F368862

General Info

Members Datasets Scaffolds Average Seq Length
259 144 518 199

Family's Representative Sequence

Representative Sequence 3300025910|Ga0207684_10094947|Ga0207684_100949471
Length 220
Sequence MLLVLDNYDSFTYNLVQYAGELGAEPVVYRNDTLSVHDALALQPAAIVISPGPGTPCEAGISVPLVRAAAEAGVPLLGVCLGHQAIGEAFGGRVVRADRLMHGKTTMVAHTCHPLFDGLPSPVEVMRYHSLVVAPAGLPDELEVTAWSDDRPAGSEIMALCHRDLPVYGVQFHPESVGTDRGKRILVNFLELARGGFARSHPERSEGAMIQGMPPSLRSG

Samples

Sample ID Description Type Environment
1 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
54 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
55 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
56 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
57 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
58 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
59 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
60 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
61 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
62 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
63 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
64 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
65 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
66 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
67 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
68 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
69 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
70 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
71 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
72 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
73 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
74 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
75 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
76 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
77 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
78 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
79 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
80 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
81 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
82 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
83 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
84 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
85 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
86 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
87 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
88 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
89 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
90 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
91 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
92 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
93 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
94 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
95 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
100 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
104 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
105 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
106 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
107 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
108 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
109 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
110 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
111 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
112 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
113 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
114 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
115 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
116 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
117 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
118 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
119 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
120 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
121 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
122 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
123 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
124 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
125 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
126 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
127 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
128 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
129 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
131 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
132 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
133 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
134 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
135 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
136 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
137 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
138 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
139 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
140 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
141 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
142 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
143 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
144 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 11.97
Rhizosphere 87.64
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207684_10094947 3300025910 Bacteria 2544
2 MBSR1b_contig_4169532 2162886012 Bacteria 958
3 Ga0065715_10237665 3300005293 Bacteria 1210
4 Ga0070680_100101947 3300005336 Bacteria 2383
5 Ga0070680_100246767 3300005336 Bacteria 1509
6 Ga0070687_100321418 3300005343 Bacteria 989
7 Ga0070659_100030871 3300005366 Bacteria 4148
8 Ga0070709_10006550 3300005434 Bacteria 6352
9 Ga0070701_10255858 3300005438 Bacteria 1059
10 Ga0070705_100036408 3300005440 Bacteria 2767
11 Ga0070694_100069071 3300005444 Bacteria 2429
12 Ga0070708_100006756 3300005445 Bacteria 9139
13 Ga0070708_100784021 3300005445 Bacteria 896
14 Ga0070706_100031483 3300005467 Bacteria 4891
15 Ga0070698_100201338 3300005471 Bacteria 1927
16 Ga0070699_100010669 3300005518 Bacteria 7951
17 Ga0070699_100052433 3300005518 Bacteria 3530
18 Ga0070679_100298534 3300005530 Bacteria 1561
19 Ga0070679_100377295 3300005530 Bacteria 1365
20 Ga0070684_100118085 3300005535 Bacteria 2384
21 Ga0070697_100001282 3300005536 Bacteria 18927
22 Ga0070686_100411346 3300005544 Bacteria 1031
23 Ga0070695_100365392 3300005545 Bacteria 1085
24 Ga0070696_100000510 3300005546 Bacteria 24577
25 Ga0070696_100682236 3300005546 Bacteria 836
26 Ga0070696_101110984 3300005546 Bacteria 665
27 Ga0070693_100193719 3300005547 Bacteria 1316
28 Ga0070665_100514826 3300005548 Bacteria 1208
29 Ga0070704_100078455 3300005549 Bacteria 2423
30 Ga0070704_100156585 3300005549 Bacteria 1797
31 Ga0070664_100139179 3300005564 Bacteria 2136
32 Ga0070664_100782321 3300005564 Bacteria 892
33 Ga0068854_100413250 3300005578 Bacteria 1119
34 Ga0070702_100039671 3300005615 Bacteria 2629
35 Ga0068861_100956505 3300005719 Bacteria 815
36 Ga0068863_100335788 3300005841 Bacteria 1469
37 Ga0068862_100438742 3300005844 Bacteria 1229
38 Ga0081455_10092721 3300005937 Bacteria 2443
39 Ga0070716_100285353 3300006173 Bacteria 1141
40 Ga0075430_100063432 3300006846 Bacteria 3104
41 Ga0075431_100013935 3300006847 Bacteria 8120
42 Ga0075433_10121963 3300006852 Bacteria 2315
43 Ga0075433_10187535 3300006852 Bacteria 1840
44 Ga0075434_100272108 3300006871 Bacteria 1713
45 Ga0075434_100501930 3300006871 Bacteria 1234
46 Ga0075436_100011260 3300006914 Bacteria 6136
47 Ga0075436_100410441 3300006914 Bacteria 982
48 Ga0075436_100413982 3300006914 Bacteria 978
49 Ga0075435_100096678 3300007076 Bacteria 2443
50 Ga0075435_100219559 3300007076 Bacteria 1614
51 Ga0075435_100257326 3300007076 Bacteria 1487
52 Ga0111539_10305345 3300009094 Bacteria 1852
53 Ga0111539_10525539 3300009094 Bacteria 1378
54 Ga0114129_10001639 3300009147 Bacteria 30412
55 Ga0114129_10088727 3300009147 Bacteria 4287
56 Ga0114129_10199252 3300009147 Bacteria 2713
57 Ga0114129_10461008 3300009147 Bacteria 1665
58 Ga0114129_10553799 3300009147 Bacteria 1495
59 Ga0114129_11243166 3300009147 Bacteria 926
60 Ga0105237_10153519 3300009545 Bacteria 2299
61 Ga0105239_10733288 3300010375 Bacteria 1131
62 Ga0163163_10202408 3300014325 Bacteria 2034
63 Ga0207699_10008584 3300025906 Bacteria 5049
64 Ga0207684_10023751 3300025910 Bacteria 5232
65 Ga0207660_10074734 3300025917 Bacteria 2474
66 Ga0207662_10250271 3300025918 Bacteria 1163
67 Ga0207652_10079831 3300025921 Bacteria 2859
68 Ga0207646_10013858 3300025922 Bacteria 7689
69 Ga0207690_10139234 3300025932 Bacteria 1786
70 Ga0207706_10402267 3300025933 Bacteria 1187
71 Ga0207678_10062246 3300026067 Bacteria 3209
72 Ga0207678_10085299 3300026067 Bacteria 2700
73 Ga0207708_10020260 3300026075 Bacteria 5016
74 Ga0207641_10293001 3300026088 Bacteria 1534
75 Ga0207641_10371167 3300026088 Bacteria 1368
76 Ga0209999_1014213 3300027543 Bacteria 1445
77 Ga0209971_1072207 3300027682 Bacteria 838
78 Ga0207428_10108834 3300027907 Bacteria 2134
79 Ga0207428_10608129 3300027907 Bacteria 787
80 Ga0307408_100042002 3300031548 Bacteria 3245
81 Ga0307408_100102918 3300031548 Bacteria 2179
82 Ga0307408_100279069 3300031548 Bacteria 1391
83 Ga0307408_100291369 3300031548 Bacteria 1363
84 Ga0307405_10048741 3300031731 Bacteria 2614
85 Ga0307405_10103574 3300031731 Bacteria 1914
86 Ga0307405_10111062 3300031731 Bacteria 1857
87 Ga0307405_10386118 3300031731 Bacteria 1092
88 Ga0307413_10009955 3300031824 Bacteria 4581
89 Ga0307413_10544275 3300031824 Bacteria 940
90 Ga0307410_10016137 3300031852 Bacteria 4447
91 Ga0307410_10019545 3300031852 Bacteria 4124
92 Ga0307410_10050829 3300031852 Bacteria 2790
93 Ga0307410_10077461 3300031852 Bacteria 2324
94 Ga0307406_10060522 3300031901 Bacteria 2442
95 Ga0307406_10074312 3300031901 Bacteria 2238
96 Ga0307406_10131989 3300031901 Bacteria 1755
97 Ga0307407_10006080 3300031903 Bacteria 5321
98 Ga0307407_10194174 3300031903 Bacteria 1355
99 Ga0307412_10082770 3300031911 Bacteria 2223
100 Ga0307412_10934505 3300031911 Bacteria 762
101 Ga0307409_100012924 3300031995 Bacteria 5345
102 Ga0307409_100014801 3300031995 Bacteria 5091
103 Ga0307409_100019920 3300031995 Bacteria 4557
104 Ga0307409_100075270 3300031995 Bacteria 2702
105 Ga0307409_100773975 3300031995 Bacteria 965
106 Ga0307409_101364431 3300031995 Bacteria 735
107 Ga0307416_100007449 3300032002 Bacteria 6962
108 Ga0307416_100018471 3300032002 Bacteria 4911
109 Ga0307416_100058897 3300032002 Bacteria 3118
110 Ga0307416_100113754 3300032002 Bacteria 2392
111 Ga0307416_100215269 3300032002 Bacteria 1837
112 Ga0307416_100388272 3300032002 Bacteria 1429
113 Ga0307416_100454448 3300032002 Bacteria 1334
114 Ga0307414_10021785 3300032004 Bacteria 4031
115 Ga0307414_10024179 3300032004 Bacteria 3869
116 Ga0307414_10034386 3300032004 Bacteria 3360
117 Ga0307414_10060482 3300032004 Bacteria 2679
118 Ga0307414_10174700 3300032004 Bacteria 1721
119 Ga0307414_10501135 3300032004 Bacteria 1074
120 Ga0307411_10000833 3300032005 Bacteria 11538
121 Ga0307411_10001631 3300032005 Bacteria 9360
122 Ga0307411_10004742 3300032005 Bacteria 6574
123 Ga0307411_10018462 3300032005 Bacteria 4002
124 Ga0307411_10061460 3300032005 Bacteria 2501
125 Ga0307411_10210612 3300032005 Bacteria 1500
126 Ga0307411_10229031 3300032005 Bacteria 1447
127 Ga0307415_100000666 3300032126 Bacteria 15183
128 Ga0307415_100078663 3300032126 Bacteria 2346
129 Ga0373929_0015139 3300035085 Bacteria 1497
130 Ga0373940_0005412 3300035088 Bacteria 2765
131 Ga0373931_0480174 3300035691 Bacteria 799
132 Ga0373925_0709710 3300037068 Bacteria 829
133 Ga0395900_0883006 3300037418 Bacteria 818
134 Ga0395905_0035078 3300037471 Bacteria 4710
135 Ga0395905_0035774 3300037471 Bacteria 4664
136 Ga0395901_0634765 3300038443 Bacteria 1073
137 Ga0242420_081944 3300038996 Bacteria 667
138 Ga0400483_169765 3300039062 Eukaryota 2534
139 Ga0451800_0522091 3300041459 Bacteria 1565
140 Ga0439444_0083783 3300042437 Bacteria 702
141 Ga0453683_0014663 3300044673 Bacteria 5086
142 Ga0466960_0131385 3300044901 Bacteria 1322
143 Ga0495580_0116734 3300046472 Bacteria 1854
144 Ga0496100_0490477 3300048903 Bacteria 946
145 Ga0496102_0063781 3300048905 Bacteria 3374
146 Ga0496102_0285360 3300048905 Bacteria 1556
147 Ga0496103_0344272 3300048906 Bacteria 959
148 Ga0496104_0041985 3300048907 Bacteria 4290
149 Ga0496104_0105645 3300048907 Bacteria 2698
150 Ga0496105_0466321 3300048908 Bacteria 995
151 Ga0496106_0190410 3300048909 Bacteria 1631
152 Ga0496106_0297943 3300048909 Bacteria 1293
153 Ga0496106_0671322 3300048909 Bacteria 827
154 Ga0496107_0150054 3300048910 Bacteria 1724
155 Ga0496108_0013813 3300048911 Bacteria 6587
156 Ga0496108_0035533 3300048911 Bacteria 4143
157 Ga0496108_0405117 3300048911 Bacteria 1191
158 Ga0496108_0845961 3300048911 Bacteria 787
159 Ga0496109_0002726 3300048912 Bacteria 14805
160 Ga0496109_0018087 3300048912 Bacteria 6189
161 Ga0496109_0078318 3300048912 Bacteria 3043
162 Ga0496109_0079026 3300048912 Bacteria 3030
163 Ga0496109_0271427 3300048912 Bacteria 1598
164 Ga0496109_0588566 3300048912 Bacteria 1048
165 Ga0496110_0037327 3300048913 Bacteria 4223
166 Ga0496110_0054164 3300048913 Bacteria 3528
167 Ga0496111_0017950 3300048914 Bacteria 4894
168 Ga0496112_0003261 3300048915 Bacteria 13389
169 Ga0496112_0006611 3300048915 Bacteria 10206
170 Ga0496112_0399721 3300048915 Bacteria 1314
171 Ga0496113_0006320 3300048916 Bacteria 7497
172 Ga0496113_0008975 3300048916 Bacteria 6545
173 Ga0496113_0040037 3300048916 Bacteria 3452
174 Ga0501031_0371739 3300049568 Bacteria 925
175 Ga0501031_0468243 3300049568 Bacteria 814
176 Ga0501036_0016307 3300049572 Bacteria 6208
177 Ga0501039_0014570 3300049575 Bacteria 6021
178 Ga0501040_0055197 3300049576 Bacteria 2724
179 Ga0501040_0066163 3300049576 Bacteria 2490
180 Ga0501041_0034817 3300049577 Bacteria 3050
181 Ga0501041_0109089 3300049577 Bacteria 1717
182 Ga0501041_0110126 3300049577 Bacteria 1708
183 Ga0501042_0018986 3300049578 Bacteria 4770
184 Ga0501043_0197611 3300049579 Bacteria 1562
185 Ga0501046_0479633 3300049580 Bacteria 892
186 Ga0501067_0062992 3300049583 Bacteria 2053
187 Ga0501067_0180249 3300049583 Bacteria 1177
188 Ga0501068_0417323 3300049584 Bacteria 866
189 Ga0501069_0048750 3300049585 Bacteria 2353
190 Ga0501069_0211856 3300049585 Bacteria 1125
191 Ga0501070_0568418 3300049586 Bacteria 906
192 Ga0501071_0089775 3300049587 Bacteria 2256
193 Ga0501072_0054417 3300049588 Bacteria 3153
194 Ga0501072_0076214 3300049588 Bacteria 2653
195 Ga0501072_0275772 3300049588 Bacteria 1338
196 Ga0501074_0054937 3300049590 Bacteria 2871
197 Ga0501075_0003457 3300049591 Bacteria 10559
198 Ga0501075_0031838 3300049591 Bacteria 3917
199 Ga0501076_0317384 3300049592 Bacteria 1278
200 Ga0501076_0379582 3300049592 Bacteria 1162
201 Ga0501077_0000313 3300049593 Bacteria 28906
202 Ga0501077_0001408 3300049593 Bacteria 14458
203 Ga0501216_004059 3300049660 Bacteria 2160
204 Ga0501217_091025 3300049661 Bacteria 856
205 Ga0501235_081011 3300049669 Bacteria 776
206 Ga0501239_001095 3300049672 Bacteria 2255
207 Ga0501243_012883 3300049675 Bacteria 1324
208 Ga0501249_001273 3300049679 Bacteria 5278
209 Ga0501258_011066 3300049687 Bacteria 963
210 Ga0501079_0221171 3300049741 Bacteria 1479
211 Ga0501080_0183811 3300049742 Bacteria 1923
212 Ga0501080_1060085 3300049742 Bacteria 701
213 Ga0501081_0018835 3300049743 Bacteria 4586
214 Ga0501081_0020781 3300049743 Bacteria 4379
215 Ga0501081_0028482 3300049743 Bacteria 3770
216 Ga0501083_0053706 3300049744 Bacteria 2705
217 Ga0501083_0277575 3300049744 Bacteria 1090
218 Ga0501083_0326405 3300049744 Bacteria 998
219 Ga0501263_004949 3300049760 Bacteria 1488
220 Ga0501268_000441 3300049765 Bacteria 4483
221 Ga0501268_032663 3300049765 Bacteria 949
222 Ga0501272_000867 3300049769 Bacteria 2757
223 Ga0501273_002228 3300049770 Bacteria 1956
224 Ga0501283_023164 3300049779 Bacteria 1006
225 Ga0501044_0404744 3300049823 Bacteria 1277
226 Ga0501045_0034067 3300049824 Bacteria 3695
227 Ga0501045_0045016 3300049824 Bacteria 3213
228 Ga0501045_0137510 3300049824 Bacteria 1817
229 Ga0501045_0503814 3300049824 Bacteria 899
230 nmdc:mga05p37_213421_c1 3300050507 Bacteria 2332
231 nmdc:mga05p37_382584_c1 3300050507 Bacteria 1648
232 nmdc:mga05p37_541731_c1 3300050507 Bacteria 1327
233 nmdc:mga05p37_7243_c1 3300050507 Bacteria 13086
234 nmdc:mga0qj67_16159_c1 3300050509 Bacteria 5655
235 nmdc:mga0qj67_486596_c1 3300050509 Bacteria 992
236 nmdc:mga0qj67_864575_c1 3300050509 Bacteria 714
237 nmdc:mga06r32_123880_c1 3300050510 Bacteria 2551
238 nmdc:mga06r32_581298_c1 3300050510 Bacteria 1092
239 nmdc:mga08y16_125913_c1 3300050511 Bacteria 2665
240 nmdc:mga08y16_390632_c1 3300050511 Bacteria 1425
241 nmdc:mga0n895_34116_c1 3300050512 Bacteria 4896
242 nmdc:mga0n895_34203_c1 3300050512 Bacteria 4890
243 nmdc:mga0n895_911031_c1 3300050512 Bacteria 864
244 nmdc:mga0rr50_142424_c1 3300050513 Bacteria 1930
245 nmdc:mga0rr50_253173_c1 3300050513 Bacteria 1463
246 nmdc:mga0rr50_256353_c1 3300050513 Bacteria 1454
247 nmdc:mga08x19_12440_c1 3300050514 Bacteria 5127
248 nmdc:mga0a205_38478_c1 3300050515 Bacteria 4602
249 nmdc:mga0a205_91660_c1 3300050515 Bacteria 1112
250 Ga0501084_0002209 3300054114 Bacteria 15613
251 Ga0501084_0019646 3300054114 Bacteria 5630
252 Ga0501084_0147304 3300054114 Bacteria 1983
253 Ga0590071_001444 3300059421 Bacteria 6267
254 Ga0590075_034641 3300059424 Bacteria 1284
255 Ga0590077_007057 3300059426 Bacteria 2301
256 Ga0590077_026582 3300059426 Bacteria 1251
257 Ga0501082_0469735 3300060353 Bacteria 1099
258 Ga0530510_0069939 3300061734 Bacteria 2547
259 Ga0530510_0250010 3300061734 Bacteria 1321
260 Ga0207684_10094947
261 MBSR1b_contig_4169532
262 Ga0065715_10237665
263 Ga0070680_100101947
264 Ga0070680_100246767
265 Ga0070687_100321418
266 Ga0070659_100030871
267 Ga0070709_10006550
268 Ga0070701_10255858
269 Ga0070705_100036408
270 Ga0070694_100069071
271 Ga0070708_100006756
272 Ga0070708_100784021
273 Ga0070706_100031483
274 Ga0070698_100201338
275 Ga0070699_100010669
276 Ga0070699_100052433
277 Ga0070679_100298534
278 Ga0070679_100377295
279 Ga0070684_100118085
280 Ga0070697_100001282
281 Ga0070686_100411346
282 Ga0070695_100365392
283 Ga0070696_100000510
284 Ga0070696_100682236
285 Ga0070696_101110984
286 Ga0070693_100193719
287 Ga0070665_100514826
288 Ga0070704_100078455
289 Ga0070704_100156585
290 Ga0070664_100139179
291 Ga0070664_100782321
292 Ga0068854_100413250
293 Ga0070702_100039671
294 Ga0068861_100956505
295 Ga0068863_100335788
296 Ga0068862_100438742
297 Ga0081455_10092721
298 Ga0070716_100285353
299 Ga0075430_100063432
300 Ga0075431_100013935
301 Ga0075433_10121963
302 Ga0075433_10187535
303 Ga0075434_100272108
304 Ga0075434_100501930
305 Ga0075436_100011260
306 Ga0075436_100410441
307 Ga0075436_100413982
308 Ga0075435_100096678
309 Ga0075435_100219559
310 Ga0075435_100257326
311 Ga0111539_10305345
312 Ga0111539_10525539
313 Ga0114129_10001639
314 Ga0114129_10088727
315 Ga0114129_10199252
316 Ga0114129_10461008
317 Ga0114129_10553799
318 Ga0114129_11243166
319 Ga0105237_10153519
320 Ga0105239_10733288
321 Ga0163163_10202408
322 Ga0207699_10008584
323 Ga0207684_10023751
324 Ga0207660_10074734
325 Ga0207662_10250271
326 Ga0207652_10079831
327 Ga0207646_10013858
328 Ga0207690_10139234
329 Ga0207706_10402267
330 Ga0207678_10062246
331 Ga0207678_10085299
332 Ga0207708_10020260
333 Ga0207641_10293001
334 Ga0207641_10371167
335 Ga0209999_1014213
336 Ga0209971_1072207
337 Ga0207428_10108834
338 Ga0207428_10608129
339 Ga0307408_100042002
340 Ga0307408_100102918
341 Ga0307408_100279069
342 Ga0307408_100291369
343 Ga0307405_10048741
344 Ga0307405_10103574
345 Ga0307405_10111062
346 Ga0307405_10386118
347 Ga0307413_10009955
348 Ga0307413_10544275
349 Ga0307410_10016137
350 Ga0307410_10019545
351 Ga0307410_10050829
352 Ga0307410_10077461
353 Ga0307406_10060522
354 Ga0307406_10074312
355 Ga0307406_10131989
356 Ga0307407_10006080
357 Ga0307407_10194174
358 Ga0307412_10082770
359 Ga0307412_10934505
360 Ga0307409_100012924
361 Ga0307409_100014801
362 Ga0307409_100019920
363 Ga0307409_100075270
364 Ga0307409_100773975
365 Ga0307409_101364431
366 Ga0307416_100007449
367 Ga0307416_100018471
368 Ga0307416_100058897
369 Ga0307416_100113754
370 Ga0307416_100215269
371 Ga0307416_100388272
372 Ga0307416_100454448
373 Ga0307414_10021785
374 Ga0307414_10024179
375 Ga0307414_10034386
376 Ga0307414_10060482
377 Ga0307414_10174700
378 Ga0307414_10501135
379 Ga0307411_10000833
380 Ga0307411_10001631
381 Ga0307411_10004742
382 Ga0307411_10018462
383 Ga0307411_10061460
384 Ga0307411_10210612
385 Ga0307411_10229031
386 Ga0307415_100000666
387 Ga0307415_100078663
388 Ga0373929_0015139
389 Ga0373940_0005412
390 Ga0373931_0480174
391 Ga0373925_0709710
392 Ga0395900_0883006
393 Ga0395905_0035078
394 Ga0395905_0035774
395 Ga0395901_0634765
396 Ga0242420_081944
397 Ga0400483_169765
398 Ga0451800_0522091
399 Ga0439444_0083783
400 Ga0453683_0014663
401 Ga0466960_0131385
402 Ga0495580_0116734
403 Ga0496100_0490477
404 Ga0496102_0063781
405 Ga0496102_0285360
406 Ga0496103_0344272
407 Ga0496104_0041985
408 Ga0496104_0105645
409 Ga0496105_0466321
410 Ga0496106_0190410
411 Ga0496106_0297943
412 Ga0496106_0671322
413 Ga0496107_0150054
414 Ga0496108_0013813
415 Ga0496108_0035533
416 Ga0496108_0405117
417 Ga0496108_0845961
418 Ga0496109_0002726
419 Ga0496109_0018087
420 Ga0496109_0078318
421 Ga0496109_0079026
422 Ga0496109_0271427
423 Ga0496109_0588566
424 Ga0496110_0037327
425 Ga0496110_0054164
426 Ga0496111_0017950
427 Ga0496112_0003261
428 Ga0496112_0006611
429 Ga0496112_0399721
430 Ga0496113_0006320
431 Ga0496113_0008975
432 Ga0496113_0040037
433 Ga0501031_0371739
434 Ga0501031_0468243
435 Ga0501036_0016307
436 Ga0501039_0014570
437 Ga0501040_0055197
438 Ga0501040_0066163
439 Ga0501041_0034817
440 Ga0501041_0109089
441 Ga0501041_0110126
442 Ga0501042_0018986
443 Ga0501043_0197611
444 Ga0501046_0479633
445 Ga0501067_0062992
446 Ga0501067_0180249
447 Ga0501068_0417323
448 Ga0501069_0048750
449 Ga0501069_0211856
450 Ga0501070_0568418
451 Ga0501071_0089775
452 Ga0501072_0054417
453 Ga0501072_0076214
454 Ga0501072_0275772
455 Ga0501074_0054937
456 Ga0501075_0003457
457 Ga0501075_0031838
458 Ga0501076_0317384
459 Ga0501076_0379582
460 Ga0501077_0000313
461 Ga0501077_0001408
462 Ga0501216_004059
463 Ga0501217_091025
464 Ga0501235_081011
465 Ga0501239_001095
466 Ga0501243_012883
467 Ga0501249_001273
468 Ga0501258_011066
469 Ga0501079_0221171
470 Ga0501080_0183811
471 Ga0501080_1060085
472 Ga0501081_0018835
473 Ga0501081_0020781
474 Ga0501081_0028482
475 Ga0501083_0053706
476 Ga0501083_0277575
477 Ga0501083_0326405
478 Ga0501263_004949
479 Ga0501268_000441
480 Ga0501268_032663
481 Ga0501272_000867
482 Ga0501273_002228
483 Ga0501283_023164
484 Ga0501044_0404744
485 Ga0501045_0034067
486 Ga0501045_0045016
487 Ga0501045_0137510
488 Ga0501045_0503814
489 nmdc:mga05p37_213421_c1
490 nmdc:mga05p37_382584_c1
491 nmdc:mga05p37_541731_c1
492 nmdc:mga05p37_7243_c1
493 nmdc:mga0qj67_16159_c1
494 nmdc:mga0qj67_486596_c1
495 nmdc:mga0qj67_864575_c1
496 nmdc:mga06r32_123880_c1
497 nmdc:mga06r32_581298_c1
498 nmdc:mga08y16_125913_c1
499 nmdc:mga08y16_390632_c1
500 nmdc:mga0n895_34116_c1
501 nmdc:mga0n895_34203_c1
502 nmdc:mga0n895_911031_c1
503 nmdc:mga0rr50_142424_c1
504 nmdc:mga0rr50_253173_c1
505 nmdc:mga0rr50_256353_c1
506 nmdc:mga08x19_12440_c1
507 nmdc:mga0a205_38478_c1
508 nmdc:mga0a205_91660_c1
509 Ga0501084_0002209
510 Ga0501084_0019646
511 Ga0501084_0147304
512 Ga0590071_001444
513 Ga0590075_034641
514 Ga0590077_007057
515 Ga0590077_026582
516 Ga0501082_0469735
517 Ga0530510_0069939
518 Ga0530510_0250010

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00117

GATase

Glutamine amidotransferase class-I

3

193

0.94

PF07722

Peptidase_C26

Peptidase C26

58

175

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
1qdl-assembly1.cif.gz_B-2 the crystal structure of anthranilate synthase from sulfolobus solfataricus 0.9234 2 189
8gr1-assembly4.cif.gz_D crystal structure of d110v/k151l mutant of gatase subunit of methanocaldococcus jannaschii gmp synthetase 0.9156 1 193
8gr3-assembly4.cif.gz_D crystal structure of k151l/y158f mutant of gatase subunit of methanocaldococcus jannaschii gmp synthetase 0.9148 1 193
8hx7-assembly1.cif.gz_B crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae co-crystallized with l-glutamine 0.9139 2 192
8hx6-assembly1.cif.gz_B crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae 0.9134 2 192
ID Description Score Start End Superfamily
af_P00903_1_187_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9637 1 190 3.40.50.880
af_P00903_1_187_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9537 1 190 3.40.50.880
af_Q2G099_1_189_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9412 1 191 3.40.50.880
af_K7L2D7_74_267_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9376 2 190 3.40.50.880
af_P9WN35_1_200_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9343 2 193 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A1F3B790-F1-model_v4 Aminodeoxychorismate/anthranilate synthase component II 0.9849 1 133 GO:0000162
GO:0004049
GO:0005829
AF-A0A7V1MHK6-F1-model_v4 Anthranilate/aminodeoxychorismate synthase component II (EC 4.1.3.27) 0.9848 1 112 GO:0000162
GO:0004049
GO:0005829
AF-A0A2E8YPJ4-F1-model_v4 Aminodeoxychorismate/anthranilate synthase component II 0.9838 1 129 GO:0000162
GO:0004049
GO:0005829
AF-A0A7X6A9Y6-F1-model_v4 deleted 0.9836 1 103
AF-A0A6V8PMB5-F1-model_v4 Anthranilate synthase component II 0.9827 1 133 GO:0000162
GO:0004049
GO:0005829

Map