:mga05p37_240668_c1
487 nmdc:mga05p37_251882_c1
488 nmdc:mga05p37_258224_c1
489 nmdc:mga05p37_41115_c1
490 nmdc:mga05p37_597317_c1
491 nmdc:mga05p37_6063_c1
492 nmdc:mga05p37_9250_c1
493 nmdc:mga09592_126889_c1
494 nmdc:mga09592_135200_c1
495 nmdc:mga0qj67_30743_c1
496 nmdc:mga0qj67_63692_c1
497 nmdc:mga0qj67_73449_c1
498 nmdc:mga06r32_143880_c1
499 nmdc:mga06r32_24566_c1
500 nmdc:mga06r32_3475_c1
501 nmdc:mga08y16_12467_c1
502 nmdc:mga08y16_382594_c1
503 nmdc:mga0n895_173841_c1
504 nmdc:mga08x19_182748_c1
505 nmdc:mga0a205_11086_c1
506 nmdc:mga0a205_136711_c1
507 nmdc:mga0a205_64016_c2
508 Ga0495601_0043306
509 Ga0501084_0034909
510 Ga0501084_0035445
511 Ga0501084_0140533
512 Ga0590074_000599
513 Ga0590075_000156
514 Ga0590077_000183
515 Ga0501082_0086792
516 Ga0501082_0101367
517 Ga0530510_0158521
518 Ga0530510_0461272

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04055

Radical_SAM

Radical SAM superfamily

36

200

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5exk-assembly6.cif.gz_K crystal structure of m. tuberculosis lipoyl synthase with 6-thiooctanoyl peptide intermediate 0.9695 14 302
4u0p-assembly1.cif.gz_B the crystal structure of lipoyl synthase in complex with s-adenosyl homocysteine 0.9497 18 292
5exk-assembly6.cif.gz_K crystal structure of m. tuberculosis lipoyl synthase with 6-thiooctanoyl peptide intermediate 0.9375 14 302
4u0o-assembly1.cif.gz_B crystal structure of thermosynechococcus elongatus lipoyl synthase 2 complexed with mta and dtt 0.9354 20 292
4u0o-assembly1.cif.gz_B crystal structure of thermosynechococcus elongatus lipoyl synthase 2 complexed with mta and dtt 0.9288 20 292
ID Description Score Start End Superfamily
af_P9WK91_74_280_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9883 68 276 3.20.20.70
af_P60716_82_298_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.986 63 276 3.20.20.70
af_P9WK91_74_280_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9836 68 276 3.20.20.70
af_P0CH67_115_331_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9718 57 266 3.20.20.70
af_Q2FZX4_3_265_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9713 17 271 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A520LKY5-F1-model_v4 Lipoyl synthase (EC 2.8.1.8) 0.9983 158 292 GO:0016992
GO:0046872
GO:0051539
AF-X1JI93-F1-model_v4 lipoyl synthase (EC 2.8.1.8) 0.9974 77 297 GO:0016992
GO:0046872
GO:0051539
AF-X1G6A7-F1-model_v4 lipoyl synthase (EC 2.8.1.8) 0.9973 71 298 GO:0016992
GO:0046872
GO:0051539
AF-A0A535Q8R3-F1-model_v4 Lipoyl synthase (EC 2.8.1.8) (Lip-syn) (LS) (Lipoate synthase) (Lipoic acid synthase) (Sulfur insertion protein LipA) 0.997 69 294 GO:0005737
GO:0016992
GO:0046872
GO:0051539
AF-A0A832FN80-F1-model_v4 Lipoyl synthase 0.9946 215 297 GO:0016992
GO:0051539

Map