F368924

General Info

Members Datasets Scaffolds Average Seq Length
259 152 518 302

Family's Representative Sequence

Representative Sequence 3300031731|Ga0307405_10003425|Ga0307405_100034254
Length 343
Sequence MRELVVLGTASQVPTRTRNHNGYLLRWDGEGLLFDPGEGTQRQMIHAGVSASQITRICLTHVHGDHCFGLPGVLSRMVLDGVQHPVDLHFPASGGEVVRALVSLASPGLDLRLHPHSGPGQIAPGLEVRPLRHRIETFGYRLVEPEGRTLLPGRLAAAGIAGPDIARLQREGNLGGVRLEDVSVPRPGQSFAFVMDTAECSGAEELADGVDLLVAESTFSNDDAGLAARYLHLTAGQAGALASAAGAGTLVLTHFSSRYGDVGALAKQAVTRSGGAAVVAAQDLDRIPLPGRQRDYGSPGGVWPPVGPTSVDEDVDPGAVVGVKQDQEQHEVEQQVDGHDVGQ

Samples

Sample ID Description Type Environment
1 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
2 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
3 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
4 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
5 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
6 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
7 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
8 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
9 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
10 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
11 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
12 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
13 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
14 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
15 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
16 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
17 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
18 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
19 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
20 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
21 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
22 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
23 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
24 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
25 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
26 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
27 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
28 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
29 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
30 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
31 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
32 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
33 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
34 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
35 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
36 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
37 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
38 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
39 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
40 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
41 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
42 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
43 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
44 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
45 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
46 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
47 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
48 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
49 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
50 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
51 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
52 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
53 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
54 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
55 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
56 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
57 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
58 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
59 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
60 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
61 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
62 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
63 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
64 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
65 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
66 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
67 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
68 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
69 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
70 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
71 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
72 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
73 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
74 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
75 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
76 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
77 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
78 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
79 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
80 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
81 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
82 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
83 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
84 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
85 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
86 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
87 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
88 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
89 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
90 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
91 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
92 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
93 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
94 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
95 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
96 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
97 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
98 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
99 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
100 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
101 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
102 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
103 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
104 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
105 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
106 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
107 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
108 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
109 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
110 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
111 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
112 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
113 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
116 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
117 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
118 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
119 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
120 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
121 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
122 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
123 2643221613 Oerskovia sp. Root22 Isolate Unclassified
124 2643221721 Oerskovia sp. Root918 Isolate Unclassified
125 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
126 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
127 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
128 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
129 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
130 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
131 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
132 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
133 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
134 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
135 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
136 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
137 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
138 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
139 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
140 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
141 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
142 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
143 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
144 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
145 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
146 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
147 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
148 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
149 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
150 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
151 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
152 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 87.26
Metatranscriptomes 0.39
Isolates 12.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.86
Rhizosphere 88.03
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307405_10003425 3300031731 Bacteria 7284
2 Ga0070713_100042573 3300005436 Bacteria 3707
3 Ga0070697_100117323 3300005536 Bacteria 2223
4 Ga0070696_100136173 3300005546 Bacteria 1790
5 Ga0068855_100249964 3300005563 Bacteria 1978
6 Ga0081540_1000458 3300005983 Bacteria 40511
7 Ga0075432_10004741 3300006058 Bacteria 4631
8 Ga0075429_100134552 3300006880 Bacteria 2163
9 Ga0105246_10369926 3300011119 Bacteria 1181
10 Ga0206353_10700445 3300020082 Bacteria 1698
11 Ga0213875_10002508 3300021388 Bacteria 10966
12 Ga0207685_10004989 3300025905 Bacteria 3448
13 Ga0207699_10150507 3300025906 Bacteria 1539
14 Ga0207663_10029854 3300025916 Bacteria 3208
15 Ga0207700_10240941 3300025928 Bacteria 1541
16 Ga0207664_10211439 3300025929 Bacteria 1678
17 Ga0207667_10638763 3300025949 Bacteria 1071
18 Ga0207428_10077658 3300027907 Bacteria 2600
19 Ga0307408_100003592 3300031548 Bacteria 10561
20 Ga0307408_100020429 3300031548 Bacteria 4471
21 Ga0307408_100049316 3300031548 Bacteria 3023
22 Ga0307408_100087413 3300031548 Bacteria 2345
23 Ga0307408_100256699 3300031548 Bacteria 1444
24 Ga0307405_10015395 3300031731 Bacteria 4143
25 Ga0307405_10022016 3300031731 Bacteria 3596
26 Ga0307405_10309899 3300031731 Bacteria 1201
27 Ga0307413_10010910 3300031824 Bacteria 4436
28 Ga0307413_10029634 3300031824 Bacteria 3065
29 Ga0307413_10067019 3300031824 Bacteria 2243
30 Ga0307413_10263586 3300031824 Bacteria 1286
31 Ga0307410_10009841 3300031852 Bacteria 5386
32 Ga0307410_10022167 3300031852 Bacteria 3920
33 Ga0307410_10029250 3300031852 Bacteria 3507
34 Ga0307410_10037172 3300031852 Bacteria 3177
35 Ga0307410_10040139 3300031852 Bacteria 3078
36 Ga0307410_10041319 3300031852 Bacteria 3040
37 Ga0307410_10088251 3300031852 Bacteria 2195
38 Ga0307410_10125097 3300031852 Bacteria 1881
39 Ga0307406_10163690 3300031901 Bacteria 1602
40 Ga0307407_10020245 3300031903 Bacteria 3405
41 Ga0307407_10061753 3300031903 Bacteria 2192
42 Ga0307407_10067292 3300031903 Bacteria 2116
43 Ga0307407_10123162 3300031903 Bacteria 1647
44 Ga0307407_10158611 3300031903 Bacteria 1478
45 Ga0307412_10008965 3300031911 Bacteria 5729
46 Ga0307412_10016710 3300031911 Bacteria 4377
47 Ga0307412_10026550 3300031911 Bacteria 3600
48 Ga0307412_10035308 3300031911 Bacteria 3193
49 Ga0307412_10068363 3300031911 Bacteria 2415
50 Ga0307412_10135308 3300031911 Bacteria 1797
51 Ga0307412_10179659 3300031911 Bacteria 1590
52 Ga0307412_10480330 3300031911 Bacteria 1030
53 Ga0307409_100013425 3300031995 Bacteria 5273
54 Ga0307409_100091326 3300031995 Bacteria 2495
55 Ga0307409_100259028 3300031995 Bacteria 1595
56 Ga0307416_100003414 3300032002 Bacteria 9323
57 Ga0307416_100039637 3300032002 Bacteria 3650
58 Ga0307416_100196463 3300032002 Bacteria 1909
59 Ga0307414_10022970 3300032004 Bacteria 3945
60 Ga0307414_10067013 3300032004 Bacteria 2569
61 Ga0307414_10178895 3300032004 Bacteria 1704
62 Ga0307411_10232905 3300032005 Bacteria 1437
63 Ga0307507_10000003 3300033179 Bacteria 371707
64 Ga0373958_0005201 3300034819 Bacteria 1965
65 Ga0373949_0016945 3300035090 Bacteria 1638
66 Ga0373931_0036522 3300035691 Bacteria 2561
67 Ga0373935_0063781 3300035692 Bacteria 2362
68 Ga0373933_0011246 3300035724 Bacteria 4926
69 Ga0373947_0039110 3300035725 Bacteria 2821
70 Ga0373947_0184972 3300035725 Bacteria 1358
71 Ga0373947_0454745 3300035725 Bacteria 867
72 Ga0373925_0079633 3300037068 Bacteria 2489
73 Ga0395899_0014113 3300037312 Bacteria 6097
74 Ga0395899_0033170 3300037312 Bacteria 3878
75 Ga0395899_0034982 3300037312 Bacteria 3772
76 Ga0395899_0077449 3300037312 Bacteria 2425
77 Ga0395900_0104618 3300037418 Bacteria 2908
78 Ga0395898_0035486 3300037466 Bacteria 4957
79 Ga0395898_0072198 3300037466 Bacteria 3334
80 Ga0395898_0165157 3300037466 Bacteria 2117
81 Ga0395905_0051647 3300037471 Bacteria 3851
82 Ga0395905_0226277 3300037471 Bacteria 1750
83 Ga0436364_0923522 3300037853 Bacteria 137390
84 Ga0395901_0001124 3300038443 Bacteria 28426
85 Ga0395901_0103431 3300038443 Bacteria 2988
86 Ga0395901_0174141 3300038443 Bacteria 2257
87 Ga0395901_0224466 3300038443 Bacteria 1963
88 Ga0395901_0261480 3300038443 Bacteria 1801
89 Ga0395901_0530087 3300038443 Bacteria 1195
90 Ga0439436_0000349 3300041404 Bacteria 11426
91 Ga0439436_0001557 3300041404 Bacteria 6675
92 Ga0439436_0011240 3300041404 Bacteria 2720
93 Ga0439438_019687 3300041405 Bacteria 1905
94 Ga0439439_0000323 3300041406 Bacteria 7704
95 Ga0439439_0000450 3300041406 Bacteria 6967
96 Ga0439439_0021302 3300041406 Bacteria 1615
97 Ga0439439_0023550 3300041406 Bacteria 1543
98 Ga0439439_0026929 3300041406 Bacteria 1451
99 Ga0439466_0003277 3300041411 Bacteria 6305
100 Ga0439466_0017280 3300041411 Bacteria 2600
101 Ga0439466_0073415 3300041411 Bacteria 1087
102 Ga0439465_0084147 3300041413 Bacteria 1082
103 Ga0439433_0000112 3300041999 Bacteria 11573
104 Ga0439433_0000459 3300041999 Bacteria 7520
105 Ga0439433_0000728 3300041999 Bacteria 6426
106 Ga0439433_0003072 3300041999 Bacteria 3574
107 Ga0439433_0015207 3300041999 Bacteria 1699
108 Ga0439442_000268 3300042002 Bacteria 12731
109 Ga0439442_000427 3300042002 Bacteria 9667
110 Ga0439442_000510 3300042002 Bacteria 8735
111 Ga0439442_004406 3300042002 Bacteria 2796
112 Ga0439432_003114 3300042006 Bacteria 6176
113 Ga0439432_007196 3300042006 Bacteria 3952
114 Ga0439449_0000797 3300042007 Bacteria 12155
115 Ga0439449_0001759 3300042007 Bacteria 8513
116 Ga0439449_0003237 3300042007 Bacteria 6351
117 Ga0439449_0005242 3300042007 Bacteria 4973
118 Ga0439449_0010590 3300042007 Bacteria 3484
119 Ga0439449_0060440 3300042007 Bacteria 1398
120 Ga0439449_0095307 3300042007 Bacteria 1099
121 Ga0439452_001987 3300042010 Bacteria 7825
122 Ga0439452_002166 3300042010 Bacteria 7429
123 Ga0439457_000554 3300042014 Bacteria 10919
124 Ga0439457_002349 3300042014 Bacteria 5432
125 Ga0439462_0000904 3300042015 Bacteria 6256
126 Ga0439462_0001796 3300042015 Bacteria 4849
127 Ga0439462_0038420 3300042015 Bacteria 1276
128 Ga0450919_000332 3300042121 Bacteria 5656
129 Ga0450919_000422 3300042121 Bacteria 5221
130 Ga0450919_004520 3300042121 Bacteria 1699
131 Ga0450920_003598 3300042122 Bacteria 2695
132 Ga0450920_003881 3300042122 Bacteria 2605
133 Ga0450920_013331 3300042122 Bacteria 1547
134 Ga0450920_016580 3300042122 Bacteria 1405
135 Ga0450920_019215 3300042122 Bacteria 1311
136 Ga0450907_000461 3300042146 Bacteria 11539
137 Ga0450907_004519 3300042146 Bacteria 2393
138 Ga0450907_009780 3300042146 Bacteria 1590
139 Ga0439446_0004672 3300042156 Bacteria 3478
140 Ga0450908_011487 3300042184 Bacteria 1620
141 Ga0450909_001027 3300042185 Bacteria 3837
142 Ga0439434_0000770 3300042435 Bacteria 9212
143 Ga0439434_0017221 3300042435 Bacteria 2162
144 Ga0439434_0028888 3300042435 Bacteria 1680
145 Ga0450918_001435 3300042531 Bacteria 4736
146 Ga0466965_0018748 3300044683 Bacteria 3320
147 Ga0466965_0176448 3300044683 Bacteria 1126
148 Ga0466966_0003165 3300044684 Bacteria 10831
149 Ga0466966_0098999 3300044684 Bacteria 1805
150 Ga0466961_0008574 3300044693 Bacteria 6514
151 Ga0466961_0032099 3300044693 Bacteria 3375
152 Ga0466961_0134204 3300044693 Bacteria 1551
153 Ga0466971_0128540 3300044719 Bacteria 1175
154 Ga0466971_0173549 3300044719 Bacteria 1012
155 Ga0466970_0006898 3300044765 Bacteria 5686
156 Ga0466970_0016043 3300044765 Bacteria 3857
157 Ga0466957_0091692 3300044842 Bacteria 1905
158 Ga0466960_0020794 3300044901 Bacteria 2913
159 Ga0466960_0173176 3300044901 Bacteria 1166
160 Ga0466959_0007421 3300045049 Bacteria 7693
161 Ga0466959_0025134 3300045049 Bacteria 4411
162 Ga0466959_0294455 3300045049 Bacteria 1112
163 Ga0466967_0087613 3300045976 Bacteria 2823
164 Ga0466967_0104839 3300045976 Bacteria 2589
165 Ga0495603_0100719 3300046455 Bacteria 1686
166 Ga0495629_0005515 3300046459 Bacteria 9440
167 Ga0495641_0095811 3300046461 Bacteria 1324
168 Ga0495653_0127248 3300046463 Bacteria 1807
169 Ga0495653_0245220 3300046463 Bacteria 1192
170 Ga0495580_0019325 3300046472 Bacteria 5062
171 Ga0495639_0009709 3300046475 Bacteria 4130
172 Ga0495662_0019860 3300046476 Bacteria 3250
173 Ga0495662_0035459 3300046476 Bacteria 2406
174 Ga0495594_0097872 3300046499 Bacteria 1649
175 Ga0495630_0041672 3300046517 Bacteria 3429
176 Ga0495665_0026684 3300046531 Bacteria 3102
177 Ga0495665_0036500 3300046531 Bacteria 2623
178 Ga0495586_0018480 3300046535 Bacteria 3711
179 Ga0495645_0117699 3300046543 Bacteria 1874
180 Ga0495588_0018584 3300046674 Bacteria 3392
181 Ga0495588_0031319 3300046674 Bacteria 2676
182 Ga0495588_0051277 3300046674 Bacteria 2125
183 Ga0495657_0069202 3300046675 Bacteria 2311
184 Ga0495599_0224349 3300046678 Bacteria 1149
185 Ga0495623_0064613 3300046679 Bacteria 2290
186 Ga0495646_0025479 3300046680 Bacteria 3719
187 Ga0495658_0017169 3300046683 Bacteria 3735
188 Ga0495624_0047272 3300046690 Bacteria 2735
189 Ga0495624_0075778 3300046690 Bacteria 2088
190 Ga0495670_0086328 3300046691 Bacteria 1602
191 Ga0495670_0191498 3300046691 Bacteria 1081
192 Ga0495581_0024435 3300047315 Bacteria 3501
193 Ga0495604_0039241 3300047317 Bacteria 3722
194 Ga0495604_0046323 3300047317 Bacteria 3390
195 Ga0495674_0015523 3300047319 Bacteria 7116
196 Ga0495674_0283227 3300047319 Bacteria 1357
197 Ga0495676_0302848 3300047321 Bacteria 1077
198 Ga0495685_026272 3300047447 Bacteria 2003
199 Ga0495684_0054446 3300047471 Bacteria 3051
200 Ga0495684_0120716 3300047471 Bacteria 1974
201 Ga0495593_0033353 3300047673 Bacteria 2803
202 Ga0495593_0046214 3300047673 Bacteria 2321
203 Ga0495602_0070740 3300048088 Bacteria 2983
204 Ga0495614_0021290 3300048089 Bacteria 2800
205 Ga0496100_0062616 3300048903 Bacteria 2455
206 Ga0496101_0029417 3300048904 Bacteria 3842
207 Ga0496102_0182806 3300048905 Bacteria 1975
208 Ga0496103_0226814 3300048906 Bacteria 1201
209 Ga0496105_0111417 3300048908 Bacteria 2258
210 Ga0496106_0215737 3300048909 Bacteria 1529
211 Ga0496107_0073779 3300048910 Bacteria 2482
212 Ga0496113_0364751 3300048916 Bacteria 1159
213 Ga0496115_0158506 3300048918 Bacteria 1870
214 Ga0496115_0246819 3300048918 Bacteria 1470
215 Ga0496117_0003289 3300048920 Bacteria 18938
216 Ga0496122_0000243 3300048925 Bacteria 122429
217 Ga0496125_0000015 3300048928 Bacteria 516648
218 Ga0501037_0004423 3300049573 Bacteria 10207
219 Ga0501038_0063791 3300049574 Bacteria 3143
220 Ga0501038_0476732 3300049574 Bacteria 957
221 Ga0501039_0042852 3300049575 Bacteria 3496
222 nmdc:mga05p37_1501_c1 3300050507 Bacteria 27103
223 nmdc:mga09592_107197_c1 3300050508 Bacteria 2396
224 nmdc:mga09592_61187_c1 3300050508 Bacteria 3184
225 nmdc:mga0qj67_116484_c1 3300050509 Bacteria 2159
226 Ga0495601_0217685 3300053077 Bacteria 1247
227 Ga0466962_0121684 3300061719 Bacteria 1259
228 2537898512 2537561592 Bacteria 4348607
229 2623586673 2622736626 Bacteria 7181580
230 2644082602 2643221613 Bacteria 4622396
231 2644665463 2643221721 Bacteria 4486924
232 2691514166 2690315906 Bacteria 4517044
233 2731909194 2731639228 Bacteria 4187555
234 2775656709 2775506735 Bacteria 4556596
235 2785344337 2784746763 Bacteria 9783172
236 2799185709 2799112218 Bacteria 4315149
237 2808831331 2808606357 Bacteria 4466944
238 2808852604 2808606360 Bacteria 4404006
239 2808891503 2808606370 Bacteria 4942454
240 2808896647 2808606371 Bacteria 4251511
241 2810365329 2808606700 Bacteria 3482157
242 2812320973 2811994871 Bacteria 4497550
243 2812362487 2811994880 Bacteria 4147780
244 2819742919 2818991472 Bacteria 10089953
245 2863405591 2863404153 Bacteria 9672205
246 2905926869 2905926851 Bacteria 4423176
247 2919053768 2919051321 Bacteria 4210889
248 2919393853 2919391150 Bacteria 4884741
249 2935892978 2935890801 Bacteria 4593001
250 2939598257 2939598168 Bacteria 4687164
251 2945918719 2945916053 Bacteria 4555517
252 2945921000 2945920336 Bacteria 4501603
253 2945943086 2945941187 Bacteria 4682474
254 2945959392 2945956166 Bacteria 5110334
255 2946004278 2946003308 Bacteria 3857229
256 2946038748 2946037020 Bacteria 4900426
257 2954000015 2953998280 Bacteria 4812144
258 2995471053 2995463766 Bacteria 8577691
259 8048408445 8048406513 Bacteria 8936924
260 Ga0307405_10003425
261 Ga0070713_100042573
262 Ga0070697_100117323
263 Ga0070696_100136173
264 Ga0068855_100249964
265 Ga0081540_1000458
266 Ga0075432_10004741
267 Ga0075429_100134552
268 Ga0105246_10369926
269 Ga0206353_10700445
270 Ga0213875_10002508
271 Ga0207685_10004989
272 Ga0207699_10150507
273 Ga0207663_10029854
274 Ga0207700_10240941
275 Ga0207664_10211439
276 Ga0207667_10638763
277 Ga0207428_10077658
278 Ga0307408_100003592
279 Ga0307408_100020429
280 Ga0307408_100049316
281 Ga0307408_100087413
282 Ga0307408_100256699
283 Ga0307405_10015395
284 Ga0307405_10022016
285 Ga0307405_10309899
286 Ga0307413_10010910
287 Ga0307413_10029634
288 Ga0307413_10067019
289 Ga0307413_10263586
290 Ga0307410_10009841
291 Ga0307410_10022167
292 Ga0307410_10029250
293 Ga0307410_10037172
294 Ga0307410_10040139
295 Ga0307410_10041319
296 Ga0307410_10088251
297 Ga0307410_10125097
298 Ga0307406_10163690
299 Ga0307407_10020245
300 Ga0307407_10061753
301 Ga0307407_10067292
302 Ga0307407_10123162
303 Ga0307407_10158611
304 Ga0307412_10008965
305 Ga0307412_10016710
306 Ga0307412_10026550
307 Ga0307412_10035308
308 Ga0307412_10068363
309 Ga0307412_10135308
310 Ga0307412_10179659
311 Ga0307412_10480330
312 Ga0307409_100013425
313 Ga0307409_100091326
314 Ga0307409_100259028
315 Ga0307416_100003414
316 Ga0307416_100039637
317 Ga0307416_100196463
318 Ga0307414_10022970
319 Ga0307414_10067013
320 Ga0307414_10178895
321 Ga0307411_10232905
322 Ga0307507_10000003
323 Ga0373958_0005201
324 Ga0373949_0016945
325 Ga0373931_0036522
326 Ga0373935_0063781
327 Ga0373933_0011246
328 Ga0373947_0039110
329 Ga0373947_0184972
330 Ga0373947_0454745
331 Ga0373925_0079633
332 Ga0395899_0014113
333 Ga0395899_0033170
334 Ga0395899_0034982
335 Ga0395899_0077449
336 Ga0395900_0104618
337 Ga0395898_0035486
338 Ga0395898_0072198
339 Ga0395898_0165157
340 Ga0395905_0051647
341 Ga0395905_0226277
342 Ga0436364_0923522
343 Ga0395901_0001124
344 Ga0395901_0103431
345 Ga0395901_0174141
346 Ga0395901_0224466
347 Ga0395901_0261480
348 Ga0395901_0530087
349 Ga0439436_0000349
350 Ga0439436_0001557
351 Ga0439436_0011240
352 Ga0439438_019687
353 Ga0439439_0000323
354 Ga0439439_0000450
355 Ga0439439_0021302
356 Ga0439439_0023550
357 Ga0439439_0026929
358 Ga0439466_0003277
359 Ga0439466_0017280
360 Ga0439466_0073415
361 Ga0439465_0084147
362 Ga0439433_0000112
363 Ga0439433_0000459
364 Ga0439433_0000728
365 Ga0439433_0003072
366 Ga0439433_0015207
367 Ga0439442_000268
368 Ga0439442_000427
369 Ga0439442_000510
370 Ga0439442_004406
371 Ga0439432_003114
372 Ga0439432_007196
373 Ga0439449_0000797
374 Ga0439449_0001759
375 Ga0439449_0003237
376 Ga0439449_0005242
377 Ga0439449_0010590
378 Ga0439449_0060440
379 Ga0439449_0095307
380 Ga0439452_001987
381 Ga0439452_002166
382 Ga0439457_000554
383 Ga0439457_002349
384 Ga0439462_0000904
385 Ga0439462_0001796
386 Ga0439462_0038420
387 Ga0450919_000332
388 Ga0450919_000422
389 Ga0450919_004520
390 Ga0450920_003598
391 Ga0450920_003881
392 Ga0450920_013331
393 Ga0450920_016580
394 Ga0450920_019215
395 Ga0450907_000461
396 Ga0450907_004519
397 Ga0450907_009780
398 Ga0439446_0004672
399 Ga0450908_011487
400 Ga0450909_001027
401 Ga0439434_0000770
402 Ga0439434_0017221
403 Ga0439434_0028888
404 Ga0450918_001435
405 Ga0466965_0018748
406 Ga0466965_0176448
407 Ga0466966_0003165
408 Ga0466966_0098999
409 Ga0466961_0008574
410 Ga0466961_0032099
411 Ga0466961_0134204
412 Ga0466971_0128540
413 Ga0466971_0173549
414 Ga0466970_0006898
415 Ga0466970_0016043
416 Ga0466957_0091692
417 Ga0466960_0020794
418 Ga0466960_0173176
419 Ga0466959_0007421
420 Ga0466959_0025134
421 Ga0466959_0294455
422 Ga0466967_0087613
423 Ga0466967_0104839
424 Ga0495603_0100719
425 Ga0495629_0005515
426 Ga0495641_0095811
427 Ga0495653_0127248
428 Ga0495653_0245220
429 Ga0495580_0019325
430 Ga0495639_0009709
431 Ga0495662_0019860
432 Ga0495662_0035459
433 Ga0495594_0097872
434 Ga0495630_0041672
435 Ga0495665_0026684
436 Ga0495665_0036500
437 Ga0495586_0018480
438 Ga0495645_0117699
439 Ga0495588_0018584
440 Ga0495588_0031319
441 Ga0495588_0051277
442 Ga0495657_0069202
443 Ga0495599_0224349
444 Ga0495623_0064613
445 Ga0495646_0025479
446 Ga0495658_0017169
447 Ga0495624_0047272
448 Ga0495624_0075778
449 Ga0495670_0086328
450 Ga0495670_0191498
451 Ga0495581_0024435
452 Ga0495604_0039241
453 Ga0495604_0046323
454 Ga0495674_0015523
455 Ga0495674_0283227
456 Ga0495676_0302848
457 Ga0495685_026272
458 Ga0495684_0054446
459 Ga0495684_0120716
460 Ga0495593_0033353
461 Ga0495593_0046214
462 Ga0495602_0070740
463 Ga0495614_0021290
464 Ga0496100_0062616
465 Ga0496101_0029417
466 Ga0496102_0182806
467 Ga0496103_0226814
468 Ga0496105_0111417
469 Ga0496106_0215737
470 Ga0496107_0073779
471 Ga0496113_0364751
472 Ga0496115_0158506
473 Ga0496115_0246819
474 Ga0496117_0003289
475 Ga0496122_0000243
476 Ga0496125_0000015
477 Ga0501037_0004423
478 Ga0501038_0063791
479 Ga0501038_0476732
480 Ga0501039_0042852
481 nmdc:mga05p37_1501_c1
482 nmdc:mga09592_107197_c1
483 nmdc:mga09592_61187_c1
484 nmdc:mga0qj67_116484_c1
485 Ga0495601_0217685
486 Ga0466962_0121684
487 2537898512
488 2623586673
489 2644082602
490 2644665463
491 2691514166
492 2731909194
493 2775656709
494 2785344337
495 2799185709
496 2808831331
497 2808852604
498 2808891503
499 2808896647
500 2810365329
501 2812320973
502 2812362487
503 2819742919
504 2863405591
505 2905926869
506 2919053768
507 2919393853
508 2935892978
509 2939598257
510 2945918719
511 2945921000
512 2945943086
513 2945959392
514 2946004278
515 2946038748
516 2954000015
517 2995471053
518 8048408445

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

15

152

0.82

PF12706

Lactamase_B_2

Beta-lactamase superfamily domain

31

255

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fk6-assembly1.cif.gz_A-2 crystal structure of rnase z/trna(thr) complex 0.9025 5 303
4gcw-assembly1.cif.gz_A crystal structure of rnase z in complex with precursor trna(thr) 0.9013 5 306
1y44-assembly1.cif.gz_A crystal structure of rnase z 0.9013 5 303
1y44-assembly1.cif.gz_A crystal structure of rnase z 0.8885 5 303
4gcw-assembly1.cif.gz_A crystal structure of rnase z in complex with precursor trna(thr) 0.8847 5 306
ID Description Score Start End Superfamily
1y44B00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8709 5 306 3.60.15.10
1y44B00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8681 5 306 3.60.15.10
af_Q2FY67_1_306_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8629 5 300 3.60.15.10
af_D3ZB91_3_360_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8619 5 304 3.60.15.10
af_P0A8V0_1_305_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8587 5 302 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A0B8NLV8-F1-model_v4 Ribonuclease Z 0.9687 207 306 GO:0042781
AF-R5SQ69-F1-model_v4 deleted 0.9654 203 302
AF-A0A0B8NLV8-F1-model_v4 Ribonuclease Z 0.9592 207 306 GO:0042781
AF-A0A1C4L2F2-F1-model_v4 deleted 0.9482 158 303
AF-A0A379W6U3-F1-model_v4 Ribonuclease Z (EC 3.1.-.-) 0.9471 198 302 GO:0042781

Map