F368668

General Info

Members Datasets Scaffolds Average Seq Length
259 186 518 349

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100017351|Ga0068855_1000173513
Length 403
Sequence LQQNNRQVAILRVPVPAAPWRMHRQALKRSLMAHLMSYKTMDDAATSVLERTADERDSHARQERGRLRDKLGRAITDLRVSVTDRCNFKCVYCRTGNEGAQYSELPIADYLRMVRRFVALGVEKVRLTGGEPLLRSGLLEMIGELAKMRTAYLPDGTSTEEGRPLDIALTTNGHLLEHMAGSLKEAGLNRITVSMDAVDAETFAAITRVPRSFDRVLAGIRQAKSVGLGPVKVNCVLLRGFNDGQIEQFAEFSRREGVIVRFIEFMPLEEDRSWRPETVVPMDEIVGRLDAYRPLVELPPNSVSETAKRFTFDDGLGEVGIIAPVSRPFCGHCSRVRLTSDGKIRTCLFSQSDHDLYGEMARGGTDSELDAYIRKVVMRKEARHHIGEPGFQKPSRNMVHIGG

Samples

Sample ID Description Type Environment
1 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
59 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
89 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
91 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
92 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
93 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
94 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
95 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
96 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
97 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
98 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
99 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
100 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
103 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
104 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
105 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
106 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
107 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
108 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
109 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
110 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
111 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
112 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
113 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
114 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
115 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
116 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
117 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
118 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
119 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
120 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
121 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
122 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
123 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
124 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
125 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
126 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
127 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
128 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
129 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
130 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
131 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
132 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
133 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
134 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
135 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
136 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
137 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
138 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
139 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
140 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
141 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
142 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
143 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
144 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
145 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
146 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
147 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
148 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
149 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
150 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
151 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
152 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
153 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
154 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
155 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
156 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
157 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
158 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
159 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
160 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
161 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
162 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
163 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
164 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
165 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
166 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
167 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
168 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
169 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
170 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
171 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
172 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
173 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
174 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
180 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
181 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
182 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
183 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
184 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
185 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
186 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.61
Metatranscriptomes 0
Isolates 0.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.54
Nodule 0
Rhizoplane 3.86
Rhizosphere 93.05
Stem 0
Stem Tuber 0
Unclassified 4.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068855_100017351 3300005563 Bacteria 8661
2 LJNas_1004155 3300000546 Bacteria 1618
3 Ga0070658_10000123 3300005327 Bacteria 68437
4 Ga0070658_10007083 3300005327 Bacteria 9051
5 Ga0070658_10013443 3300005327 Bacteria 6568
6 Ga0070658_10021523 3300005327 Bacteria 5168
7 Ga0070658_10231153 3300005327 Bacteria 1566
8 Ga0070676_10063644 3300005328 Bacteria 2198
9 Ga0070683_100051830 3300005329 Bacteria 3800
10 Ga0068869_100099591 3300005334 Bacteria 2197
11 Ga0070666_10163047 3300005335 Bacteria 1558
12 Ga0070682_100000108 3300005337 Bacteria 73708
13 Ga0068868_100037673 3300005338 Bacteria 3750
14 Ga0070660_100005679 3300005339 Bacteria 8647
15 Ga0070660_100155757 3300005339 Bacteria 1839
16 Ga0070660_100180979 3300005339 Bacteria 1706
17 Ga0070675_100009860 3300005354 Bacteria 7444
18 Ga0070671_100186851 3300005355 Bacteria 1756
19 Ga0070673_100106396 3300005364 Unclassified 2319
20 Ga0070667_100008150 3300005367 Bacteria 8684
21 Ga0070709_10083171 3300005434 Bacteria 2093
22 Ga0070714_100443743 3300005435 Bacteria 1232
23 Ga0070713_100065069 3300005436 Bacteria 3062
24 Ga0070713_100389069 3300005436 Bacteria 1301
25 Ga0070711_100008780 3300005439 Bacteria 6201
26 Ga0070711_100329130 3300005439 Bacteria 1223
27 Ga0070694_100000549 3300005444 Bacteria 20633
28 Ga0070708_100140846 3300005445 Bacteria 2236
29 Ga0070678_100031025 3300005456 Bacteria 3681
30 Ga0070681_10055673 3300005458 Bacteria 3937
31 Ga0070679_100094915 3300005530 Bacteria 2970
32 Ga0070684_100297557 3300005535 Bacteria 1480
33 Ga0068853_100015269 3300005539 Bacteria 6312
34 Ga0068853_100016186 3300005539 Bacteria 6134
35 Ga0070672_100201987 3300005543 Bacteria 1662
36 Ga0070696_100026019 3300005546 Bacteria 3981
37 Ga0070665_100043080 3300005548 Bacteria 4537
38 Ga0070665_100245475 3300005548 Bacteria 1791
39 Ga0068855_100035948 3300005563 Bacteria 5898
40 Ga0068857_100011874 3300005577 Bacteria 7579
41 Ga0068857_100139938 3300005577 Bacteria 2187
42 Ga0068854_100014668 3300005578 Bacteria 5169
43 Ga0068859_100004911 3300005617 Bacteria 13618
44 Ga0068864_100024965 3300005618 Bacteria 5029
45 Ga0068863_100045180 3300005841 Bacteria 4180
46 Ga0068863_100052369 3300005841 Bacteria 3869
47 Ga0068858_100062570 3300005842 Bacteria 3441
48 Ga0068862_100019825 3300005844 Bacteria 5616
49 Ga0070717_10153594 3300006028 Bacteria 1993
50 Ga0070717_10216419 3300006028 Bacteria 1682
51 Ga0070712_100023685 3300006175 Bacteria 4059
52 Ga0097621_100030856 3300006237 Bacteria 4246
53 Ga0068871_100022167 3300006358 Bacteria 4896
54 Ga0075436_100119347 3300006914 Bacteria 1844
55 Ga0097620_100004911 3300006931 Bacteria 13618
56 Ga0105245_10035686 3300009098 Bacteria 4414
57 Ga0105241_10085816 3300009174 Bacteria 2475
58 Ga0105242_10004045 3300009176 Bacteria 11391
59 Ga0105242_10011647 3300009176 Bacteria 6765
60 Ga0105248_10285714 3300009177 Unclassified 1857
61 Ga0105248_10450207 3300009177 Unclassified 1451
62 Ga0105238_10019046 3300009551 Bacteria 6992
63 Ga0105238_10079875 3300009551 Bacteria 3260
64 Ga0105239_10024475 3300010375 Bacteria 6652
65 Ga0157373_10132785 3300013100 Bacteria 1750
66 Ga0157370_10016565 3300013104 Bacteria 7457
67 Ga0157370_10017375 3300013104 Bacteria 7260
68 Ga0157370_10017653 3300013104 Bacteria 7193
69 Ga0157370_10040392 3300013104 Bacteria 4504
70 Ga0157370_10096811 3300013104 Bacteria 2769
71 Ga0157370_10204158 3300013104 Bacteria 1833
72 Ga0157370_10379842 3300013104 Bacteria 1301
73 Ga0157369_10002488 3300013105 Bacteria 22075
74 Ga0157369_10105058 3300013105 Bacteria 3007
75 Ga0157369_10131136 3300013105 Bacteria 2656
76 Ga0157369_10216638 3300013105 Bacteria 2005
77 Ga0157369_10229784 3300013105 Bacteria 1940
78 Ga0157374_10087379 3300013296 Bacteria 2967
79 Ga0157378_10187068 3300013297 Bacteria 1951
80 Ga0163162_10009504 3300013306 Bacteria 9456
81 Ga0163162_10153650 3300013306 Bacteria 2420
82 Ga0163162_10360318 3300013306 Bacteria 1587
83 Ga0163162_10458383 3300013306 Unclassified 1406
84 Ga0157372_10018603 3300013307 Bacteria 7474
85 Ga0157372_10022212 3300013307 Bacteria 6864
86 Ga0157372_10048373 3300013307 Bacteria 4727
87 Ga0157372_10110434 3300013307 Bacteria 3150
88 Ga0163163_10019119 3300014325 Bacteria 6428
89 Ga0157379_10060804 3300014968 Bacteria 3378
90 Ga0157376_10123056 3300014969 Bacteria 2302
91 Ga0163161_10005323 3300017792 Bacteria 8960
92 Ga0207647_10005119 3300025904 Bacteria 9652
93 Ga0207645_10016635 3300025907 Bacteria 4865
94 Ga0207705_10000100 3300025909 Bacteria 102196
95 Ga0207705_10000697 3300025909 Bacteria 27809
96 Ga0207705_10023157 3300025909 Bacteria 4430
97 Ga0207705_10053532 3300025909 Bacteria 2907
98 Ga0207705_10125322 3300025909 Bacteria 1909
99 Ga0207695_10187523 3300025913 Bacteria 1987
100 Ga0207693_10042087 3300025915 Bacteria 3596
101 Ga0207663_10006567 3300025916 Bacteria 5967
102 Ga0207657_10002479 3300025919 Bacteria 19972
103 Ga0207652_10118755 3300025921 Bacteria 2351
104 Ga0207694_10057183 3300025924 Bacteria 3032
105 Ga0207694_10114830 3300025924 Unclassified 2145
106 Ga0207659_10138037 3300025926 Bacteria 1889
107 Ga0207664_10015400 3300025929 Bacteria 5549
108 Ga0207664_10061857 3300025929 Bacteria 2988
109 Ga0207664_10133082 3300025929 Bacteria 2095
110 Ga0207644_10020488 3300025931 Bacteria 4497
111 Ga0207690_10198693 3300025932 Bacteria 1521
112 Ga0207706_10006098 3300025933 Bacteria 11190
113 Ga0207665_10019557 3300025939 Bacteria 4452
114 Ga0207711_10131039 3300025941 Unclassified 2248
115 Ga0207661_10042476 3300025944 Bacteria 3584
116 Ga0207667_10012563 3300025949 Bacteria 9741
117 Ga0207667_10035270 3300025949 Bacteria 5366
118 Ga0207667_10169514 3300025949 Bacteria 2244
119 Ga0207667_10217380 3300025949 Bacteria 1958
120 Ga0207651_10390045 3300025960 Bacteria 1182
121 Ga0207640_10013815 3300025981 Bacteria 4636
122 Ga0207677_10358317 3300026023 Bacteria 1224
123 Ga0207639_10028809 3300026041 Bacteria 4058
124 Ga0207639_10138269 3300026041 Bacteria 2026
125 Ga0207678_10003617 3300026067 Bacteria 13888
126 Ga0207708_10174427 3300026075 Bacteria 1704
127 Ga0207702_10034955 3300026078 Bacteria 4203
128 Ga0207641_10047902 3300026088 Bacteria 3606
129 Ga0207674_10000741 3300026116 Bacteria 42733
130 Ga0207674_10002288 3300026116 Bacteria 24294
131 Ga0207683_10026054 3300026121 Bacteria 5049
132 Ga0207698_10063124 3300026142 Bacteria 2897
133 Ga0207698_10363592 3300026142 Bacteria 1371
134 Ga0207428_10004537 3300027907 Bacteria 13168
135 Ga0268265_10059750 3300028380 Bacteria 2918
136 Ga0265325_10016133 3300031241 Unclassified 4180
137 Ga0265339_10077663 3300031249 Unclassified 1759
138 Ga0265316_10050267 3300031344 Unclassified 3279
139 Ga0307510_10008600 3300033180 Bacteria 12170
140 Ga0373926_0001222 3300035083 Bacteria 7727
141 Ga0373936_0026405 3300035113 Bacteria 2274
142 Ga0373945_0024505 3300035116 Bacteria 2091
143 Ga0373943_0024760 3300035170 Bacteria 2801
144 Ga0373924_0000605 3300035410 Bacteria 11072
145 Ga0373927_0072670 3300035695 Bacteria 2226
146 Ga0373937_0183117 3300036401 Bacteria 1967
147 Ga0373925_0155411 3300037068 Bacteria 1798
148 Ga0395900_0101446 3300037418 Bacteria 2956
149 Ga0395905_0050689 3300037471 Bacteria 3888
150 Ga0395905_0075307 3300037471 Bacteria 3164
151 Ga0395901_0157935 3300038443 Bacteria 2381
152 Ga0451577_0001555 3300042876 Bacteria 30103
153 Ga0453683_0046232 3300044673 Bacteria 2729
154 Ga0466966_0036261 3300044684 Bacteria 3185
155 Ga0453684_0000289 3300044712 Bacteria 215476
156 Ga0451576_0837456 3300045051 Unclassified 966
157 Ga0466967_0048458 3300045976 Bacteria 3710
158 Ga0495592_0118743 3300046454 Bacteria 1863
159 Ga0495603_0004829 3300046455 Bacteria 8059
160 Ga0495629_0015987 3300046459 Bacteria 5393
161 Ga0495629_0017442 3300046459 Bacteria 5145
162 Ga0495651_0007125 3300046462 Bacteria 8551
163 Ga0495651_0018665 3300046462 Bacteria 5374
164 Ga0495651_0036102 3300046462 Bacteria 3847
165 Ga0495650_0000038 3300046471 Bacteria 377530
166 Ga0495580_0042948 3300046472 Bacteria 3218
167 Ga0495582_0017138 3300046473 Bacteria 3964
168 Ga0495639_0001517 3300046475 Bacteria 10353
169 Ga0495639_0066597 3300046475 Bacteria 1658
170 Ga0495662_0003535 3300046476 Bacteria 7897
171 Ga0495664_0001394 3300046477 Bacteria 12779
172 Ga0495594_0000271 3300046499 Bacteria 25464
173 Ga0495594_0000738 3300046499 Bacteria 16779
174 Ga0495596_0009508 3300046500 Bacteria 4273
175 Ga0495583_0009042 3300046506 Bacteria 6002
176 Ga0495606_0197664 3300046507 Bacteria 1148
177 Ga0495608_0064521 3300046511 Bacteria 2401
178 Ga0495628_0018034 3300046516 Bacteria 5854
179 Ga0495630_0269346 3300046517 Bacteria 1301
180 Ga0495631_0042168 3300046518 Bacteria 2017
181 Ga0495644_0001275 3300046523 Bacteria 10320
182 Ga0495666_0004513 3300046526 Bacteria 7033
183 Ga0495652_0012379 3300046529 Bacteria 7697
184 Ga0495652_0194270 3300046529 Bacteria 1546
185 Ga0495640_0010457 3300046533 Bacteria 7168
186 Ga0495586_0002790 3300046535 Bacteria 9440
187 Ga0495587_0106443 3300046536 Bacteria 1613
188 Ga0495609_0011493 3300046538 Bacteria 4216
189 Ga0495645_0001790 3300046543 Bacteria 14589
190 Ga0495645_0013654 3300046543 Bacteria 5753
191 Ga0495645_0019491 3300046543 Bacteria 4883
192 Ga0495622_0010552 3300046557 Bacteria 4266
193 Ga0495633_0098191 3300046558 Bacteria 1360
194 Ga0495667_0034468 3300046559 Bacteria 3385
195 Ga0495656_0035629 3300046615 Bacteria 2045
196 Ga0495668_0025122 3300046616 Bacteria 3387
197 Ga0495634_0007775 3300046642 Bacteria 8018
198 Ga0495611_0011933 3300046648 Bacteria 3690
199 Ga0495625_0000102 3300046660 Bacteria 138850
200 Ga0495625_0011862 3300046660 Bacteria 7078
201 Ga0495625_0019124 3300046660 Bacteria 5327
202 Ga0495625_0094082 3300046660 Bacteria 2068
203 Ga0495635_0013012 3300046663 Bacteria 5824
204 Ga0495635_0076025 3300046663 Bacteria 2301
205 Ga0495659_0028723 3300046664 Bacteria 1926
206 Ga0495599_0011751 3300046678 Bacteria 5382
207 Ga0495623_0182113 3300046679 Unclassified 1220
208 Ga0495646_0015069 3300046680 Bacteria 4910
209 Ga0495669_0000797 3300046684 Bacteria 13470
210 Ga0495669_0015901 3300046684 Bacteria 3222
211 Ga0495669_0064718 3300046684 Bacteria 1659
212 Ga0495613_0001588 3300046689 Bacteria 17233
213 Ga0495613_0013987 3300046689 Bacteria 5956
214 Ga0495624_0016126 3300046690 Bacteria 5031
215 Ga0495670_0011916 3300046691 Unclassified 4278
216 Ga0495600_0013258 3300046809 Bacteria 5174
217 Ga0495600_0036369 3300046809 Bacteria 3200
218 Ga0495581_0006355 3300047315 Bacteria 6851
219 Ga0495604_0014806 3300047317 Bacteria 6220
220 Ga0495604_0133054 3300047317 Bacteria 1785
221 Ga0495604_0181575 3300047317 Bacteria 1471
222 Ga0495674_0011040 3300047319 Bacteria 8528
223 Ga0495672_0000587 3300047320 Bacteria 41091
224 Ga0495676_0002261 3300047321 Bacteria 17095
225 Ga0495680_0032838 3300047322 Bacteria 4208
226 Ga0495675_0009470 3300047444 Bacteria 6064
227 Ga0495684_0012414 3300047471 Bacteria 6570
228 Ga0495686_0000178 3300047472 Bacteria 121468
229 Ga0495686_0001346 3300047472 Bacteria 27456
230 Ga0495686_0005353 3300047472 Bacteria 10157
231 Ga0495593_0034936 3300047673 Bacteria 2732
232 Ga0495614_0007598 3300048089 Bacteria 4822
233 Ga0496101_0268859 3300048904 Bacteria 1331
234 Ga0496104_0000054 3300048907 Bacteria 132314
235 Ga0496104_0041415 3300048907 Bacteria 4319
236 Ga0496105_0158540 3300048908 Bacteria 1858
237 Ga0496107_0290730 3300048910 Bacteria 1216
238 Ga0496110_0306788 3300048913 Bacteria 1446
239 Ga0496111_0131806 3300048914 Bacteria 1850
240 Ga0496112_0011609 3300048915 Bacteria 8056
241 Ga0496112_0128764 3300048915 Bacteria 2502
242 Ga0496112_0419597 3300048915 Bacteria 1277
243 Ga0496126_0000014 3300048929 Bacteria 686881
244 Ga0496126_0000154 3300048929 Bacteria 159983
245 Ga0496126_0220608 3300048929 Bacteria 1593
246 Ga0501032_0098258 3300049569 Bacteria 1940
247 Ga0501034_0081140 3300049571 Bacteria 3246
248 Ga0501037_0086455 3300049573 Bacteria 2270
249 Ga0501038_0001016 3300049574 Bacteria 25252
250 Ga0501047_0039034 3300049581 Bacteria 4593
251 Ga0501070_0074255 3300049586 Bacteria 2815
252 Ga0501080_0074716 3300049742 Bacteria 3152
253 Ga0501044_0000651 3300049823 Bacteria 41968
254 Ga0495601_0003960 3300053077 Bacteria 8529
255 Ga0500651_0000005 3300053093 Bacteria 384761
256 Ga0500595_000004 3300053119 Bacteria 410922
257 Ga0500595_007895 3300053119 Bacteria 4379
258 Ga0500661_002468 3300055283 Bacteria 3484
259 2884217852 2884215851 Bacteria 4554841
260 Ga0068855_100017351
261 LJNas_1004155
262 Ga0070658_10000123
263 Ga0070658_10007083
264 Ga0070658_10013443
265 Ga0070658_10021523
266 Ga0070658_10231153
267 Ga0070676_10063644
268 Ga0070683_100051830
269 Ga0068869_100099591
270 Ga0070666_10163047
271 Ga0070682_100000108
272 Ga0068868_100037673
273 Ga0070660_100005679
274 Ga0070660_100155757
275 Ga0070660_100180979
276 Ga0070675_100009860
277 Ga0070671_100186851
278 Ga0070673_100106396
279 Ga0070667_100008150
280 Ga0070709_10083171
281 Ga0070714_100443743
282 Ga0070713_100065069
283 Ga0070713_100389069
284 Ga0070711_100008780
285 Ga0070711_100329130
286 Ga0070694_100000549
287 Ga0070708_100140846
288 Ga0070678_100031025
289 Ga0070681_10055673
290 Ga0070679_100094915
291 Ga0070684_100297557
292 Ga0068853_100015269
293 Ga0068853_100016186
294 Ga0070672_100201987
295 Ga0070696_100026019
296 Ga0070665_100043080
297 Ga0070665_100245475
298 Ga0068855_100035948
299 Ga0068857_100011874
300 Ga0068857_100139938
301 Ga0068854_100014668
302 Ga0068859_100004911
303 Ga0068864_100024965
304 Ga0068863_100045180
305 Ga0068863_100052369
306 Ga0068858_100062570
307 Ga0068862_100019825
308 Ga0070717_10153594
309 Ga0070717_10216419
310 Ga0070712_100023685
311 Ga0097621_100030856
312 Ga0068871_100022167
313 Ga0075436_100119347
314 Ga0097620_100004911
315 Ga0105245_10035686
316 Ga0105241_10085816
317 Ga0105242_10004045
318 Ga0105242_10011647
319 Ga0105248_10285714
320 Ga0105248_10450207
321 Ga0105238_10019046
322 Ga0105238_10079875
323 Ga0105239_10024475
324 Ga0157373_10132785
325 Ga0157370_10016565
326 Ga0157370_10017375
327 Ga0157370_10017653
328 Ga0157370_10040392
329 Ga0157370_10096811
330 Ga0157370_10204158
331 Ga0157370_10379842
332 Ga0157369_10002488
333 Ga0157369_10105058
334 Ga0157369_10131136
335 Ga0157369_10216638
336 Ga0157369_10229784
337 Ga0157374_10087379
338 Ga0157378_10187068
339 Ga0163162_10009504
340 Ga0163162_10153650
341 Ga0163162_10360318
342 Ga0163162_10458383
343 Ga0157372_10018603
344 Ga0157372_10022212
345 Ga0157372_10048373
346 Ga0157372_10110434
347 Ga0163163_10019119
348 Ga0157379_10060804
349 Ga0157376_10123056
350 Ga0163161_10005323
351 Ga0207647_10005119
352 Ga0207645_10016635
353 Ga0207705_10000100
354 Ga0207705_10000697
355 Ga0207705_10023157
356 Ga0207705_10053532
357 Ga0207705_10125322
358 Ga0207695_10187523
359 Ga0207693_10042087
360 Ga0207663_10006567
361 Ga0207657_10002479
362 Ga0207652_10118755
363 Ga0207694_10057183
364 Ga0207694_10114830
365 Ga0207659_10138037
366 Ga0207664_10015400
367 Ga0207664_10061857
368 Ga0207664_10133082
369 Ga0207644_10020488
370 Ga0207690_10198693
371 Ga0207706_10006098
372 Ga0207665_10019557
373 Ga0207711_10131039
374 Ga0207661_10042476
375 Ga0207667_10012563
376 Ga0207667_10035270
377 Ga0207667_10169514
378 Ga0207667_10217380
379 Ga0207651_10390045
380 Ga0207640_10013815
381 Ga0207677_10358317
382 Ga0207639_10028809
383 Ga0207639_10138269
384 Ga0207678_10003617
385 Ga0207708_10174427
386 Ga0207702_10034955
387 Ga0207641_10047902
388 Ga0207674_10000741
389 Ga0207674_10002288
390 Ga0207683_10026054
391 Ga0207698_10063124
392 Ga0207698_10363592
393 Ga0207428_10004537
394 Ga0268265_10059750
395 Ga0265325_10016133
396 Ga0265339_10077663
397 Ga0265316_10050267
398 Ga0307510_10008600
399 Ga0373926_0001222
400 Ga0373936_0026405
401 Ga0373945_0024505
402 Ga0373943_0024760
403 Ga0373924_0000605
404 Ga0373927_0072670
405 Ga0373937_0183117
406 Ga0373925_0155411
407 Ga0395900_0101446
408 Ga0395905_0050689
409 Ga0395905_0075307
410 Ga0395901_0157935
411 Ga0451577_0001555
412 Ga0453683_0046232
413 Ga0466966_0036261
414 Ga0453684_0000289
415 Ga0451576_0837456
416 Ga0466967_0048458
417 Ga0495592_0118743
418 Ga0495603_0004829
419 Ga0495629_0015987
420 Ga0495629_0017442
421 Ga0495651_0007125
422 Ga0495651_0018665
423 Ga0495651_0036102
424 Ga0495650_0000038
425 Ga0495580_0042948
426 Ga0495582_0017138
427 Ga0495639_0001517
428 Ga0495639_0066597
429 Ga0495662_0003535
430 Ga0495664_0001394
431 Ga0495594_0000271
432 Ga0495594_0000738
433 Ga0495596_0009508
434 Ga0495583_0009042
435 Ga0495606_0197664
436 Ga0495608_0064521
437 Ga0495628_0018034
438 Ga0495630_0269346
439 Ga0495631_0042168
440 Ga0495644_0001275
441 Ga0495666_0004513
442 Ga0495652_0012379
443 Ga0495652_0194270
444 Ga0495640_0010457
445 Ga0495586_0002790
446 Ga0495587_0106443
447 Ga0495609_0011493
448 Ga0495645_0001790
449 Ga0495645_0013654
450 Ga0495645_0019491
451 Ga0495622_0010552
452 Ga0495633_0098191
453 Ga0495667_0034468
454 Ga0495656_0035629
455 Ga0495668_0025122
456 Ga0495634_0007775
457 Ga0495611_0011933
458 Ga0495625_0000102
459 Ga0495625_0011862
460 Ga0495625_0019124
461 Ga0495625_0094082
462 Ga0495635_0013012
463 Ga0495635_0076025
464 Ga0495659_0028723
465 Ga0495599_0011751
466 Ga0495623_0182113
467 Ga0495646_0015069
468 Ga0495669_0000797
469 Ga0495669_0015901
470 Ga0495669_0064718
471 Ga0495613_0001588
472 Ga0495613_0013987
473 Ga0495624_0016126
474 Ga0495670_0011916
475 Ga0495600_0013258
476 Ga0495600_0036369
477 Ga0495581_0006355
478 Ga0495604_0014806
479 Ga0495604_0133054
480 Ga0495604_0181575
481 Ga0495674_0011040
482 Ga0495672_0000587
483 Ga0495676_0002261
484 Ga0495680_0032838
485 Ga0495675_0009470
486 Ga0495684_0012414
487 Ga0495686_0000178
488 Ga0495686_0001346
489 Ga0495686_0005353
490 Ga0495593_0034936
491 Ga0495614_0007598
492 Ga0496101_0268859
493 Ga0496104_0000054
494 Ga0496104_0041415
495 Ga0496105_0158540
496 Ga0496107_0290730
497 Ga0496110_0306788
498 Ga0496111_0131806
499 Ga0496112_0011609
500 Ga0496112_0128764
501 Ga0496112_0419597
502 Ga0496126_0000014
503 Ga0496126_0000154
504 Ga0496126_0220608
505 Ga0501032_0098258
506 Ga0501034_0081140
507 Ga0501037_0086455
508 Ga0501038_0001016
509 Ga0501047_0039034
510 Ga0501070_0074255
511 Ga0501080_0074716
512 Ga0501044_0000651
513 Ga0495601_0003960
514 Ga0500651_0000005
515 Ga0500595_000004
516 Ga0500595_007895
517 Ga0500661_002468
518 2884217852

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04055

Radical_SAM

Radical SAM superfamily

80

253

0.98

PF06463

Mob_synth_C

Molybdenum Cofactor Synthesis C

258

386

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fb2-assembly1.cif.gz_B structure of the moaa arg17/266/268/ala triple mutant 0.8922 28 344
1tv8-assembly1.cif.gz_A structure of moaa in complex with s-adenosylmethionine 0.8852 28 344
2fb2-assembly1.cif.gz_B structure of the moaa arg17/266/268/ala triple mutant 0.8475 28 344
1tv8-assembly1.cif.gz_A structure of moaa in complex with s-adenosylmethionine 0.8362 28 344
7voc-assembly1.cif.gz_C the crystal structure of a radical sam enzyme blse involved in the biosynthesis of blasticidin s 0.82 38 253
ID Description Score Start End Superfamily
af_P9WJS3_16_359_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9181 28 343 3.20.20.70
af_I1KTQ5_72_400_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9074 29 366 3.20.20.70
af_P9WJS1_27_360_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9033 26 366 3.20.20.70
af_P9WJS1_27_360_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9007 26 366 3.20.20.70
af_I1KTQ5_72_400_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.894 29 366 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A2W0BM66-F1-model_v4 GTP 3',8-cyclase (EC 4.1.99.22) (Molybdenum cofactor biosynthesis protein A) 0.9685 28 366 GO:0005525
GO:0006777
GO:0046872
GO:0051539
GO:0061798
GO:0061799
GO:1904047
AF-A0A2W0BM66-F1-model_v4 GTP 3',8-cyclase (EC 4.1.99.22) (Molybdenum cofactor biosynthesis protein A) 0.9628 28 366 GO:0005525
GO:0006777
GO:0046872
GO:0051539
GO:0061798
GO:0061799
GO:1904047
AF-A0A2V2UEZ3-F1-model_v4 GTP 3',8-cyclase MoaA 0.959 99 346 GO:0005525
GO:0006777
GO:0046872
GO:0051539
GO:0061798
GO:0061799
AF-F4ZCI7-F1-model_v4 Molybdenum cofactor biosynthesis protein 0.9563 131 273 GO:0006777
GO:0046872
GO:0051536
GO:0061798
GO:0061799
AF-C4B482-F1-model_v4 deleted 0.9529 94 343

Map